Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|6301
Gene name
LocationContig_57:707..4870
Strand-
Gene length (bp)4163
Transcript length (bp)2682
Coding sequence length (bp)2682
Protein length (aa) 894

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12157 DUF3591 Protein of unknown function (DUF3591) 1.7E-126 302 673

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q09813|T111_SCHPO Putative transcription initiation factor TFIID 111 kDa subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC2G11.14 PE=1 SV=1 248 860 4.0E-126
sp|P46677|TAF1_YEAST Transcription initiation factor TFIID subunit 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TAF1 PE=1 SV=1 254 859 6.0E-92
sp|P51123|TAF1_DROME Transcription initiation factor TFIID subunit 1 OS=Drosophila melanogaster GN=Taf1 PE=1 SV=3 315 619 5.0E-35
sp|Q60544|TAF1_MESAU Transcription initiation factor TFIID subunit 1 OS=Mesocricetus auratus GN=TAF1 PE=2 SV=1 315 619 1.0E-32
sp|P21675|TAF1_HUMAN Transcription initiation factor TFIID subunit 1 OS=Homo sapiens GN=TAF1 PE=1 SV=2 315 619 1.0E-32
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q09813|T111_SCHPO Putative transcription initiation factor TFIID 111 kDa subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC2G11.14 PE=1 SV=1 248 860 4.0E-126
sp|P46677|TAF1_YEAST Transcription initiation factor TFIID subunit 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TAF1 PE=1 SV=1 254 859 6.0E-92
sp|P51123|TAF1_DROME Transcription initiation factor TFIID subunit 1 OS=Drosophila melanogaster GN=Taf1 PE=1 SV=3 315 619 5.0E-35
sp|Q60544|TAF1_MESAU Transcription initiation factor TFIID subunit 1 OS=Mesocricetus auratus GN=TAF1 PE=2 SV=1 315 619 1.0E-32
sp|P21675|TAF1_HUMAN Transcription initiation factor TFIID subunit 1 OS=Homo sapiens GN=TAF1 PE=1 SV=2 315 619 1.0E-32
sp|Q8IZX4|TAF1L_HUMAN Transcription initiation factor TFIID subunit 1-like OS=Homo sapiens GN=TAF1L PE=1 SV=1 315 619 7.0E-32
sp|Q54DH8|TAF1_DICDI Transcription initiation factor TFIID subunit 1 OS=Dictyostelium discoideum GN=taf1 PE=3 SV=1 315 619 9.0E-32
sp|Q80UV9|TAF1_MOUSE Transcription initiation factor TFIID subunit 1 OS=Mus musculus GN=Taf1 PE=1 SV=2 315 619 1.0E-31
sp|G5EGM3|TAF1_CAEEL Transcription initiation factor TFIID subunit 1 OS=Caenorhabditis elegans GN=taf-1 PE=2 SV=1 313 619 1.0E-29
sp|Q8LRK9|TAF1_ARATH Transcription initiation factor TFIID subunit 1 OS=Arabidopsis thaliana GN=TAF1 PE=1 SV=1 289 615 2.0E-25
sp|Q67W65|TAF1_ORYSJ Transcription initiation factor TFIID subunit 1 OS=Oryza sativa subsp. japonica GN=TAF1 PE=2 SV=1 306 620 2.0E-24
sp|Q6PUA2|TAF1B_ARATH Transcription initiation factor TFIID subunit 1b OS=Arabidopsis thaliana GN=TAF1B PE=2 SV=1 309 619 4.0E-23
sp|P51123|TAF1_DROME Transcription initiation factor TFIID subunit 1 OS=Drosophila melanogaster GN=Taf1 PE=1 SV=3 726 862 4.0E-08
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4351
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3921
Ophiocordyceps australis map64 (Brazil) OphauB2|6301 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|02459
Ophiocordyceps camponoti-rufipedis Ophun1|3747
Ophiocordyceps kimflemingae Ophio5|4699
Ophiocordyceps subramaniannii Hirsu2|8945

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|6301
MAQEFSSLDEDAWKAQDARDEREIARLLEQSQEGGSGGLTLDDTPFDQTNKADDAQDFEDISDDDLPDEEPGVST
SLELPGLTDDGGTSNDADDLFGEGPSSPSDPILATDSQPALLFPGIINTAGAQDGKNHLDGAVNQDPDIPAPAET
IEDLIKATYPAFVKGRTVKWNKAQLFPNETQDENTIELADESDSELVVEAADAAYDANKAAEKESVIKRRRIVKK
GLPEIPRWAAPSFDNHEQMTARGAKRVYLDSSDPYLLIETERFNLSNDEAYEMLKENHQNKLTWPYYKVKLAGTT
DEYHHLSMNDNSTAVLFEYCEPRPRVLNNFGMGNRLINYYRRKDTNDEDQLPKQELGEYRMLLPEDRSPFSLFGT
VDPGETVPTLHNEMFRAPVFKHNPRDTDFLVVRNTTGIEGSHWYLRKIDHLHVVGQAFPMKMLAFRLIRHSETDN
CQLADITKHIADSTDTQNRQKLKEFLQYDRDSVEKGMWRLKAGEILPDENAIRAMIKPEEVSLLDAMQLGIKELE
DAGYDPRNANIDDEQMADADAEEEEVDDEASKLTKGAKKAAEKQEETLADKMAPWKTTKAFIDACAQKAMLQLHG
EGDPTGHGLGFSFIRTSMKGGYIEAVQGPLATSADAMEREKRANGGHAYNVKKQQAMYEEGIREIWEKQRASLSD
GREHDDKDVAVTEDEDERFNVNANTAATPAHFDEGFSQISGFTSSSRHLKRAIRITREVQMADGTRQKRIEVVHD
PVVISQYMKRRTEADLESKDIYTSRPTGNADHDRLANLRIKKELERLEKNKARRQAREQQKELHQKAHAGDALSP
GAGGIDKIATGTTRKCANCGQVGHIKTNKKLCPLLNGTMKTDKSSAEHGGFGNYNASGMGLGAGSPAS*
Coding >OphauB2|6301
ATGGCGCAAGAATTCTCGTCTCTCGACGAGGATGCCTGGAAGGCACAAGATGCCCGCGATGAGCGCGAAATTGCT
CGCCTTCTTGAACAGAGCCAAGAGGGCGGCAGTGGCGGCCTGACCCTCGACGACACTCCTTTTGACCAGACTAAC
AAGGCCGACGACGCTCAAGACTTCGAAGACATTAGCGACGATGACTTGCCCGATGAGGAGCCTGGAGTCAGCACC
TCACTCGAGCTCCCCGGTCTTACCGACGATGGCGGGACGAGCAACGATGCGGACGACCTCTTCGGTGAAGGCCCC
TCGTCTCCCTCTGACCCTATTCTGGCCACCGACTCGCAGCCTGCCCTTTTATTCCCTGGAATCATCAACACGGCT
GGCGCCCAGGATGGAAAGAACCATCTCGATGGTGCTGTTAACCAGGATCCCGATATCCCAGCACCTGCCGAAACT
ATCGAGGACCTGATCAAGGCAACTTATCCAGCCTTTGTAAAGGGGCGTACCGTGAAGTGGAACAAGGCACAGCTA
TTTCCGAATGAGACTCAAGACGAGAATACCATCGAGCTTGCGGATGAATCTGATTCGGAGCTCGTGGTCGAAGCT
GCCGATGCGGCATACGATGCAAATAAGGCTGCCGAAAAAGAGTCTGTTATCAAAAGGCGAAGGATAGTCAAGAAG
GGACTTCCAGAGATACCGCGCTGGGCCGCACCTTCATTTGACAATCACGAGCAAATGACAGCACGAGGCGCTAAG
CGTGTCTATCTCGACTCGTCAGACCCTTATCTCCTGATTGAAACGGAACGCTTCAACTTGTCCAACGACGAGGCC
TATGAGATGCTCAAGGAGAATCATCAGAACAAGCTCACCTGGCCTTACTATAAAGTCAAGTTGGCAGGAACCACT
GACGAATACCATCATTTGAGTATGAATGACAACTCGACTGCCGTTCTCTTCGAATACTGCGAACCCCGGCCGAGA
GTTCTCAACAACTTTGGAATGGGCAACAGACTCATTAACTACTATCGGCGGAAAGACACAAATGATGAAGACCAA
CTCCCCAAGCAAGAATTGGGCGAATATCGAATGCTTTTGCCCGAGGATAGATCACCCTTTTCGCTATTTGGCACG
GTCGATCCTGGCGAGACGGTGCCCACGCTGCACAATGAAATGTTTCGCGCTCCCGTCTTCAAACATAATCCACGA
GATACCGACTTCCTCGTTGTACGCAACACGACTGGAATCGAGGGTTCGCACTGGTATCTTCGCAAAATTGATCAT
CTTCACGTCGTGGGCCAGGCATTTCCAATGAAGATGCTTGCCTTTCGCCTCATCAGGCATAGTGAGACTGACAAT
TGTCAATTGGCTGACATTACCAAGCATATTGCCGACTCGACAGATACGCAGAATCGACAGAAGCTCAAGGAGTTC
CTTCAGTACGATCGCGACAGCGTCGAGAAAGGCATGTGGAGACTCAAGGCAGGAGAAATCCTTCCTGATGAGAAT
GCAATACGTGCCATGATCAAGCCGGAAGAAGTGAGCTTGCTCGATGCAATGCAGCTTGGGATCAAGGAGCTCGAA
GATGCTGGATACGATCCTCGCAATGCAAACATTGATGATGAACAAATGGCCGATGCCGACGCTGAAGAAGAGGAG
GTGGACGACGAAGCAAGCAAGTTGACTAAGGGAGCCAAGAAAGCAGCCGAGAAACAGGAGGAGACGCTGGCGGAC
AAGATGGCGCCGTGGAAGACGACCAAGGCTTTTATCGATGCATGTGCACAAAAGGCCATGTTGCAGTTGCACGGT
GAAGGCGATCCGACGGGCCACGGTCTAGGTTTTAGCTTTATTCGCACCTCTATGAAAGGGGGTTACATTGAAGCA
GTTCAGGGTCCACTGGCTACGTCTGCCGATGCCATGGAGCGAGAGAAGCGGGCCAATGGCGGGCATGCCTACAAT
GTCAAGAAGCAGCAGGCCATGTACGAAGAAGGCATTCGGGAAATTTGGGAGAAGCAACGAGCGTCGTTGTCTGAT
GGTCGAGAGCATGACGATAAAGACGTGGCAGTGACGGAAGACGAAGACGAGCGATTCAATGTGAATGCCAACACA
GCCGCCACTCCGGCGCACTTTGACGAGGGCTTTAGCCAGATCAGTGGATTCACGTCAAGCAGCCGCCACCTAAAG
CGAGCAATACGCATCACCAGAGAGGTGCAGATGGCCGACGGAACGAGGCAGAAGCGTATTGAAGTTGTTCATGAC
CCCGTCGTTATTTCACAGTATATGAAGCGGCGCACCGAAGCCGACCTGGAATCCAAAGACATATATACGTCCAGG
CCTACGGGCAATGCCGACCATGACCGTCTTGCAAACCTTAGAATCAAAAAGGAACTCGAGCGACTTGAGAAGAAC
AAGGCCAGAAGACAAGCTCGAGAGCAGCAAAAGGAGCTACATCAAAAAGCCCATGCCGGTGACGCACTGTCTCCA
GGCGCCGGCGGAATTGACAAGATTGCAACAGGAACTACACGGAAGTGTGCCAATTGCGGTCAGGTCGGACACATC
AAAACTAATAAAAAGCTATGCCCTCTGCTTAACGGTACAATGAAGACGGACAAGAGCTCAGCCGAACACGGTGGA
TTTGGCAATTATAACGCTTCAGGTATGGGATTGGGTGCTGGCTCTCCAGCATCGTGA
Transcript >OphauB2|6301
ATGGCGCAAGAATTCTCGTCTCTCGACGAGGATGCCTGGAAGGCACAAGATGCCCGCGATGAGCGCGAAATTGCT
CGCCTTCTTGAACAGAGCCAAGAGGGCGGCAGTGGCGGCCTGACCCTCGACGACACTCCTTTTGACCAGACTAAC
AAGGCCGACGACGCTCAAGACTTCGAAGACATTAGCGACGATGACTTGCCCGATGAGGAGCCTGGAGTCAGCACC
TCACTCGAGCTCCCCGGTCTTACCGACGATGGCGGGACGAGCAACGATGCGGACGACCTCTTCGGTGAAGGCCCC
TCGTCTCCCTCTGACCCTATTCTGGCCACCGACTCGCAGCCTGCCCTTTTATTCCCTGGAATCATCAACACGGCT
GGCGCCCAGGATGGAAAGAACCATCTCGATGGTGCTGTTAACCAGGATCCCGATATCCCAGCACCTGCCGAAACT
ATCGAGGACCTGATCAAGGCAACTTATCCAGCCTTTGTAAAGGGGCGTACCGTGAAGTGGAACAAGGCACAGCTA
TTTCCGAATGAGACTCAAGACGAGAATACCATCGAGCTTGCGGATGAATCTGATTCGGAGCTCGTGGTCGAAGCT
GCCGATGCGGCATACGATGCAAATAAGGCTGCCGAAAAAGAGTCTGTTATCAAAAGGCGAAGGATAGTCAAGAAG
GGACTTCCAGAGATACCGCGCTGGGCCGCACCTTCATTTGACAATCACGAGCAAATGACAGCACGAGGCGCTAAG
CGTGTCTATCTCGACTCGTCAGACCCTTATCTCCTGATTGAAACGGAACGCTTCAACTTGTCCAACGACGAGGCC
TATGAGATGCTCAAGGAGAATCATCAGAACAAGCTCACCTGGCCTTACTATAAAGTCAAGTTGGCAGGAACCACT
GACGAATACCATCATTTGAGTATGAATGACAACTCGACTGCCGTTCTCTTCGAATACTGCGAACCCCGGCCGAGA
GTTCTCAACAACTTTGGAATGGGCAACAGACTCATTAACTACTATCGGCGGAAAGACACAAATGATGAAGACCAA
CTCCCCAAGCAAGAATTGGGCGAATATCGAATGCTTTTGCCCGAGGATAGATCACCCTTTTCGCTATTTGGCACG
GTCGATCCTGGCGAGACGGTGCCCACGCTGCACAATGAAATGTTTCGCGCTCCCGTCTTCAAACATAATCCACGA
GATACCGACTTCCTCGTTGTACGCAACACGACTGGAATCGAGGGTTCGCACTGGTATCTTCGCAAAATTGATCAT
CTTCACGTCGTGGGCCAGGCATTTCCAATGAAGATGCTTGCCTTTCGCCTCATCAGGCATAGTGAGACTGACAAT
TGTCAATTGGCTGACATTACCAAGCATATTGCCGACTCGACAGATACGCAGAATCGACAGAAGCTCAAGGAGTTC
CTTCAGTACGATCGCGACAGCGTCGAGAAAGGCATGTGGAGACTCAAGGCAGGAGAAATCCTTCCTGATGAGAAT
GCAATACGTGCCATGATCAAGCCGGAAGAAGTGAGCTTGCTCGATGCAATGCAGCTTGGGATCAAGGAGCTCGAA
GATGCTGGATACGATCCTCGCAATGCAAACATTGATGATGAACAAATGGCCGATGCCGACGCTGAAGAAGAGGAG
GTGGACGACGAAGCAAGCAAGTTGACTAAGGGAGCCAAGAAAGCAGCCGAGAAACAGGAGGAGACGCTGGCGGAC
AAGATGGCGCCGTGGAAGACGACCAAGGCTTTTATCGATGCATGTGCACAAAAGGCCATGTTGCAGTTGCACGGT
GAAGGCGATCCGACGGGCCACGGTCTAGGTTTTAGCTTTATTCGCACCTCTATGAAAGGGGGTTACATTGAAGCA
GTTCAGGGTCCACTGGCTACGTCTGCCGATGCCATGGAGCGAGAGAAGCGGGCCAATGGCGGGCATGCCTACAAT
GTCAAGAAGCAGCAGGCCATGTACGAAGAAGGCATTCGGGAAATTTGGGAGAAGCAACGAGCGTCGTTGTCTGAT
GGTCGAGAGCATGACGATAAAGACGTGGCAGTGACGGAAGACGAAGACGAGCGATTCAATGTGAATGCCAACACA
GCCGCCACTCCGGCGCACTTTGACGAGGGCTTTAGCCAGATCAGTGGATTCACGTCAAGCAGCCGCCACCTAAAG
CGAGCAATACGCATCACCAGAGAGGTGCAGATGGCCGACGGAACGAGGCAGAAGCGTATTGAAGTTGTTCATGAC
CCCGTCGTTATTTCACAGTATATGAAGCGGCGCACCGAAGCCGACCTGGAATCCAAAGACATATATACGTCCAGG
CCTACGGGCAATGCCGACCATGACCGTCTTGCAAACCTTAGAATCAAAAAGGAACTCGAGCGACTTGAGAAGAAC
AAGGCCAGAAGACAAGCTCGAGAGCAGCAAAAGGAGCTACATCAAAAAGCCCATGCCGGTGACGCACTGTCTCCA
GGCGCCGGCGGAATTGACAAGATTGCAACAGGAACTACACGGAAGTGTGCCAATTGCGGTCAGGTCGGACACATC
AAAACTAATAAAAAGCTATGCCCTCTGCTTAACGGTACAATGAAGACGGACAAGAGCTCAGCCGAACACGGTGGA
TTTGGCAATTATAACGCTTCAGGTATGGGATTGGGTGCTGGCTCTCCAGCATCGTGA
Gene >OphauB2|6301
ATGGCGCAAGAATTCTCGTCTCTCGACGAGGATGCCTGGAAGGCACAAGATGCCCGCGATGAGCGCGAAATTGCT
CGCCTTCTTGAACAGAGCCAAGAGGGCGGCAGTGGCGGCCTGACCCTCGACGACACTCCTTTTGACCAGACTAAC
AAGGCCGACGACGCTCAAGACTTCGAAGACATTAGCGACGATGACTTGCCCGATGAGGAGCCTGGAGTCAGCACC
TCACTCGAGCTCCCCGGTCTTACCGACGATGGCGGGACGAGCAACGATGCGGACGACCTCTTCGGTGAAGGCCCC
TCGTCTCCCTCTGACCCTATTCTGGGTCGTTTATCCCCAACTCCTCAGGTGCAAGGAGCTGTTGAGGCTATAGCC
ACCGACTCGCAGCCTGCCCTTTTATTCCCTGGAATCATCAACACGGCTGGCGCCCAGGATGGAAGTGCTCAAACC
CAGTTCGCAGAGGGACAATCCAGCTTCTCAACAATCGCTTACGACGTAGAGAACCATCTCGATGGTGCTGTTAAC
CAGGATCCCGATATCCCAGCACCTGCCGAAACTATCGAGGACCTGATCAAGGCAACTTATCCAGCCTTTGTAAAG
GGGCGTACCGTGAAGTGGAACAAGGTCTTGCCACCTAAAGAGGCAATCTGGAAAGAAAAGAAGCCGACGAAAAAA
CCGAAACATCTTGTCACAAGCAAATTGGCTCTCGAACTGGCTCCTGATCAGGCACAGCTATTTCGTACGCCCGAA
AGTTCGGAAACAAAACTCCAGTCTCGAAACCACGAGACCCTGTCCGGCCTCGTCATGGTCGCTTGCGAAACCCCA
GCGAATGAGACTCAAGACGAGAATACCATCGAGCTTGCGGATGAATCTGATTCGGAGCTCGTGGGTGGCTTCAGT
TTAGCGGATATTATACTGGCGTGTGAGGATTTCGGCGCCCAAGTCGAAGCTGCCGATGCGGCATACGATGCAAAT
AAGGCTGCCGAAAAAGAGGTGATTTCTCGCAAAAAACGTCCTTTCGATGCAGATCAAGACGACGAATGGGACGCC
GAGTTTTTACCTGATGCCGTTGAAGACGTACAGTCTGTTATCAAAAGGCGAAGGATAGTCAAGAAGGGACTTCCA
GAGATACCGCGCTGGGCCGCACCTTCATTTGACAATCACGAGCAAATGACAGCACGAGGCGCTAAGCGTGTCTAT
CTCGACTCGTCAGACCCTTATCTCCTGATTGAAACGGAGTCACAACCAGCTGCCAAGCGACCACGCCTTGATCCT
GGCTCACAGGCTGGAGAGACTCGAAAACTAAGCCGTGATTTATCCAGACGCTTCAACTTGTCCAACGACGAGGCC
TATGAGATGCTCAAGGAGAATCATCAGAACAAGGTTCGAGCGACGCTTGGCAACATTTCAGTCGAGCACAGCATG
CCCGCCATCAAGCTCACCTGGCCTTACTATAAAGTCAAGTTGGCAGGAACCACTGACGAATACCATCGTCCCCGT
TTCCGTTATAAGAAATTTGCTGGTCACTTAATCAAGTTTGACAAATTATTGCATCAAAAACGGAAGCAAATGAGA
GGCAAGGCGCACGAAGTCTTTGTTCACTCTAAAGATTTGAGTATGAATGACAACTCGACTGCCGTTCTCTTCGAA
TACTGCGAACCCCGGCCGAGAGTTCTCAACAACTTTGGAATGGGCAACAGACTCATTAACTACTATCGGCGGAAA
GACACAAATGATGAAGACCAACTCCCCAAGCAAGAATTGGGCGAATATCGAATGCTTTTGCCCGAGGATAGATCA
CCCTTTTCGCTATTTGGCACGGTCGATCCTGGCGAGACGGTGCCCACGCTGCACAATGAAATGTTTCGCGCTCCC
GTCTTCAAACATAATCCACGAGATACCGACTTCCTCGTTGTACGCAACACGACTGGAATCGAGGGTTCGCACTGG
TATCTTCGCAAAATTGATCATCTTCACGTCGTGGGCCAGGCATTTCCGTCGGTCGAAGTACCGGGTCCTCACAGC
AGGAAGGTTACCAACGCATCAAAAAACAGAATGAAGATGCTTGCCTTTCGCCTCATCAGGCATAGTGAGACTGAC
AATTGTCAATTGGCTGACATTACCAAGCATATTGCCGACTCGACAGATACGCAGAATCGACAGAAGCTCAAGGAG
TTCCTTCAGTACGATCGCGACAGCGTCGAGAAAGGCATGTGGAGACTCAAGGCAGGAGAAATCCTTCCTGATGAG
AATGCAATACGTGCCATGATCAAGCCGGAAGAAGTGAGCTTGCTCGATGCAATGCAGCTTGGGATCAAGGAGCTC
GAAGATGCTGGATACGATCCTCGCAATGCAAACATTGATGATGAACAAATGGCCGATGCCGACGCTGAAGAAGAG
GAGGTGGACGACGAAGCAAGCAAGTTGACTAAGGGAGCCAAGAAAGCAGCCGAGAAACAGGAGGAGACGCTGGCG
GACAAGATGGCGCCGTGGAAGACGACCAAGGCTTTTATCGATGCATGTGCACAAAAGGCCATGTTGCAGTTGCAC
GGTGAAGGCGATCCGACGGGCCACGGTCTAGGTTTTAGCTTTATTCGCACCTCTATGAAAGGGGGTTACATTGAA
GCAGTTCAGGGTCCACTGGCTACGTCTGCCGATGCCATGGAGCGAGAGAAGCGGGCCAATGGCGGGCATGCCTAC
AATGTCAAGAAGCAGCAGGCCATGTACGAAGAAGGCATTCGGGAAATTTGGGAGAAGCAACGAGCGTCGTTGTCT
GATGGTCGAGAGCATGACGATAAAGACGTGGCAGTGACGGAAGACGAAGACGAGCGATTCAATGTGAATGCCAAC
ACAGCCGCCACTCCGGCGCACTTTGACGAGGGCTTTAGCCAGATCAGTGGATTCACGTCAAGCAGCCGCCACCTA
AAGCGAGCAATACGCATCACCAGAGAGGTGCAGATGGCCGACGGAACGAGGCAGAAGCGTATTGAAGTTGTTCAT
GACCCCGTCGTTATTTCACAGTATATGAAGCGGCGCACCGAAGCCGACCTGGAATCCAAAGAGTACGTCAGACCC
AGTTGTGTTTCTGGAGGTTCCAAGAAGCGATTGCCGCCATCGGTTCTAGCTCTGTTTCGGTGGGCAAGGTATTCG
AAAAAGCATCTGCTCCCGAAACATGAACGGCAGGGCTCTTGGACTCCTCCAGGCGCCATGTTTGATTGCGTTGGA
ATGGAGTGGAGAGCGCCTGCTTACACGTATTTTTCTTCAGCATATATACGTCCAGGCCTACGGGCAATGCCGACC
ATGACCGTCTTGCAAACCTTAGGTAGGCCGCTACTTACGTCTTGATTTGAACATCAACAGAGGACTGACTATATA
CGCATAGAATCAAAAAGGAACTCGAGCGACTTGAGAAGAACAAGGCCAGAAGACAAGCTCGAGAGCAGCAAAAGG
AGCTACATCAAAAAGCCCATGCCGGTGACGCACTGTCTCCAGGCGCCGGCGGAATTGACAAGATTGCAACAGGAA
CTACACGGAAGTGTGCCAATTGCGGTCAGGTCGGACACATCAAAACTAATAAAAAGTATGCCATCCCCTTGCTCT
CCCCCGCCTGATGTCACTTTTGATTGGTTTGGTGCCACGAACTCGGACGGGAAAGCTGGAAACGGAAAGAAAAGA
CGCCAAACTGCGCTGCGTCGGTTGATGAAGCAGGCATCCGCCAAGAGACGCAAGAAAGAAAAACGGGAAGCCACT
CAAGAGAGGATTGCAGCAAGAGAGGCTAGAAAGGAAGAAAGGCGCCGGGAAAAAGAAGCAGTCAAGAAAGAAAAG
GAAGAAAGACGTCTAGAAAGGGGAGAACGTCGAAGGCGCAAATAAGATGCCGTCTGGGAAAAAGAGCAAATATTA
GGGGCTGAAGAAAAGCCAAGCCAAGCCTCGATTCAATCCTGGCCCCGTTCTGAGATAGCTTGCGTTTGTTTTATT
TTTTTTCTTTCCTATTTATTTGCCGTTTCTGACGTGGACTATTTGACTAACGTTTGCTTTGCTTTTATAGGCTAT
GCCCTCTGCTTAACGGTACAATGAAGACGGACAAGAGCTCAGCCGAACACGGTGGATTTGGCAATTATAACGCTT
CAGGTATGGGATTGGGTGCTGGCTCTCCAGCATCGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail