Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|6295
Gene name
LocationContig_56:108439..109447
Strand+
Gene length (bp)1008
Transcript length (bp)1008
Coding sequence length (bp)1008
Protein length (aa) 336

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12906 RINGv RING-variant domain 1.3E-08 104 144

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P2E8|MARH4_HUMAN E3 ubiquitin-protein ligase MARCH4 OS=Homo sapiens GN=MARCH4 PE=2 SV=2 68 184 9.0E-08
sp|Q0P496|MARH4_DANRE E3 ubiquitin-protein ligase MARCH4 OS=Danio rerio GN=march4 PE=2 SV=1 101 184 2.0E-07
sp|Q80TE3|MARH4_MOUSE E3 ubiquitin-protein ligase MARCH4 OS=Mus musculus GN=March4 PE=2 SV=3 67 184 6.0E-07
sp|Q86YJ5|MARH9_HUMAN E3 ubiquitin-protein ligase MARCH9 OS=Homo sapiens GN=MARCH9 PE=1 SV=2 101 184 6.0E-07
sp|Q3TZ87|MARH9_MOUSE E3 ubiquitin-protein ligase MARCH9 OS=Mus musculus GN=March9 PE=2 SV=1 101 184 7.0E-07
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P2E8|MARH4_HUMAN E3 ubiquitin-protein ligase MARCH4 OS=Homo sapiens GN=MARCH4 PE=2 SV=2 68 184 9.0E-08
sp|Q0P496|MARH4_DANRE E3 ubiquitin-protein ligase MARCH4 OS=Danio rerio GN=march4 PE=2 SV=1 101 184 2.0E-07
sp|Q80TE3|MARH4_MOUSE E3 ubiquitin-protein ligase MARCH4 OS=Mus musculus GN=March4 PE=2 SV=3 67 184 6.0E-07
sp|Q86YJ5|MARH9_HUMAN E3 ubiquitin-protein ligase MARCH9 OS=Homo sapiens GN=MARCH9 PE=1 SV=2 101 184 6.0E-07
sp|Q3TZ87|MARH9_MOUSE E3 ubiquitin-protein ligase MARCH9 OS=Mus musculus GN=March9 PE=2 SV=1 101 184 7.0E-07
sp|A6NNE9|MARHB_HUMAN E3 ubiquitin-protein ligase MARCH11 OS=Homo sapiens GN=MARCH11 PE=2 SV=3 102 194 3.0E-06
sp|A6P320|MARHB_RAT E3 ubiquitin-protein ligase MARCH11 OS=Rattus norvegicus GN=March11 PE=1 SV=1 102 194 7.0E-06
sp|Q8CBH7|MARHB_MOUSE E3 ubiquitin-protein ligase MARCH11 OS=Mus musculus GN=March11 PE=2 SV=2 102 194 7.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0008270 zinc ion binding Yes
GO:0046872 metal ion binding No
GO:0003674 molecular_function No
GO:0005488 binding No
GO:0043167 ion binding No
GO:0046914 transition metal ion binding No
GO:0043169 cation binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 16 0.45

Transmembrane Domains

Domain # Start End Length
1 166 188 22
2 232 254 22
3 275 297 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|6295
MDSQATWNWGAASGHDAGPDASSSRGRHEPSRQHLDGQSPQNEPPSPSHQQPQPPPRSRRYGPRTCRICLETEQP
RYPTGLTSTFGISSSSSQPTYVSDDPELGRLLSPCRCKGSQKYVHEGCLTSWRMANPMATTNYWQCPTCKFSYRL
VRMQWASMLSSKWAQVGLTLTALVLGIFLLGFIADPILDLWFDPVGTISDTVANVVSDIEAHRPPPYQEPTTWSE
HFTKGFFSLGFVGFIKSVVAMGPWQWLNLRNSGLLGSGRRRGTGRARMDNFNILFVLIGTFTFLMAIWKLVNAVS
ARVLKVVSDKVLDVGTDDDDDDDEGDDEDNGQTNG*
Coding >OphauB2|6295
ATGGATTCACAGGCGACCTGGAACTGGGGAGCTGCCTCTGGCCACGACGCTGGTCCCGATGCCTCAAGCAGCCGT
GGCAGGCACGAGCCTAGCCGGCAGCATCTAGATGGCCAAAGCCCGCAGAACGAGCCTCCATCACCCTCCCACCAG
CAGCCGCAACCGCCACCGCGATCACGGCGGTACGGCCCCCGAACCTGTCGCATTTGTCTCGAAACAGAGCAGCCT
CGATATCCTACAGGCCTCACATCAACCTTTGGCATCTCGTCATCTTCGTCGCAACCTACATACGTGTCGGATGAC
CCTGAACTAGGAAGACTATTATCGCCTTGCCGGTGCAAGGGCTCGCAGAAATATGTTCACGAGGGCTGCTTGACA
TCATGGCGCATGGCGAATCCCATGGCGACAACAAACTACTGGCAGTGTCCAACATGCAAGTTTAGCTATCGGTTG
GTGCGCATGCAGTGGGCTTCAATGTTGAGCAGCAAATGGGCCCAGGTGGGCTTGACGCTCACTGCCCTCGTCTTG
GGCATCTTCCTGCTAGGCTTTATTGCTGACCCAATACTGGACCTCTGGTTTGACCCCGTTGGCACTATTAGCGAC
ACAGTGGCCAACGTGGTCTCAGACATTGAAGCCCACCGGCCTCCCCCCTACCAAGAGCCCACGACTTGGTCCGAA
CACTTTACCAAGGGCTTCTTCTCTCTTGGTTTTGTGGGATTCATCAAGTCAGTGGTTGCCATGGGACCATGGCAG
TGGCTCAATCTTCGCAACAGTGGCTTGCTAGGCTCTGGCCGGCGACGCGGGACTGGAAGAGCGAGGATGGATAAT
TTCAACATCTTGTTTGTCCTCATTGGCACTTTTACCTTTCTCATGGCTATTTGGAAGCTGGTAAATGCTGTGAGT
GCTCGAGTTCTCAAGGTTGTCAGCGATAAGGTGCTTGACGTTGGGACCGACGACGACGATGATGATGATGAAGGC
GACGACGAGGACAATGGGCAGACCAATGGCTAG
Transcript >OphauB2|6295
ATGGATTCACAGGCGACCTGGAACTGGGGAGCTGCCTCTGGCCACGACGCTGGTCCCGATGCCTCAAGCAGCCGT
GGCAGGCACGAGCCTAGCCGGCAGCATCTAGATGGCCAAAGCCCGCAGAACGAGCCTCCATCACCCTCCCACCAG
CAGCCGCAACCGCCACCGCGATCACGGCGGTACGGCCCCCGAACCTGTCGCATTTGTCTCGAAACAGAGCAGCCT
CGATATCCTACAGGCCTCACATCAACCTTTGGCATCTCGTCATCTTCGTCGCAACCTACATACGTGTCGGATGAC
CCTGAACTAGGAAGACTATTATCGCCTTGCCGGTGCAAGGGCTCGCAGAAATATGTTCACGAGGGCTGCTTGACA
TCATGGCGCATGGCGAATCCCATGGCGACAACAAACTACTGGCAGTGTCCAACATGCAAGTTTAGCTATCGGTTG
GTGCGCATGCAGTGGGCTTCAATGTTGAGCAGCAAATGGGCCCAGGTGGGCTTGACGCTCACTGCCCTCGTCTTG
GGCATCTTCCTGCTAGGCTTTATTGCTGACCCAATACTGGACCTCTGGTTTGACCCCGTTGGCACTATTAGCGAC
ACAGTGGCCAACGTGGTCTCAGACATTGAAGCCCACCGGCCTCCCCCCTACCAAGAGCCCACGACTTGGTCCGAA
CACTTTACCAAGGGCTTCTTCTCTCTTGGTTTTGTGGGATTCATCAAGTCAGTGGTTGCCATGGGACCATGGCAG
TGGCTCAATCTTCGCAACAGTGGCTTGCTAGGCTCTGGCCGGCGACGCGGGACTGGAAGAGCGAGGATGGATAAT
TTCAACATCTTGTTTGTCCTCATTGGCACTTTTACCTTTCTCATGGCTATTTGGAAGCTGGTAAATGCTGTGAGT
GCTCGAGTTCTCAAGGTTGTCAGCGATAAGGTGCTTGACGTTGGGACCGACGACGACGATGATGATGATGAAGGC
GACGACGAGGACAATGGGCAGACCAATGGCTAG
Gene >OphauB2|6295
ATGGATTCACAGGCGACCTGGAACTGGGGAGCTGCCTCTGGCCACGACGCTGGTCCCGATGCCTCAAGCAGCCGT
GGCAGGCACGAGCCTAGCCGGCAGCATCTAGATGGCCAAAGCCCGCAGAACGAGCCTCCATCACCCTCCCACCAG
CAGCCGCAACCGCCACCGCGATCACGGCGGTACGGCCCCCGAACCTGTCGCATTTGTCTCGAAACAGAGCAGCCT
CGATATCCTACAGGCCTCACATCAACCTTTGGCATCTCGTCATCTTCGTCGCAACCTACATACGTGTCGGATGAC
CCTGAACTAGGAAGACTATTATCGCCTTGCCGGTGCAAGGGCTCGCAGAAATATGTTCACGAGGGCTGCTTGACA
TCATGGCGCATGGCGAATCCCATGGCGACAACAAACTACTGGCAGTGTCCAACATGCAAGTTTAGCTATCGGTTG
GTGCGCATGCAGTGGGCTTCAATGTTGAGCAGCAAATGGGCCCAGGTGGGCTTGACGCTCACTGCCCTCGTCTTG
GGCATCTTCCTGCTAGGCTTTATTGCTGACCCAATACTGGACCTCTGGTTTGACCCCGTTGGCACTATTAGCGAC
ACAGTGGCCAACGTGGTCTCAGACATTGAAGCCCACCGGCCTCCCCCCTACCAAGAGCCCACGACTTGGTCCGAA
CACTTTACCAAGGGCTTCTTCTCTCTTGGTTTTGTGGGATTCATCAAGTCAGTGGTTGCCATGGGACCATGGCAG
TGGCTCAATCTTCGCAACAGTGGCTTGCTAGGCTCTGGCCGGCGACGCGGGACTGGAAGAGCGAGGATGGATAAT
TTCAACATCTTGTTTGTCCTCATTGGCACTTTTACCTTTCTCATGGCTATTTGGAAGCTGGTAAATGCTGTGAGT
GCTCGAGTTCTCAAGGTTGTCAGCGATAAGGTGCTTGACGTTGGGACCGACGACGACGATGATGATGATGAAGGC
GACGACGAGGACAATGGGCAGACCAATGGCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail