Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|6293
Gene name
LocationContig_56:105603..106769
Strand+
Gene length (bp)1166
Transcript length (bp)1026
Coding sequence length (bp)1026
Protein length (aa) 342

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00415 RCC1 Regulator of chromosome condensation (RCC1) repeat 7.5E-05 270 322
PF13540 RCC1_2 Regulator of chromosome condensation (RCC1) repeat 2.3E-05 254 283

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q92834|RPGR_HUMAN X-linked retinitis pigmentosa GTPase regulator OS=Homo sapiens GN=RPGR PE=1 SV=2 200 324 2.0E-07
sp|Q9R0X5|RPGR_MOUSE X-linked retinitis pigmentosa GTPase regulator OS=Mus musculus GN=Rpgr PE=1 SV=2 200 324 2.0E-07
sp|Q15034|HERC3_HUMAN Probable E3 ubiquitin-protein ligase HERC3 OS=Homo sapiens GN=HERC3 PE=1 SV=1 141 326 3.0E-07
sp|P23800|RCC1_MESAU Regulator of chromosome condensation OS=Mesocricetus auratus GN=RCC1 PE=1 SV=1 154 285 6.0E-07
sp|Q8VE37|RCC1_MOUSE Regulator of chromosome condensation OS=Mus musculus GN=Rcc1 PE=1 SV=1 154 285 1.0E-06
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q92834|RPGR_HUMAN X-linked retinitis pigmentosa GTPase regulator OS=Homo sapiens GN=RPGR PE=1 SV=2 200 324 2.0E-07
sp|Q9R0X5|RPGR_MOUSE X-linked retinitis pigmentosa GTPase regulator OS=Mus musculus GN=Rpgr PE=1 SV=2 200 324 2.0E-07
sp|Q15034|HERC3_HUMAN Probable E3 ubiquitin-protein ligase HERC3 OS=Homo sapiens GN=HERC3 PE=1 SV=1 141 326 3.0E-07
sp|P23800|RCC1_MESAU Regulator of chromosome condensation OS=Mesocricetus auratus GN=RCC1 PE=1 SV=1 154 285 6.0E-07
sp|Q8VE37|RCC1_MOUSE Regulator of chromosome condensation OS=Mus musculus GN=Rcc1 PE=1 SV=1 154 285 1.0E-06
sp|Q4U2R1|HERC2_MOUSE E3 ubiquitin-protein ligase HERC2 OS=Mus musculus GN=Herc2 PE=1 SV=3 203 318 3.0E-06
sp|P18754|RCC1_HUMAN Regulator of chromosome condensation OS=Homo sapiens GN=RCC1 PE=1 SV=1 142 285 3.0E-06
sp|O95714|HERC2_HUMAN E3 ubiquitin-protein ligase HERC2 OS=Homo sapiens GN=HERC2 PE=1 SV=2 203 318 3.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 17 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|6293
MDLIVLQPTGIMMLYAAGFNAWNQLCFDRKHEESEPNDVFAFTKVLEAQHIDPPVSRQSYTLVRHDGCLSMAGFG
LQDQEAYQAAYSSAEAENDEILDVVDDAPDISSAANEGVPQHRLVKYASASARAARTADKTWPCKKPVSAVAAFA
TGFIILHQDGTVDTLGDARYQDCLGRQVDDESPAEDPCLVSDLADLDEPVTHVSAGGYTLAALTRSGALYLWGTC
PTNVQAGQNFMPNLNNIPNYVQVDGDEDVRDVALGESHAIVLMMDGALHVIGDNGNGQLGLGDSTVKGCSSWTKV
SLNLPQGHQVVAVAAGPRASFILTASKSTLDNHDADICSNP*
Coding >OphauB2|6293
ATGGACCTGATTGTGCTACAACCAACGGGCATCATGATGCTGTACGCAGCTGGCTTTAATGCATGGAACCAGCTC
TGTTTTGACCGCAAGCACGAGGAATCCGAACCAAATGATGTTTTTGCCTTTACAAAGGTGCTCGAGGCCCAACAT
ATTGACCCACCAGTATCCAGACAGTCTTATACACTAGTGCGTCATGATGGCTGCTTGTCCATGGCTGGCTTTGGC
TTGCAAGACCAAGAAGCATACCAAGCCGCGTATTCCTCTGCCGAGGCGGAAAATGACGAGATTCTCGACGTTGTA
GATGACGCCCCCGACATTAGTAGTGCCGCCAACGAGGGCGTGCCACAGCATCGTCTCGTCAAGTACGCCTCGGCC
AGTGCTCGTGCAGCTCGTACAGCAGACAAGACATGGCCATGCAAGAAGCCAGTCAGCGCCGTTGCCGCCTTTGCA
ACAGGCTTCATAATTCTACACCAAGACGGCACAGTCGACACTTTGGGGGATGCCCGTTACCAAGACTGTTTGGGG
CGCCAGGTTGATGATGAGTCACCTGCTGAGGACCCGTGTCTAGTTTCCGATCTCGCTGACCTTGACGAGCCTGTC
ACGCACGTCTCTGCCGGTGGCTACACCCTCGCTGCCTTGACCAGGAGCGGCGCTCTTTATCTTTGGGGGACGTGT
CCCACAAACGTGCAGGCTGGCCAGAATTTCATGCCAAACCTCAACAACATTCCCAACTATGTTCAGGTAGACGGC
GACGAGGACGTCCGTGACGTGGCCCTCGGAGAGTCTCATGCCATTGTCCTCATGATGGACGGGGCGCTCCACGTC
ATTGGAGACAATGGTAATGGACAACTTGGTCTCGGAGACTCAACCGTCAAGGGCTGCTCCTCATGGACAAAGGTG
TCTCTCAATTTACCACAAGGTCACCAAGTCGTTGCTGTTGCAGCAGGGCCGCGAGCTTCATTCATCTTGACGGCT
TCAAAGTCAACTTTGGACAATCATGATGCAGACATTTGTAGCAATCCTTAA
Transcript >OphauB2|6293
ATGGACCTGATTGTGCTACAACCAACGGGCATCATGATGCTGTACGCAGCTGGCTTTAATGCATGGAACCAGCTC
TGTTTTGACCGCAAGCACGAGGAATCCGAACCAAATGATGTTTTTGCCTTTACAAAGGTGCTCGAGGCCCAACAT
ATTGACCCACCAGTATCCAGACAGTCTTATACACTAGTGCGTCATGATGGCTGCTTGTCCATGGCTGGCTTTGGC
TTGCAAGACCAAGAAGCATACCAAGCCGCGTATTCCTCTGCCGAGGCGGAAAATGACGAGATTCTCGACGTTGTA
GATGACGCCCCCGACATTAGTAGTGCCGCCAACGAGGGCGTGCCACAGCATCGTCTCGTCAAGTACGCCTCGGCC
AGTGCTCGTGCAGCTCGTACAGCAGACAAGACATGGCCATGCAAGAAGCCAGTCAGCGCCGTTGCCGCCTTTGCA
ACAGGCTTCATAATTCTACACCAAGACGGCACAGTCGACACTTTGGGGGATGCCCGTTACCAAGACTGTTTGGGG
CGCCAGGTTGATGATGAGTCACCTGCTGAGGACCCGTGTCTAGTTTCCGATCTCGCTGACCTTGACGAGCCTGTC
ACGCACGTCTCTGCCGGTGGCTACACCCTCGCTGCCTTGACCAGGAGCGGCGCTCTTTATCTTTGGGGGACGTGT
CCCACAAACGTGCAGGCTGGCCAGAATTTCATGCCAAACCTCAACAACATTCCCAACTATGTTCAGGTAGACGGC
GACGAGGACGTCCGTGACGTGGCCCTCGGAGAGTCTCATGCCATTGTCCTCATGATGGACGGGGCGCTCCACGTC
ATTGGAGACAATGGTAATGGACAACTTGGTCTCGGAGACTCAACCGTCAAGGGCTGCTCCTCATGGACAAAGGTG
TCTCTCAATTTACCACAAGGTCACCAAGTCGTTGCTGTTGCAGCAGGGCCGCGAGCTTCATTCATCTTGACGGCT
TCAAAGTCAACTTTGGACAATCATGATGCAGACATTTGTAGCAATCCTTAA
Gene >OphauB2|6293
ATGGACCTGATTGTGCTACAACCAACGGGCATCATGATGCTGTACGCAGCTGGCTTTAATGCATGGAACCAGCTC
TGTTTTGACCGCAAGCACGAGGAATCCGAACCAAATGATGTTTTTGCCTTTACAAAGGTGCTCGAGGCCCAACAT
ATTGACCCACCAGTATCCAGACAGTCTTATACACTAGGTACGTTTGGCATACGAAGCGACTTGCATGAGTAGAAA
CTCACCGTGTTTGCGTACCGTCCTACGCACAGTGCGTCATGATGGCTGCTTGTCCATGGCTGGCTTTGGCTTGCA
AGACCAAGAAGCATACCAAGCCGCGTATTCCTCTGCCGAGGCGGAAAATGACGAGATTCTCGACGTTGTAGATGA
CGCCCCCGACATTAGTAGTGCCGCCAACGAGGGCGTGCCACAGCATCGTCTCGTCAAGTACGCCTCGGCCAGTGC
TCGTGCAGCTCGTACAGCAGACAAGACATGGCCATGCAAGAAGCCAGTCAGCGCCGTTGCCGCCTTTGCAACAGG
CTTCATAATTCTACACCAAGACGGCACAGTCGACACTTTGGGGGATGCCCGTTACCAAGACTGTTTGGGGCGCCA
GGTTGATGATGAGTCGTGAGGCTTTTTCCCTTCTTTCCTCGTCCATGACCAATTACAAGAGATGAAGCCGCTCAC
ACACAGCCAGACCTGCTGAGGACCCGTGTCTAGTTTCCGATCTCGCTGACCTTGACGAGCCTGTCACGCACGTCT
CTGCCGGTGGCTACACCCTCGCTGCCTTGACCAGGAGCGGCGCTCTTTATCTTTGGGGGACGTGTCCCACAAACG
TGCAGGCTGGCCAGAATTTCATGCCAAACCTCAACAACATTCCCAACTATGTTCAGGTAGACGGCGACGAGGACG
TCCGTGACGTGGCCCTCGGAGAGTCTCATGCCATTGTCCTCATGATGGACGGGGCGCTCCACGTCATTGGAGACA
ATGGTAATGGACAACTTGGTCTCGGAGACTCAACCGTCAAGGGCTGCTCCTCATGGACAAAGGTGTCTCTCAATT
TACCACAAGGTCACCAAGTCGTTGCTGTTGCAGCAGGGCCGCGAGCTTCATTCATCTTGACGGCTTCAAAGTCAA
CTTTGGACAATCATGATGCAGACATTTGTAGCAATCCTTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail