Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|629
Gene name
LocationContig_110:19323..20088
Strand+
Gene length (bp)765
Transcript length (bp)384
Coding sequence length (bp)384
Protein length (aa) 128

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02271 UCR_14kD Ubiquinol-cytochrome C reductase complex 14kD subunit 1.9E-44 14 113

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q871K1|QCR7_NEUCR Cytochrome b-c1 complex subunit 7 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=qcr-7 PE=3 SV=1 1 118 1.0E-48
sp|O74533|QCR7_SCHPO Cytochrome b-c1 complex subunit 7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=qcr7 PE=3 SV=1 1 119 1.0E-36
sp|P49345|QCR7_KLULA Cytochrome b-c1 complex subunit 7 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=QCR7 PE=3 SV=1 6 118 1.0E-35
sp|Q6C3K7|QCR7_YARLI Cytochrome b-c1 complex subunit 7 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=QCR7 PE=3 SV=1 9 118 4.0E-30
sp|Q751U4|QCR7_ASHGO Cytochrome b-c1 complex subunit 7 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=QCR7 PE=3 SV=1 6 118 3.0E-29
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q871K1|QCR7_NEUCR Cytochrome b-c1 complex subunit 7 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=qcr-7 PE=3 SV=1 1 118 1.0E-48
sp|O74533|QCR7_SCHPO Cytochrome b-c1 complex subunit 7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=qcr7 PE=3 SV=1 1 119 1.0E-36
sp|P49345|QCR7_KLULA Cytochrome b-c1 complex subunit 7 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=QCR7 PE=3 SV=1 6 118 1.0E-35
sp|Q6C3K7|QCR7_YARLI Cytochrome b-c1 complex subunit 7 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=QCR7 PE=3 SV=1 9 118 4.0E-30
sp|Q751U4|QCR7_ASHGO Cytochrome b-c1 complex subunit 7 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=QCR7 PE=3 SV=1 6 118 3.0E-29
sp|P00128|QCR7_YEAST Cytochrome b-c1 complex subunit 7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=QCR7 PE=1 SV=2 6 118 4.0E-29
sp|Q6BNQ5|QCR7_DEBHA Cytochrome b-c1 complex subunit 7 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=QCR7 PE=3 SV=1 7 118 1.0E-26
sp|Q6FSJ2|QCR7_CANGA Cytochrome b-c1 complex subunit 7 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=QCR7 PE=3 SV=1 6 98 1.0E-22
sp|P46268|QCR7_CYBJA Cytochrome b-c1 complex subunit 7 OS=Cyberlindnera jadinii GN=QCR7 PE=3 SV=1 9 95 3.0E-20
sp|Q5RC24|QCR7_PONAB Cytochrome b-c1 complex subunit 7 OS=Pongo abelii GN=UQCRB PE=3 SV=3 17 113 1.0E-17
sp|P14927|QCR7_HUMAN Cytochrome b-c1 complex subunit 7 OS=Homo sapiens GN=UQCRB PE=1 SV=2 17 113 3.0E-17
sp|Q9D855|QCR7_MOUSE Cytochrome b-c1 complex subunit 7 OS=Mus musculus GN=Uqcrb PE=1 SV=3 17 113 3.0E-17
sp|P00129|QCR7_BOVIN Cytochrome b-c1 complex subunit 7 OS=Bos taurus GN=UQCRB PE=1 SV=3 17 113 3.0E-17
sp|Q9GP40|QCR7_ECHMU Cytochrome b-c1 complex subunit 7 OS=Echinococcus multilocularis GN=UBCRBP PE=2 SV=1 21 119 2.0E-10
sp|O01369|QCR7_FASHE Cytochrome b-c1 complex subunit 7 OS=Fasciola hepatica GN=UBCRBP PE=3 SV=2 33 120 2.0E-09
sp|O01374|QCR7_SCHMA Cytochrome b-c1 complex subunit 7 OS=Schistosoma mansoni PE=3 SV=1 29 120 6.0E-08
sp|Q9SUU5|QCR71_ARATH Cytochrome b-c1 complex subunit 7-1 OS=Arabidopsis thaliana GN=QCR7-1 PE=1 SV=1 12 118 1.0E-07
sp|F4JWS8|QCR72_ARATH Cytochrome b-c1 complex subunit 7-2 OS=Arabidopsis thaliana GN=QCR7-2 PE=1 SV=1 12 118 8.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0006122 mitochondrial electron transport, ubiquinol to cytochrome c Yes
GO:0005750 mitochondrial respiratory chain complex III Yes
GO:1990204 oxidoreductase complex No
GO:0098798 mitochondrial protein-containing complex No
GO:0019646 aerobic electron transport chain No
GO:0005575 cellular_component No
GO:0008150 biological_process No
GO:1990351 transporter complex No
GO:0006091 generation of precursor metabolites and energy No
GO:0098803 respiratory chain complex No
GO:0098800 inner mitochondrial membrane protein complex No
GO:1902494 catalytic complex No
GO:0015980 energy derivation by oxidation of organic compounds No
GO:0070069 cytochrome complex No
GO:0044237 cellular metabolic process No
GO:0008152 metabolic process No
GO:0009987 cellular process No
GO:0022904 respiratory electron transport chain No
GO:0045333 cellular respiration No
GO:0032991 protein-containing complex No
GO:0098796 membrane protein complex No
GO:1902495 transmembrane transporter complex No
GO:0022900 electron transport chain No
GO:0045275 respiratory chain complex III No
GO:0009060 aerobic respiration No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 18 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|629
MVGYSLAPFVLRRPWLAKMLKPVAHWYADAAGYRKLGLRYDDLLEEEREAVQIALRRLSPKETYDRVFRIRRSTQ
CSYQHKLLPKDQWTKPEEDTPYLRNIVAQVEAEMAERDALDSMIQRIGLKSI*
Coding >OphauB2|629
ATGGTCGGCTACTCCCTTGCGCCCTTTGTCTTGCGCCGGCCATGGCTGGCCAAAATGCTTAAACCCGTTGCGCAT
TGGTATGCCGACGCCGCTGGATACCGTAAACTCGGCCTCAGATACGACGACCTCCTTGAAGAAGAACGCGAGGCT
GTCCAAATTGCCCTACGACGCCTCTCTCCCAAAGAAACATATGACCGCGTCTTCCGCATTCGCCGCTCCACTCAG
TGCAGCTACCAGCACAAACTTCTACCCAAGGACCAGTGGACAAAACCCGAAGAGGATACTCCCTATCTCCGCAAT
ATTGTTGCACAAGTCGAAGCTGAAATGGCTGAAAGGGACGCCCTCGACTCCATGATACAGAGGATCGGCCTAAAG
AGTATTTGA
Transcript >OphauB2|629
ATGGTCGGCTACTCCCTTGCGCCCTTTGTCTTGCGCCGGCCATGGCTGGCCAAAATGCTTAAACCCGTTGCGCAT
TGGTATGCCGACGCCGCTGGATACCGTAAACTCGGCCTCAGATACGACGACCTCCTTGAAGAAGAACGCGAGGCT
GTCCAAATTGCCCTACGACGCCTCTCTCCCAAAGAAACATATGACCGCGTCTTCCGCATTCGCCGCTCCACTCAG
TGCAGCTACCAGCACAAACTTCTACCCAAGGACCAGTGGACAAAACCCGAAGAGGATACTCCCTATCTCCGCAAT
ATTGTTGCACAAGTCGAAGCTGAAATGGCTGAAAGGGACGCCCTCGACTCCATGATACAGAGGATCGGCCTAAAG
AGTATTTGA
Gene >OphauB2|629
ATGGTCGGCTACTCCCTTGCGCCCTTTGTCTTGCGCCGGCCATGGCTGGCCAAAATGCTTAAACCCGTTGCGCAT
TGGTATGCCGACGCCGCTGGATACCGTAAACTCGGCCTCAGGTAAACCGCGAACCCTCAAACCCTCAAACCCGCC
AATCCCACCACCACCCGAGAAGACTGAACAGGAGACGTGATGACGACTGTGCCATATATTCTCTTGGTATCCCTT
CAACAACAATAACAACAACAACAACAACAAAAACCCCCCACACATCGCCAAATCTTCTACGCAATTTGACAAGCA
CTCCCTCACAGAGCCCGCTCGCTGACTCCCAAGGCTGCCAGATACGACGACCTCCTTGAAGAAGAACGCGAGGCT
GTCCAAATTGCCCTACGACGCCTCTCTCCCAAAGAAACATATGACCGCGTCTTCCGCATTCGCCGCTCCACTCAG
TGCAGCTACCAGCACAAACTTCTACCCAAGGACCAGTGGACAAAACCCGAAGAGGTAAAGGAAAAAATGTCATGA
TTGGAATCGTGTTAGAATACTATGCGATCATTTCATTAATCACTCATTACCTAGGATACTCCCTATCTCCGCAAT
ATTGTTGCACAAGTCGAAGCTGAAATGGCTGAAAGGGACGCCCTCGACTCCATGTACGTTGTCAAGAACCACTGA
AATAACCGACTATCGGCCAGGAGAGCAAGACACAAACATGGCTTTTTGTCGCATCTTAGGATACAGAGGATCGGC
CTAAAGAGTATTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail