Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|6284
Gene name
LocationContig_56:84480..86277
Strand+
Gene length (bp)1797
Transcript length (bp)1578
Coding sequence length (bp)1578
Protein length (aa) 526

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01490 Aa_trans Transmembrane amino acid transporter protein 4.2E-67 122 510

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P39981|AVT2_YEAST Vacuolar amino acid transporter 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AVT2 PE=2 SV=1 83 520 6.0E-99
sp|Q3USY0|S38AB_MOUSE Putative sodium-coupled neutral amino acid transporter 11 OS=Mus musculus GN=Slc38a11 PE=2 SV=2 106 511 6.0E-71
sp|D3Z813|S38AB_RAT Putative sodium-coupled neutral amino acid transporter 11 OS=Rattus norvegicus GN=Slc38a11 PE=2 SV=1 122 511 3.0E-69
sp|Q5EA97|S38AB_BOVIN Putative sodium-coupled neutral amino acid transporter 11 OS=Bos taurus GN=SLC38A11 PE=2 SV=1 95 511 2.0E-67
sp|A8KBL5|S38AB_DANRE Putative sodium-coupled neutral amino acid transporter 11 OS=Danio rerio GN=slc38a11 PE=2 SV=2 145 509 6.0E-66
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P39981|AVT2_YEAST Vacuolar amino acid transporter 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AVT2 PE=2 SV=1 83 520 6.0E-99
sp|Q3USY0|S38AB_MOUSE Putative sodium-coupled neutral amino acid transporter 11 OS=Mus musculus GN=Slc38a11 PE=2 SV=2 106 511 6.0E-71
sp|D3Z813|S38AB_RAT Putative sodium-coupled neutral amino acid transporter 11 OS=Rattus norvegicus GN=Slc38a11 PE=2 SV=1 122 511 3.0E-69
sp|Q5EA97|S38AB_BOVIN Putative sodium-coupled neutral amino acid transporter 11 OS=Bos taurus GN=SLC38A11 PE=2 SV=1 95 511 2.0E-67
sp|A8KBL5|S38AB_DANRE Putative sodium-coupled neutral amino acid transporter 11 OS=Danio rerio GN=slc38a11 PE=2 SV=2 145 509 6.0E-66
sp|Q8HXI3|S38AB_MACFA Putative sodium-coupled neutral amino acid transporter 11 OS=Macaca fascicularis GN=SLC38A11 PE=2 SV=1 56 511 1.0E-55
sp|Q08AI6|S38AB_HUMAN Putative sodium-coupled neutral amino acid transporter 11 OS=Homo sapiens GN=SLC38A11 PE=2 SV=1 148 511 4.0E-53
sp|Q6DEL1|S38A7_DANRE Putative sodium-coupled neutral amino acid transporter 7 OS=Danio rerio GN=slc38a7 PE=2 SV=1 94 497 4.0E-30
sp|Q9JM15|S38A1_RAT Sodium-coupled neutral amino acid transporter 1 OS=Rattus norvegicus GN=Slc38a1 PE=1 SV=1 65 507 8.0E-29
sp|Q9DCP2|S38A3_MOUSE Sodium-coupled neutral amino acid transporter 3 OS=Mus musculus GN=Slc38a3 PE=1 SV=1 56 519 1.0E-28
sp|Q9JHZ9|S38A3_RAT Sodium-coupled neutral amino acid transporter 3 OS=Rattus norvegicus GN=Slc38a3 PE=2 SV=1 56 519 1.0E-28
sp|Q8K2P7|S38A1_MOUSE Sodium-coupled neutral amino acid transporter 1 OS=Mus musculus GN=Slc38a1 PE=1 SV=1 65 486 3.0E-27
sp|Q9H2H9|S38A1_HUMAN Sodium-coupled neutral amino acid transporter 1 OS=Homo sapiens GN=SLC38A1 PE=1 SV=1 65 482 2.0E-26
sp|Q6JWR2|S38A7_RAT Putative sodium-coupled neutral amino acid transporter 7 OS=Rattus norvegicus GN=Slc38a7 PE=2 SV=1 74 497 3.0E-26
sp|Q6WWW3|S38A6_RAT Probable sodium-coupled neutral amino acid transporter 6 OS=Rattus norvegicus GN=Slc38a6 PE=2 SV=1 93 508 3.0E-26
sp|Q5R443|S38A1_PONAB Sodium-coupled neutral amino acid transporter 1 OS=Pongo abelii GN=SLC38A1 PE=2 SV=1 65 482 6.0E-26
sp|G3UVW3|S38A6_MOUSE Probable sodium-coupled neutral amino acid transporter 6 OS=Mus musculus GN=Slc38a6 PE=2 SV=1 95 508 1.0E-25
sp|Q8BWH0|S38A7_MOUSE Putative sodium-coupled neutral amino acid transporter 7 OS=Mus musculus GN=Slc38a7 PE=1 SV=1 74 497 2.0E-25
sp|Q99624|S38A3_HUMAN Sodium-coupled neutral amino acid transporter 3 OS=Homo sapiens GN=SLC38A3 PE=1 SV=1 96 486 2.0E-25
sp|Q8IZM9|S38A6_HUMAN Probable sodium-coupled neutral amino acid transporter 6 OS=Homo sapiens GN=SLC38A6 PE=1 SV=2 113 502 8.0E-25
sp|Q28HE5|S38A6_XENTR Probable sodium-coupled neutral amino acid transporter 6 OS=Xenopus tropicalis GN=slc38a6 PE=2 SV=1 107 502 2.0E-24
sp|Q9NVC3|S38A7_HUMAN Putative sodium-coupled neutral amino acid transporter 7 OS=Homo sapiens GN=SLC38A7 PE=1 SV=1 72 497 3.0E-23
sp|Q5R9F5|S38A7_PONAB Putative sodium-coupled neutral amino acid transporter 7 OS=Pongo abelii GN=SLC38A7 PE=2 SV=1 74 497 5.0E-23
sp|A7E3U5|S38A7_BOVIN Putative sodium-coupled neutral amino acid transporter 7 OS=Bos taurus GN=SLC38A7 PE=2 SV=1 128 497 3.0E-22
sp|Q6DFE7|S38A7_XENLA Putative sodium-coupled neutral amino acid transporter 7 OS=Xenopus laevis GN=slc38a7 PE=2 SV=1 106 515 6.0E-22
sp|Q9JHE5|S38A2_RAT Sodium-coupled neutral amino acid transporter 2 OS=Rattus norvegicus GN=Slc38a2 PE=1 SV=1 63 504 2.0E-21
sp|Q5I012|S38AA_MOUSE Putative sodium-coupled neutral amino acid transporter 10 OS=Mus musculus GN=Slc38a10 PE=1 SV=2 131 481 4.0E-21
sp|Q503G8|S38A6_DANRE Probable sodium-coupled neutral amino acid transporter 6 OS=Danio rerio GN=slc38a6 PE=2 SV=1 107 507 2.0E-20
sp|E9PT23|S38AA_RAT Putative sodium-coupled neutral amino acid transporter 10 OS=Rattus norvegicus GN=Slc38a10 PE=2 SV=2 131 481 3.0E-20
sp|Q5RC98|S38AA_PONAB Putative sodium-coupled neutral amino acid transporter 10 OS=Pongo abelii GN=SLC38A10 PE=2 SV=1 131 508 1.0E-19
sp|Q5SPB1|S38A2_DANRE Sodium-coupled neutral amino acid transporter 2 OS=Danio rerio GN=slc38a2 PE=3 SV=1 92 482 1.0E-19
sp|Q9HBR0|S38AA_HUMAN Putative sodium-coupled neutral amino acid transporter 10 OS=Homo sapiens GN=SLC38A10 PE=1 SV=2 131 508 1.0E-19
sp|Q5E9S9|S38A5_BOVIN Sodium-coupled neutral amino acid transporter 5 OS=Bos taurus GN=SLC38A5 PE=2 SV=1 122 507 2.0E-19
sp|Q5XH90|S38A2_XENTR Sodium-coupled neutral amino acid transporter 2 OS=Xenopus tropicalis GN=slc38a2 PE=2 SV=1 71 504 2.0E-19
sp|Q8WUX1|S38A5_HUMAN Sodium-coupled neutral amino acid transporter 5 OS=Homo sapiens GN=SLC38A5 PE=1 SV=1 122 507 3.0E-19
sp|Q3U1J0|S38A5_MOUSE Sodium-coupled neutral amino acid transporter 5 OS=Mus musculus GN=Slc38a5 PE=1 SV=1 122 507 3.0E-19
sp|A2VCW5|S38A5_RAT Sodium-coupled neutral amino acid transporter 5 OS=Rattus norvegicus GN=Slc38a5 PE=1 SV=1 122 507 8.0E-19
sp|P40074|AVT6_YEAST Vacuolar amino acid transporter 6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AVT6 PE=1 SV=1 123 511 1.0E-17
sp|O74327|AVT5_SCHPO Vacuolar amino acid transporter 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=avt5 PE=3 SV=1 122 513 1.0E-17
sp|A6NNN8|S38A8_HUMAN Putative sodium-coupled neutral amino acid transporter 8 OS=Homo sapiens GN=SLC38A8 PE=1 SV=1 123 480 1.0E-16
sp|Q5F468|S38A2_CHICK Sodium-coupled neutral amino acid transporter 2 OS=Gallus gallus GN=SLC38A2 PE=2 SV=2 106 482 2.0E-16
sp|Q5HZH7|S38A8_MOUSE Putative sodium-coupled neutral amino acid transporter 8 OS=Mus musculus GN=Slc38a8 PE=2 SV=1 107 480 1.0E-15
sp|P38176|AVT5_YEAST Vacuolar amino acid transporter 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AVT5 PE=3 SV=2 123 507 1.0E-14
sp|Q6PCF9|S38AA_XENLA Putative sodium-coupled neutral amino acid transporter 10 OS=Xenopus laevis GN=slc38a10 PE=2 SV=1 130 506 1.0E-14
sp|A1YG32|S38A2_PANPA Sodium-coupled neutral amino acid transporter 2 OS=Pan paniscus GN=SLC38A2 PE=3 SV=1 106 482 2.0E-14
sp|Q8CFE6|S38A2_MOUSE Sodium-coupled neutral amino acid transporter 2 OS=Mus musculus GN=Slc38a2 PE=1 SV=1 106 507 2.0E-14
sp|Q96QD8|S38A2_HUMAN Sodium-coupled neutral amino acid transporter 2 OS=Homo sapiens GN=SLC38A2 PE=1 SV=2 106 482 2.0E-14
sp|P40501|AVT7_YEAST Vacuolar amino acid transporter 7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AVT7 PE=1 SV=1 131 410 3.0E-14
sp|Q5RE87|S38A4_PONAB Sodium-coupled neutral amino acid transporter 4 OS=Pongo abelii GN=SLC38A4 PE=2 SV=1 319 507 8.0E-13
sp|Q969I6|S38A4_HUMAN Sodium-coupled neutral amino acid transporter 4 OS=Homo sapiens GN=SLC38A4 PE=1 SV=1 319 482 8.0E-13
sp|A2VE31|S38A2_BOVIN Sodium-coupled neutral amino acid transporter 2 OS=Bos taurus GN=SLC38A2 PE=2 SV=1 106 482 1.0E-12
sp|Q8R1S9|S38A4_MOUSE Sodium-coupled neutral amino acid transporter 4 OS=Mus musculus GN=Slc38a4 PE=1 SV=1 319 482 1.0E-11
sp|Q9EQ25|S38A4_RAT Sodium-coupled neutral amino acid transporter 4 OS=Rattus norvegicus GN=Slc38a4 PE=1 SV=1 319 482 2.0E-11
sp|Q28I47|S38A8_XENTR Putative sodium-coupled neutral amino acid transporter 8 OS=Xenopus tropicalis GN=slc38a8 PE=2 SV=1 117 480 3.0E-10
sp|Q4KL91|S36A4_XENLA Proton-coupled amino acid transporter 4 OS=Xenopus laevis GN=slc36a4 PE=2 SV=1 57 501 2.0E-09
sp|Q5RE87|S38A4_PONAB Sodium-coupled neutral amino acid transporter 4 OS=Pongo abelii GN=SLC38A4 PE=2 SV=1 131 298 4.0E-09
sp|Q969I6|S38A4_HUMAN Sodium-coupled neutral amino acid transporter 4 OS=Homo sapiens GN=SLC38A4 PE=1 SV=1 110 298 9.0E-09
sp|Q8R1S9|S38A4_MOUSE Sodium-coupled neutral amino acid transporter 4 OS=Mus musculus GN=Slc38a4 PE=1 SV=1 110 298 1.0E-08
sp|Q9EQ25|S38A4_RAT Sodium-coupled neutral amino acid transporter 4 OS=Rattus norvegicus GN=Slc38a4 PE=1 SV=1 110 298 2.0E-08
sp|F4ILY9|ANTL1_ARATH Amino acid transporter ANTL1 OS=Arabidopsis thaliana GN=At2g42005 PE=2 SV=1 119 480 3.0E-08
sp|Q9SF09|ANT1_ARATH Amino acid transporter ANT1 OS=Arabidopsis thaliana GN=ANT1 PE=1 SV=1 131 501 4.0E-08
sp|Q9SS86|LHTL4_ARATH Lysine histidine transporter-like 4 OS=Arabidopsis thaliana GN=At3g01760 PE=3 SV=2 107 525 4.0E-08
sp|Q19425|S38A9_CAEEL Sodium-coupled neutral amino acid transporter 9 homolog OS=Caenorhabditis elegans GN=F13H10.3 PE=3 SV=2 321 508 1.0E-07
sp|P50944|AVT4_YEAST Vacuolar amino acid transporter 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AVT4 PE=1 SV=1 54 425 2.0E-07
sp|P36062|AVT3_YEAST Vacuolar amino acid transporter 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AVT3 PE=1 SV=1 262 511 3.0E-07
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 38 0.45

Transmembrane Domains

Domain # Start End Length
1 124 146 22
2 156 178 22
3 199 221 22
4 241 263 22
5 275 297 22
6 317 339 22
7 351 373 22
8 393 415 22
9 435 457 22
10 461 483 22
11 490 512 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|6284
MTATPKHEEEGRGLLAGDSLSDHDDSGHDGPDDLDADLANSQQAGQTQGRRGHGKPRQAIQLPDETGAAVAEYDH
VDVASPTSRSHRTPLLTDLEAPSVAVANAWDEDDDAAQLHRELGRPKSGLRSAFMNMANSIIGAGIIGQPYALKQ
AGLLAGIVLLIVLTAIVDWTICLIVINSKLSGTSSFQGTVEYCFGHGGLIAISLAQWVFAFGGMVAFGVIVGDTI
PHVLLAVWPDIASVPVIGLLTDRRVVIVVFVMGVSYPLTLYRDIAKLAKASTFALIGMIVIVSTVLVQSLLVPAE
ARGSFDTALLTVNGGLFQAIGVISFAFVCHHNSLLIYGSLRTPTIDNFSRVTHYSTSVSMLACLVVALAGFLTFG
DKTLGNVLNNFATDNTMVNVARLFFGLNMLTTLPLEAFVCREVMLTYWYPDESFNMRRHLVFSTGLVAGATAVSL
LTCDLGVVFELVGATSAVAIAYILPPLCYIKLATTNWRTYVAYSIVVFGVVVMIISIVQAVGKAISGTDATATCT
*
Coding >OphauB2|6284
ATGACGGCGACCCCGAAGCACGAGGAAGAGGGCCGAGGGCTGTTGGCGGGCGACTCGCTTTCTGACCACGACGAC
TCTGGCCACGATGGCCCCGACGACCTGGACGCCGACCTTGCCAATTCGCAGCAGGCTGGGCAGACCCAAGGCCGT
CGTGGCCATGGGAAGCCGCGCCAGGCTATCCAGCTCCCCGACGAGACTGGGGCTGCCGTGGCGGAATACGACCAT
GTCGACGTGGCCAGTCCCACGAGCCGCTCGCATCGAACGCCCCTCTTGACCGACTTGGAGGCGCCGAGCGTTGCT
GTTGCCAATGCCTGGGATGAGGACGACGATGCCGCGCAGCTTCACCGCGAACTGGGGCGGCCCAAGTCGGGCCTT
CGCTCCGCCTTTATGAATATGGCCAACTCGATTATTGGCGCTGGCATCATTGGCCAGCCCTACGCCCTCAAGCAG
GCGGGCCTGCTGGCCGGCATTGTGCTGCTCATTGTCCTGACTGCCATTGTGGACTGGACCATTTGCCTCATTGTC
ATTAATAGCAAGCTGAGCGGCACCAGCAGCTTCCAGGGCACCGTCGAGTACTGCTTTGGCCACGGCGGCCTCATC
GCCATTAGCCTTGCCCAGTGGGTCTTTGCCTTTGGCGGCATGGTGGCCTTTGGCGTCATTGTCGGCGACACGATT
CCCCATGTCCTCTTGGCTGTCTGGCCCGACATTGCCTCTGTTCCCGTTATTGGCCTGCTGACGGACCGCCGCGTC
GTCATTGTCGTTTTTGTCATGGGAGTCAGCTACCCCCTGACGCTGTACCGCGACATTGCCAAGTTGGCCAAGGCG
AGCACCTTTGCCCTTATTGGCATGATTGTCATTGTCTCTACCGTGCTTGTACAGAGCCTCTTGGTGCCCGCCGAG
GCACGCGGGTCCTTTGACACGGCCTTGCTGACGGTCAATGGAGGCCTCTTCCAAGCCATTGGCGTCATTTCGTTT
GCTTTTGTCTGCCACCACAACTCGCTGCTCATTTACGGCTCGCTCCGCACCCCCACGATTGACAACTTTTCGCGC
GTGACGCACTACTCGACGAGCGTCTCCATGCTGGCCTGTCTGGTCGTGGCTCTGGCCGGCTTCCTCACCTTTGGC
GACAAGACTCTGGGCAACGTGCTCAACAACTTTGCCACGGACAACACCATGGTTAATGTGGCGCGTCTGTTTTTT
GGCCTCAACATGCTGACGACGCTTCCGCTCGAGGCATTTGTCTGCCGCGAGGTGATGCTGACGTACTGGTATCCC
GACGAGAGCTTCAACATGCGCCGCCACTTGGTCTTTAGCACCGGTCTCGTTGCCGGGGCCACGGCGGTGAGTCTG
TTGACGTGCGACTTGGGCGTCGTGTTTGAGCTTGTTGGCGCCACGAGCGCCGTGGCTATTGCTTACATCTTGCCG
CCGCTGTGCTACATTAAGCTTGCCACGACCAATTGGCGCACATATGTGGCCTATTCCATTGTTGTGTTTGGCGTC
GTCGTCATGATTATTAGCATTGTGCAAGCCGTGGGCAAGGCCATATCTGGCACCGATGCAACAGCAACGTGTACC
TGA
Transcript >OphauB2|6284
ATGACGGCGACCCCGAAGCACGAGGAAGAGGGCCGAGGGCTGTTGGCGGGCGACTCGCTTTCTGACCACGACGAC
TCTGGCCACGATGGCCCCGACGACCTGGACGCCGACCTTGCCAATTCGCAGCAGGCTGGGCAGACCCAAGGCCGT
CGTGGCCATGGGAAGCCGCGCCAGGCTATCCAGCTCCCCGACGAGACTGGGGCTGCCGTGGCGGAATACGACCAT
GTCGACGTGGCCAGTCCCACGAGCCGCTCGCATCGAACGCCCCTCTTGACCGACTTGGAGGCGCCGAGCGTTGCT
GTTGCCAATGCCTGGGATGAGGACGACGATGCCGCGCAGCTTCACCGCGAACTGGGGCGGCCCAAGTCGGGCCTT
CGCTCCGCCTTTATGAATATGGCCAACTCGATTATTGGCGCTGGCATCATTGGCCAGCCCTACGCCCTCAAGCAG
GCGGGCCTGCTGGCCGGCATTGTGCTGCTCATTGTCCTGACTGCCATTGTGGACTGGACCATTTGCCTCATTGTC
ATTAATAGCAAGCTGAGCGGCACCAGCAGCTTCCAGGGCACCGTCGAGTACTGCTTTGGCCACGGCGGCCTCATC
GCCATTAGCCTTGCCCAGTGGGTCTTTGCCTTTGGCGGCATGGTGGCCTTTGGCGTCATTGTCGGCGACACGATT
CCCCATGTCCTCTTGGCTGTCTGGCCCGACATTGCCTCTGTTCCCGTTATTGGCCTGCTGACGGACCGCCGCGTC
GTCATTGTCGTTTTTGTCATGGGAGTCAGCTACCCCCTGACGCTGTACCGCGACATTGCCAAGTTGGCCAAGGCG
AGCACCTTTGCCCTTATTGGCATGATTGTCATTGTCTCTACCGTGCTTGTACAGAGCCTCTTGGTGCCCGCCGAG
GCACGCGGGTCCTTTGACACGGCCTTGCTGACGGTCAATGGAGGCCTCTTCCAAGCCATTGGCGTCATTTCGTTT
GCTTTTGTCTGCCACCACAACTCGCTGCTCATTTACGGCTCGCTCCGCACCCCCACGATTGACAACTTTTCGCGC
GTGACGCACTACTCGACGAGCGTCTCCATGCTGGCCTGTCTGGTCGTGGCTCTGGCCGGCTTCCTCACCTTTGGC
GACAAGACTCTGGGCAACGTGCTCAACAACTTTGCCACGGACAACACCATGGTTAATGTGGCGCGTCTGTTTTTT
GGCCTCAACATGCTGACGACGCTTCCGCTCGAGGCATTTGTCTGCCGCGAGGTGATGCTGACGTACTGGTATCCC
GACGAGAGCTTCAACATGCGCCGCCACTTGGTCTTTAGCACCGGTCTCGTTGCCGGGGCCACGGCGGTGAGTCTG
TTGACGTGCGACTTGGGCGTCGTGTTTGAGCTTGTTGGCGCCACGAGCGCCGTGGCTATTGCTTACATCTTGCCG
CCGCTGTGCTACATTAAGCTTGCCACGACCAATTGGCGCACATATGTGGCCTATTCCATTGTTGTGTTTGGCGTC
GTCGTCATGATTATTAGCATTGTGCAAGCCGTGGGCAAGGCCATATCTGGCACCGATGCAACAGCAACGTGTACC
TGA
Gene >OphauB2|6284
ATGACGGCGACCCCGAAGCACGAGGAAGAGGGCCGAGGGCTGTTGGCGGGCGACTCGCTTTCTGACCACGACGAC
TCTGGCCACGATGGCCCCGACGACCTGGACGCCGACCTTGCCAATTCGCAGCAGGCTGGGCAGACCCAAGGCCGT
CGTGGCCATGGGAAGCCGCGCCAGGCTATCCAGCTCCCCGACGAGACTGGGGCTGCCGTGGCGGAATACGACCAT
GTCGACGTGGCCAGTCCCACGAGCCGCTCGCATCGAACGCCCCTCTTGACCGACTTGGAGGCGCCGAGCGTTGCT
GTTGCCAATGCCTGGGATGAGGACGACGATGCCGCGCAGCTTCACCGCGAACTGGGGCGGCCCAAGTCGGGCCTT
CGCTCCGCCTTTATGAATATGGCCAACTCGATTATTGGCGCTGGCATCATTGGCCAGCCCTACGCCCTCAAGCAG
GCGGGCCTGCTGGCCGGCATTGTGCTGCTCATTGTCCTGACTGCCATTGTGGACTGGACCATTTGCCTCATTGTC
ATTAATAGCAAGCTGAGCGGCACCAGCAGCTTCCAGGGCACCGTCGAGTACTGCTTTGGCCACGGCGGCCTCATC
GCCATTAGCCTTGCCCAGTGGGTCTTTGCCTTTGGCGGCATGGTGGCCTTTGGCGTCATTGTCGGCGACACGATT
CCCCATGTCCTCTTGGCTGTCTGGCCCGACATTGCCTCTGTTCCCGTTATTGGCCTGCTGACGGACCGCCGCGTC
GTCATTGTCGTTTTTGTCATGGGAGTCAGCTACCCCCTGACGCTGTACCGCGACATTGCCAAGGTGAGGCAGCTG
GAGAGATGCTCCATGGACTTTTGTTGACGGGTTTACTGACCATGTGTCTAGTTGGCCAAGGCGAGCACCTTTGCC
CTTATTGGCATGATTGTCATTGTCTCTACCGTGCTTGTACAGAGCCTCTTGGTGCCCGCCGAGGCACGCGGGTCC
TTTGACACGGCCTTGCTGACGGTCAATGGAGGCCTCTTCCAAGCCATTGGCGTCATTTCGTTTGGTGAGGAACCT
CCTGGGTCCGACGTTGCCCCCCGTCGCAAAACTGACGAGAGCCTTGCCATTTGCAGCTTTTGTCTGCCACCACAA
CTCGCTGCTCATTTACGGCTCGCTCCGCACCCCCACGATTGACAACTTTTCGCGCGTGACGCACTACTCGACGAG
CGTCTCCATGCTGGCCTGTCTGGTCGTGGCTCTGGCCGGCTTCCTCACCTTTGGCGACAAGACTCTGGGCAACGT
GCTCAACAACTTTGCCACGGACAACACCATGGTTAATGTGGCGCGTCTGTTTTTTGGCCTCAACATGCTGACGAC
GCTTCCGCTCGAGGCATTTGTCTGCCGCGAGGTGATGCTGACGTACTGGTATCCCGACGAGAGCTTCAACATGCG
CCGCCACTTGGTCTTTAGCACCGGTCTCGTTGCCGGGGCCACGGCGGTGAGTCTGTTGACGTGCGACTTGGGCGT
CGTGTTTGAGCTTGTTGGCGCCACGAGCGCCGTGGCTATTGCTTACATCTTGCCGCCGCTGTGCTACATTAAGCT
TGCCACGACCAATTGGCGCACATATGTGGCCTATTCCATTGTTGTGTTTGGCGTCGTCGTCATGATTATTAGCAT
TGTGCAAGCCGTGGGCAAGGCCATATCTGGTGAGTGTATAGCTCTTGTGAAACTCTAGCCCCCCCTTTTTTTTCC
GACTCTTTTTTTTTTTTGCAAGAGGCTAACAAGCGGGATCTAGGCACCGATGCAACAGCAACGTGTACCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail