Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|6278
Gene name
LocationContig_56:69408..70666
Strand+
Gene length (bp)1258
Transcript length (bp)1134
Coding sequence length (bp)1134
Protein length (aa) 378

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) 2.6E-13 153 222

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O74978|YQL5_SCHPO Uncharacterized RNA-binding protein C1827.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1827.05c PE=3 SV=1 85 263 2.0E-45
sp|Q6GL69|MK67I_XENTR MKI67 FHA domain-interacting nucleolar phosphoprotein-like OS=Xenopus tropicalis GN=nifk PE=2 SV=1 137 296 5.0E-31
sp|Q8JIY8|MK67I_DANRE MKI67 FHA domain-interacting nucleolar phosphoprotein OS=Danio rerio GN=nifk PE=2 SV=2 151 296 2.0E-29
sp|Q7SYS2|MK67I_XENLA MKI67 FHA domain-interacting nucleolar phosphoprotein-like OS=Xenopus laevis GN=nifk PE=2 SV=2 137 291 1.0E-28
sp|P53927|NOP15_YEAST Ribosome biogenesis protein 15 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NOP15 PE=1 SV=1 151 238 4.0E-27
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O74978|YQL5_SCHPO Uncharacterized RNA-binding protein C1827.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1827.05c PE=3 SV=1 85 263 2.0E-45
sp|Q6GL69|MK67I_XENTR MKI67 FHA domain-interacting nucleolar phosphoprotein-like OS=Xenopus tropicalis GN=nifk PE=2 SV=1 137 296 5.0E-31
sp|Q8JIY8|MK67I_DANRE MKI67 FHA domain-interacting nucleolar phosphoprotein OS=Danio rerio GN=nifk PE=2 SV=2 151 296 2.0E-29
sp|Q7SYS2|MK67I_XENLA MKI67 FHA domain-interacting nucleolar phosphoprotein-like OS=Xenopus laevis GN=nifk PE=2 SV=2 137 291 1.0E-28
sp|P53927|NOP15_YEAST Ribosome biogenesis protein 15 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NOP15 PE=1 SV=1 151 238 4.0E-27
sp|Q3SZM1|MK67I_BOVIN MKI67 FHA domain-interacting nucleolar phosphoprotein OS=Bos taurus GN=NIFK PE=2 SV=1 151 246 8.0E-27
sp|Q9BYG3|MK67I_HUMAN MKI67 FHA domain-interacting nucleolar phosphoprotein OS=Homo sapiens GN=NIFK PE=1 SV=1 151 246 6.0E-24
sp|Q5RJM0|MK67I_RAT MKI67 FHA domain-interacting nucleolar phosphoprotein OS=Rattus norvegicus GN=Nifk PE=2 SV=1 151 244 3.0E-21
sp|Q91VE6|MK67I_MOUSE MKI67 FHA domain-interacting nucleolar phosphoprotein OS=Mus musculus GN=Nifk PE=1 SV=1 149 246 3.0E-21
sp|Q9SD61|C3H42_ARATH Zinc finger CCCH domain-containing protein 42 OS=Arabidopsis thaliana GN=At3g47120 PE=2 SV=1 152 235 4.0E-08
sp|P25299|RNA15_YEAST mRNA 3'-end-processing protein RNA15 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RNA15 PE=1 SV=1 152 224 7.0E-08
sp|Q99383|HRP1_YEAST Nuclear polyadenylated RNA-binding protein 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HRP1 PE=1 SV=1 153 229 4.0E-07
sp|O43040|CTF1_SCHPO Cleavage and termination factor 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ctf1 PE=1 SV=1 151 214 3.0E-06
sp|Q6IQE0|PU60B_DANRE Poly(U)-binding-splicing factor PUF60-B OS=Danio rerio GN=puf60b PE=2 SV=2 153 295 3.0E-06
sp|Q6FWS2|ESF2_CANGA Pre-rRNA-processing protein ESF2 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=ESF2 PE=3 SV=1 89 270 5.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0003723 RNA binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No
GO:1901363 heterocyclic compound binding No
GO:0097159 organic cyclic compound binding No
GO:0003676 nucleic acid binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4897
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2185
Ophiocordyceps australis map64 (Brazil) OphauB2|6278 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|04345
Ophiocordyceps kimflemingae Ophio5|6314
Ophiocordyceps subramaniannii Hirsu2|1294

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|6278
MAPELRKRKEAKQDVATKTKVERKTTTKTKRKAVDEASPVSLKKQKSTKKTLVQADEKPAKEPVKPKQPKKIAKQ
VEVTKEEIAPKSPAKEPESEDEEDKGILLLADELDSSDDDATENTSLFKPGQDVGNVPAVSEEVRKAAKKPAGER
GVIYVGRIPHGFYEYEMRQYMSQFGPITRLRLSRNPKTGASRHFAFIEFEEASTAEIVAKTMNNYLLFGHLLKVK
VVPPSELHEEVFKGANTRFKKVPWNKIAGKKLEKPHTKSAWEAKVEKERIAREGKLAKLKAIGYEFEAPEFKDVP
LPVPRLVESEDQETKAVESATTLSEAVDEAALPKDQAGQTDRAQETKPVTTISSTKTKVKAKAKTSKFAKSKKRA
KA*
Coding >OphauB2|6278
ATGGCACCTGAACTCAGAAAAAGAAAAGAAGCTAAGCAGGATGTGGCAACAAAAACAAAGGTGGAGAGAAAAACG
ACAACAAAGACCAAGAGAAAAGCTGTCGATGAGGCCTCGCCCGTATCATTGAAGAAGCAAAAGTCAACCAAGAAG
ACATTGGTTCAGGCCGACGAAAAGCCTGCAAAAGAGCCCGTTAAACCCAAGCAACCAAAGAAAATTGCCAAACAA
GTCGAAGTCACCAAGGAGGAGATTGCTCCCAAATCTCCCGCGAAGGAACCAGAATCAGAGGACGAAGAAGACAAG
GGCATTCTGCTGCTGGCTGATGAGCTCGACTCTAGCGACGATGATGCTACGGAAAACACGTCTCTGTTCAAGCCC
GGACAGGACGTCGGGAATGTACCTGCTGTCTCTGAAGAGGTGCGCAAGGCAGCAAAGAAGCCAGCGGGTGAGCGA
GGTGTCATTTACGTTGGCCGCATCCCACACGGCTTCTATGAATATGAAATGAGACAATACATGTCCCAATTCGGC
CCCATCACAAGACTTCGACTTTCGCGCAATCCCAAGACGGGTGCGAGCAGACATTTCGCCTTTATCGAATTCGAA
GAAGCGAGCACGGCCGAAATTGTTGCAAAGACAATGAACAACTACCTGCTCTTTGGGCATCTTCTCAAGGTCAAA
GTGGTGCCTCCAAGTGAGCTGCATGAAGAGGTCTTCAAGGGCGCCAATACCAGGTTCAAAAAGGTGCCATGGAAC
AAGATAGCGGGCAAGAAACTGGAGAAGCCGCATACAAAATCAGCTTGGGAGGCCAAAGTGGAAAAGGAGCGGATC
GCTCGAGAAGGAAAATTGGCCAAGCTCAAGGCAATTGGCTATGAGTTTGAGGCCCCTGAGTTCAAAGATGTCCCT
CTGCCAGTTCCTAGGCTAGTGGAGAGTGAGGACCAGGAGACAAAAGCTGTTGAGTCGGCTACGACTTTGAGCGAA
GCGGTTGATGAGGCGGCTTTACCCAAAGATCAGGCTGGCCAGACAGACAGGGCACAAGAGACAAAGCCGGTGACT
ACAATATCCTCCACAAAGACCAAGGTCAAGGCCAAGGCCAAGACGTCAAAATTTGCCAAGTCGAAGAAGAGGGCA
AAGGCCTAA
Transcript >OphauB2|6278
ATGGCACCTGAACTCAGAAAAAGAAAAGAAGCTAAGCAGGATGTGGCAACAAAAACAAAGGTGGAGAGAAAAACG
ACAACAAAGACCAAGAGAAAAGCTGTCGATGAGGCCTCGCCCGTATCATTGAAGAAGCAAAAGTCAACCAAGAAG
ACATTGGTTCAGGCCGACGAAAAGCCTGCAAAAGAGCCCGTTAAACCCAAGCAACCAAAGAAAATTGCCAAACAA
GTCGAAGTCACCAAGGAGGAGATTGCTCCCAAATCTCCCGCGAAGGAACCAGAATCAGAGGACGAAGAAGACAAG
GGCATTCTGCTGCTGGCTGATGAGCTCGACTCTAGCGACGATGATGCTACGGAAAACACGTCTCTGTTCAAGCCC
GGACAGGACGTCGGGAATGTACCTGCTGTCTCTGAAGAGGTGCGCAAGGCAGCAAAGAAGCCAGCGGGTGAGCGA
GGTGTCATTTACGTTGGCCGCATCCCACACGGCTTCTATGAATATGAAATGAGACAATACATGTCCCAATTCGGC
CCCATCACAAGACTTCGACTTTCGCGCAATCCCAAGACGGGTGCGAGCAGACATTTCGCCTTTATCGAATTCGAA
GAAGCGAGCACGGCCGAAATTGTTGCAAAGACAATGAACAACTACCTGCTCTTTGGGCATCTTCTCAAGGTCAAA
GTGGTGCCTCCAAGTGAGCTGCATGAAGAGGTCTTCAAGGGCGCCAATACCAGGTTCAAAAAGGTGCCATGGAAC
AAGATAGCGGGCAAGAAACTGGAGAAGCCGCATACAAAATCAGCTTGGGAGGCCAAAGTGGAAAAGGAGCGGATC
GCTCGAGAAGGAAAATTGGCCAAGCTCAAGGCAATTGGCTATGAGTTTGAGGCCCCTGAGTTCAAAGATGTCCCT
CTGCCAGTTCCTAGGCTAGTGGAGAGTGAGGACCAGGAGACAAAAGCTGTTGAGTCGGCTACGACTTTGAGCGAA
GCGGTTGATGAGGCGGCTTTACCCAAAGATCAGGCTGGCCAGACAGACAGGGCACAAGAGACAAAGCCGGTGACT
ACAATATCCTCCACAAAGACCAAGGTCAAGGCCAAGGCCAAGACGTCAAAATTTGCCAAGTCGAAGAAGAGGGCA
AAGGCCTAA
Gene >OphauB2|6278
ATGGCACCTGAACTCAGAAAAAGAAAAGGTAAATTACAAATTGTACGCTACAAGTATATTTTATTAATTTTGAAT
ATTCCTCACAGAAGCTAAGCAGGATGTGGCAACAAAAACAAAGGTGGAGAGAAAAACGACAACAAAGACCAAGAG
AAAAGGTGAAAGGGACCACACCGAGTAAATTCTCACTTCTCTCAGCTTGCAACTAAATGCAATCAATCCAGCTGT
CGATGAGGCCTCGCCCGTATCATTGAAGAAGCAAAAGTCAACCAAGAAGACATTGGTTCAGGCCGACGAAAAGCC
TGCAAAAGAGCCCGTTAAACCCAAGCAACCAAAGAAAATTGCCAAACAAGTCGAAGTCACCAAGGAGGAGATTGC
TCCCAAATCTCCCGCGAAGGAACCAGAATCAGAGGACGAAGAAGACAAGGGCATTCTGCTGCTGGCTGATGAGCT
CGACTCTAGCGACGATGATGCTACGGAAAACACGTCTCTGTTCAAGCCCGGACAGGACGTCGGGAATGTACCTGC
TGTCTCTGAAGAGGTGCGCAAGGCAGCAAAGAAGCCAGCGGGTGAGCGAGGTGTCATTTACGTTGGCCGCATCCC
ACACGGCTTCTATGAATATGAAATGAGACAATACATGTCCCAATTCGGCCCCATCACAAGACTTCGACTTTCGCG
CAATCCCAAGACGGGTGCGAGCAGACATTTCGCCTTTATCGAATTCGAAGAAGCGAGCACGGCCGAAATTGTTGC
AAAGACAATGAACAACTACCTGCTCTTTGGGCATCTTCTCAAGGTCAAAGTGGTGCCTCCAAGTGAGCTGCATGA
AGAGGTCTTCAAGGGCGCCAATACCAGGTTCAAAAAGGTGCCATGGAACAAGATAGCGGGCAAGAAACTGGAGAA
GCCGCATACAAAATCAGCTTGGGAGGCCAAAGTGGAAAAGGAGCGGATCGCTCGAGAAGGAAAATTGGCCAAGCT
CAAGGCAATTGGCTATGAGTTTGAGGCCCCTGAGTTCAAAGATGTCCCTCTGCCAGTTCCTAGGCTAGTGGAGAG
TGAGGACCAGGAGACAAAAGCTGTTGAGTCGGCTACGACTTTGAGCGAAGCGGTTGATGAGGCGGCTTTACCCAA
AGATCAGGCTGGCCAGACAGACAGGGCACAAGAGACAAAGCCGGTGACTACAATATCCTCCACAAAGACCAAGGT
CAAGGCCAAGGCCAAGACGTCAAAATTTGCCAAGTCGAAGAAGAGGGCAAAGGCCTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail