Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|6270
Gene name
LocationContig_56:51192..53153
Strand+
Gene length (bp)1961
Transcript length (bp)1755
Coding sequence length (bp)1755
Protein length (aa) 585

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF18380 GEN1_C Holliday junction resolvase Gen1 C-terminal domain 3.8E-29 348 453
PF00867 XPG_I XPG I-region 3.0E-24 111 199
PF00752 XPG_N XPG N-terminal domain 9.9E-06 1 94

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O50123|FEN_PYRHO Flap endonuclease 1 OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=fen PE=1 SV=1 34 218 3.0E-20
sp|O93634|FEN_PYRFU Flap endonuclease 1 OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=fen PE=1 SV=1 34 218 5.0E-20
sp|Q9V0P9|FEN_PYRAB Flap endonuclease 1 OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=fen PE=3 SV=1 34 218 5.0E-20
sp|Q17RS7|GEN_HUMAN Flap endonuclease GEN homolog 1 OS=Homo sapiens GN=GEN1 PE=1 SV=2 35 225 5.0E-19
sp|Q8BMI4|GEN_MOUSE Flap endonuclease GEN homolog 1 OS=Mus musculus GN=Gen1 PE=1 SV=2 35 225 7.0E-19
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O50123|FEN_PYRHO Flap endonuclease 1 OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=fen PE=1 SV=1 34 218 3.0E-20
sp|O93634|FEN_PYRFU Flap endonuclease 1 OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=fen PE=1 SV=1 34 218 5.0E-20
sp|Q9V0P9|FEN_PYRAB Flap endonuclease 1 OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=fen PE=3 SV=1 34 218 5.0E-20
sp|Q17RS7|GEN_HUMAN Flap endonuclease GEN homolog 1 OS=Homo sapiens GN=GEN1 PE=1 SV=2 35 225 5.0E-19
sp|Q8BMI4|GEN_MOUSE Flap endonuclease GEN homolog 1 OS=Mus musculus GN=Gen1 PE=1 SV=2 35 225 7.0E-19
sp|C6A1U9|FEN_THESM Flap endonuclease 1 OS=Thermococcus sibiricus (strain MM 739 / DSM 12597) GN=fen PE=3 SV=1 34 218 1.0E-18
sp|Q2FNC9|FEN_METHJ Flap endonuclease 1 OS=Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1) GN=fen PE=3 SV=1 60 232 6.0E-18
sp|Q4JAN1|FEN_SULAC Flap endonuclease 1 OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=fen PE=3 SV=2 28 214 7.0E-17
sp|C6TEX6|FEN1_SOYBN Flap endonuclease 1 OS=Glycine max GN=FEN1 PE=2 SV=1 1 289 1.0E-16
sp|Q976H6|FEN_SULTO Flap endonuclease 1 OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=fen PE=3 SV=2 34 213 1.0E-16
sp|Q6L2I9|FEN_PICTO Flap endonuclease 1 OS=Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828) GN=fen PE=3 SV=1 41 218 2.0E-16
sp|A8QCH0|FEN1_BRUMA Flap endonuclease 1 OS=Brugia malayi GN=FEN1 PE=3 SV=1 1 215 2.0E-16
sp|Q9SXQ6|FEN11_ORYSJ Flap endonuclease 1-A OS=Oryza sativa subsp. japonica GN=FEN-1a PE=2 SV=1 1 218 2.0E-16
sp|B8AW67|FEN11_ORYSI Flap endonuclease 1-A OS=Oryza sativa subsp. indica GN=FEN1a PE=3 SV=1 1 218 2.0E-16
sp|Q4R5U5|FEN1_MACFA Flap endonuclease 1 OS=Macaca fascicularis GN=FEN1 PE=2 SV=1 1 247 3.0E-16
sp|Q75DS8|FEN1_ASHGO Flap endonuclease 1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=FEN1 PE=3 SV=2 34 209 4.0E-16
sp|Q8TXU4|FEN_METKA Flap endonuclease 1 OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=fen PE=1 SV=1 35 232 4.0E-16
sp|C5YUK3|FEN11_SORBI Flap endonuclease 1-A OS=Sorghum bicolor GN=FEN1-A PE=3 SV=1 1 218 5.0E-16
sp|Q980U8|FEN_SULSO Flap endonuclease 1 OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=fen PE=1 SV=2 28 209 5.0E-16
sp|C5A639|FEN_THEGJ Flap endonuclease 1 OS=Thermococcus gammatolerans (strain DSM 15229 / JCM 11827 / EJ3) GN=fen PE=3 SV=1 34 214 5.0E-16
sp|Q5B9L6|FEN1_EMENI Flap endonuclease 1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=fen1 PE=3 SV=1 1 218 6.0E-16
sp|Q178M1|FEN1_AEDAE Flap endonuclease 1 OS=Aedes aegypti GN=Fen1 PE=3 SV=1 1 215 6.0E-16
sp|A9U328|FEN12_PHYPA Flap endonuclease 1-B OS=Physcomitrella patens subsp. patens GN=FEN1-B PE=3 SV=1 1 284 8.0E-16
sp|A5ABU3|FEN1_ASPNC Flap endonuclease 1 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=fen1 PE=3 SV=1 1 218 8.0E-16
sp|C8BKD0|FEN1_SHEEP Flap endonuclease 1 OS=Ovis aries GN=FEN1 PE=2 SV=1 1 215 8.0E-16
sp|Q58DH8|FEN1_BOVIN Flap endonuclease 1 OS=Bos taurus GN=FEN1 PE=2 SV=1 1 215 9.0E-16
sp|B6AFP1|FEN1_CRYMR Flap endonuclease 1 OS=Cryptosporidium muris (strain RN66) GN=FEN1 PE=3 SV=1 1 282 9.0E-16
sp|P39748|FEN1_HUMAN Flap endonuclease 1 OS=Homo sapiens GN=FEN1 PE=1 SV=1 1 247 1.0E-15
sp|Q5XIP6|FEN1_RAT Flap endonuclease 1 OS=Rattus norvegicus GN=Fen1 PE=2 SV=1 1 215 1.0E-15
sp|B1L6R9|FEN_KORCO Flap endonuclease 1 OS=Korarchaeum cryptofilum (strain OPF8) GN=fen PE=3 SV=1 34 218 1.0E-15
sp|Q58839|FEN_METJA Flap endonuclease 1 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=fen PE=1 SV=1 34 227 1.0E-15
sp|B6YWX4|FEN_THEON Flap endonuclease 1 OS=Thermococcus onnurineus (strain NA1) GN=fen PE=3 SV=1 34 214 2.0E-15
sp|P14629|ERCC5_XENLA DNA repair protein complementing XP-G cells homolog OS=Xenopus laevis GN=ercc5 PE=2 SV=1 95 333 2.0E-15
sp|Q0CBS0|FEN1_ASPTN Flap endonuclease 1 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=fen1 PE=3 SV=2 1 218 3.0E-15
sp|A1D8A4|FEN1_NEOFI Flap endonuclease 1 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=fen1 PE=3 SV=1 1 218 3.0E-15
sp|Q4WWJ1|FEN1_ASPFU Flap endonuclease 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=fen1 PE=3 SV=2 1 218 4.0E-15
sp|Q5JGN0|FEN_THEKO Flap endonuclease 1 OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=fen PE=3 SV=1 34 214 4.0E-15
sp|Q9LPD2|GENL1_ARATH Flap endonuclease GEN-like 1 OS=Arabidopsis thaliana GN=GEN1 PE=2 SV=3 34 218 5.0E-15
sp|B0XZ33|FEN1_ASPFC Flap endonuclease 1 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=fen1 PE=3 SV=2 1 218 5.0E-15
sp|Q5ZLN4|FEN1_CHICK Flap endonuclease 1 OS=Gallus gallus GN=FEN1 PE=2 SV=1 1 215 5.0E-15
sp|B4FHY0|FEN1_MAIZE Flap endonuclease 1 OS=Zea mays GN=FEN1 PE=2 SV=1 1 218 5.0E-15
sp|P70054|FEN1B_XENLA Flap endonuclease 1-B OS=Xenopus laevis GN=fen1-b PE=1 SV=1 1 218 6.0E-15
sp|B8NV37|FEN1_ASPFN Flap endonuclease 1 OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=fen1 PE=3 SV=1 1 223 6.0E-15
sp|A9S0B8|FEN11_PHYPA Flap endonuclease 1-A OS=Physcomitrella patens subsp. patens GN=FEN1-A PE=3 SV=1 1 218 8.0E-15
sp|B8MNF2|FEN1_TALSN Flap endonuclease 1 OS=Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) GN=fen1 PE=3 SV=2 1 218 9.0E-15
sp|Q4FYU7|FEN1_LEIMA Flap endonuclease 1 OS=Leishmania major GN=FEN1 PE=3 SV=1 34 289 9.0E-15
sp|Q75LI2|FEN12_ORYSJ Flap endonuclease 1-B OS=Oryza sativa subsp. japonica GN=FEN-1b PE=2 SV=1 1 218 1.0E-14
sp|B8AMS4|FEN12_ORYSI Flap endonuclease 1-B OS=Oryza sativa subsp. indica GN=FEN1b PE=3 SV=1 1 218 1.0E-14
sp|P07276|RAD2_YEAST DNA repair protein RAD2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RAD2 PE=1 SV=2 76 316 2.0E-14
sp|O29975|FEN_ARCFU Flap endonuclease 1 OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=fen PE=1 SV=1 34 214 2.0E-14
sp|A0RU95|FEN_CENSY Flap endonuclease 1 OS=Cenarchaeum symbiosum (strain A) GN=fen PE=3 SV=1 35 215 2.0E-14
sp|O65251|FEN1_ARATH Flap endonuclease 1 OS=Arabidopsis thaliana GN=FEN1 PE=2 SV=2 1 218 2.0E-14
sp|P28715|ERCC5_HUMAN DNA repair protein complementing XP-G cells OS=Homo sapiens GN=ERCC5 PE=1 SV=3 95 317 2.0E-14
sp|A7RRJ0|FEN1_NEMVE Flap endonuclease 1 OS=Nematostella vectensis GN=FEN1 PE=3 SV=1 1 218 2.0E-14
sp|B4QIG6|FEN1_DROSI Flap endonuclease 1 OS=Drosophila simulans GN=Fen1 PE=3 SV=1 16 215 2.0E-14
sp|C5DZA9|FEN1_ZYGRC Flap endonuclease 1 OS=Zygosaccharomyces rouxii (strain ATCC 2623 / CBS 732 / NBRC 1130 / NCYC 568 / NRRL Y-229) GN=FEN1 PE=3 SV=1 1 209 3.0E-14
sp|A5UL52|FEN_METS3 Flap endonuclease 1 OS=Methanobrevibacter smithii (strain PS / ATCC 35061 / DSM 861) GN=fen PE=3 SV=1 49 268 3.0E-14
sp|B4J6M4|FEN1_DROGR Flap endonuclease 1 OS=Drosophila grimshawi GN=Fen1 PE=3 SV=1 1 215 3.0E-14
sp|Q7K7A9|FEN1_DROME Flap endonuclease 1 OS=Drosophila melanogaster GN=Fen1 PE=2 SV=1 16 215 3.0E-14
sp|B3NP61|FEN1_DROER Flap endonuclease 1 OS=Drosophila erecta GN=Fen1 PE=3 SV=1 16 215 3.0E-14
sp|B4HTA1|FEN1_DROSE Flap endonuclease 1 OS=Drosophila sechellia GN=Fen1 PE=3 SV=1 16 215 3.0E-14
sp|A1RWY2|FEN_THEPD Flap endonuclease 1 OS=Thermofilum pendens (strain Hrk 5) GN=fen PE=3 SV=1 35 218 4.0E-14
sp|B4LM90|FEN1_DROVI Flap endonuclease 1 OS=Drosophila virilis GN=Fen1 PE=3 SV=1 16 247 4.0E-14
sp|C4JDR3|FEN1_UNCRE Flap endonuclease 1 OS=Uncinocarpus reesii (strain UAMH 1704) GN=FEN1 PE=3 SV=2 1 218 4.0E-14
sp|P61942|FEN_NANEQ Flap endonuclease 1 OS=Nanoarchaeum equitans (strain Kin4-M) GN=fen PE=3 SV=1 35 225 4.0E-14
sp|C5WU23|FEN12_SORBI Flap endonuclease 1-B OS=Sorghum bicolor GN=FEN1-B PE=3 SV=2 57 218 4.0E-14
sp|A7IA59|FEN_METB6 Flap endonuclease 1 OS=Methanoregula boonei (strain 6A8) GN=fen PE=3 SV=1 49 220 4.0E-14
sp|P39750|FEN1_SCHPO Flap endonuclease 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rad2 PE=1 SV=1 1 218 4.0E-14
sp|A1CJ75|FEN1_ASPCL Flap endonuclease 1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=fen1 PE=3 SV=2 1 218 5.0E-14
sp|C3ZBT0|FEN1_BRAFL Flap endonuclease 1 OS=Branchiostoma floridae GN=FEN1 PE=3 SV=1 1 218 5.0E-14
sp|B3MDA3|FEN1_DROAN Flap endonuclease 1 OS=Drosophila ananassae GN=Fen1 PE=3 SV=1 16 215 5.0E-14
sp|P39749|FEN1_MOUSE Flap endonuclease 1 OS=Mus musculus GN=Fen1 PE=1 SV=1 30 215 5.0E-14
sp|B4GIM3|FEN1_DROPE Flap endonuclease 1 OS=Drosophila persimilis GN=Fen1 PE=3 SV=1 16 215 6.0E-14
sp|B1H158|FEN1_XENTR Flap endonuclease 1 OS=Xenopus tropicalis GN=fen1 PE=2 SV=1 1 218 7.0E-14
sp|B5DUR8|FEN1_DROPS Flap endonuclease 1 OS=Drosophila pseudoobscura pseudoobscura GN=Fen1 PE=3 SV=1 16 215 7.0E-14
sp|C5FZT5|FEN1_ARTOC Flap endonuclease 1 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=FEN1 PE=3 SV=1 1 218 9.0E-14
sp|B6HEM2|FEN1_PENRW Flap endonuclease 1 OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=fen1 PE=3 SV=1 1 213 1.0E-13
sp|B0UXL7|FEN1B_DANRE Probable flap endonuclease 1 homolog OS=Danio rerio GN=si:dkeyp-13a3.3 PE=2 SV=1 35 209 1.0E-13
sp|A4HFE4|FEN1_LEIBR Flap endonuclease 1 OS=Leishmania braziliensis GN=FEN1 PE=3 SV=1 34 289 1.0E-13
sp|A8J2Z9|FEN1_CHLRE Flap endonuclease 1 OS=Chlamydomonas reinhardtii GN=FEN1 PE=3 SV=1 1 219 1.0E-13
sp|A6QV55|FEN1_AJECN Flap endonuclease 1 OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=FEN1 PE=3 SV=1 1 218 1.0E-13
sp|B4MR84|FEN1_DROWI Flap endonuclease 1 OS=Drosophila willistoni GN=Fen1 PE=3 SV=1 16 215 1.0E-13
sp|C6HQJ2|FEN1_AJECH Flap endonuclease 1 OS=Ajellomyces capsulatus (strain H143) GN=FEN1 PE=3 SV=2 1 218 1.0E-13
sp|B4P5U9|FEN1_DROYA Flap endonuclease 1 OS=Drosophila yakuba GN=Fen1 PE=3 SV=1 16 215 2.0E-13
sp|B6QT52|FEN1_TALMQ Flap endonuclease 1 OS=Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) GN=fen1 PE=3 SV=2 1 218 2.0E-13
sp|B4KNM1|FEN1_DROMO Flap endonuclease 1 OS=Drosophila mojavensis GN=Fen1 PE=3 SV=1 16 215 2.0E-13
sp|C7Z125|FEN1_NECH7 Flap endonuclease 1 OS=Nectria haematococca (strain 77-13-4 / ATCC MYA-4622 / FGSC 9596 / MPVI) GN=FEN1 PE=3 SV=1 30 218 2.0E-13
sp|P70040|FEN1A_XENLA Flap endonuclease 1-A OS=Xenopus laevis GN=fen1-a PE=1 SV=1 1 218 3.0E-13
sp|D3TQJ5|FEN1_GLOMM Flap endonuclease 1 OS=Glossina morsitans morsitans GN=Fen1 PE=2 SV=1 30 215 3.0E-13
sp|A6UX46|FEN_META3 Flap endonuclease 1 OS=Methanococcus aeolicus (strain Nankai-3 / ATCC BAA-1280) GN=fen PE=3 SV=1 35 213 3.0E-13
sp|Q8ZYN2|FEN_PYRAE Flap endonuclease 1 OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=fen PE=3 SV=1 35 215 3.0E-13
sp|A3CWV2|FEN_METMJ Flap endonuclease 1 OS=Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1) GN=fen PE=3 SV=1 60 232 3.0E-13
sp|Q9ATY5|UVH3_ARATH DNA repair protein UVH3 OS=Arabidopsis thaliana GN=UVH3 PE=2 SV=1 76 219 4.0E-13
sp|A4S1G4|FEN1_OSTLU Flap endonuclease 1 OS=Ostreococcus lucimarinus (strain CCE9901) GN=FEN1 PE=3 SV=1 34 213 4.0E-13
sp|Q64MA3|GENL1_ORYSJ Flap endonuclease GEN-like 1 OS=Oryza sativa subsp. japonica GN=RAD PE=2 SV=1 34 213 4.0E-13
sp|B3LQY3|FEN1_YEAS1 Flap endonuclease 1 OS=Saccharomyces cerevisiae (strain RM11-1a) GN=RAD27 PE=3 SV=1 1 253 4.0E-13
sp|Q0W6I0|FEN_METAR Flap endonuclease 1 OS=Methanocella arvoryzae (strain DSM 22066 / NBRC 105507 / MRE50) GN=fen PE=3 SV=1 50 268 4.0E-13
sp|A4I2L4|FEN1_LEIIN Flap endonuclease 1 OS=Leishmania infantum GN=FEN1 PE=3 SV=1 34 234 5.0E-13
sp|B3L014|FEN1_PLAKH Flap endonuclease 1 OS=Plasmodium knowlesi (strain H) GN=FEN1 PE=3 SV=1 1 213 5.0E-13
sp|Q9GZ01|FEN1_PLAFA Flap endonuclease 1 OS=Plasmodium falciparum GN=FEN1 PE=2 SV=1 1 213 5.0E-13
sp|A8M9L3|FEN_CALMQ Flap endonuclease 1 OS=Caldivirga maquilingensis (strain ATCC 700844 / DSM 13496 / JCM 10307 / IC-167) GN=fen PE=3 SV=1 14 214 6.0E-13
sp|B7G7Y7|FEN1_PHATC Flap endonuclease 1 OS=Phaeodactylum tricornutum (strain CCAP 1055/1) GN=FEN1 PE=3 SV=1 1 218 6.0E-13
sp|C1E3X9|FEN1_MICSR Flap endonuclease 1 OS=Micromonas sp. (strain RCC299 / NOUM17) GN=FEN1 PE=3 SV=1 34 209 7.0E-13
sp|Q7K734|FEN1_PLAF7 Flap endonuclease 1 OS=Plasmodium falciparum (isolate 3D7) GN=FEN1 PE=3 SV=1 1 213 7.0E-13
sp|A2SQC6|FEN_METLZ Flap endonuclease 1 OS=Methanocorpusculum labreanum (strain ATCC 43576 / DSM 4855 / Z) GN=fen PE=3 SV=1 40 220 7.0E-13
sp|C5JVG7|FEN1_AJEDS Flap endonuclease 1 OS=Ajellomyces dermatitidis (strain SLH14081) GN=FEN1 PE=3 SV=2 1 218 7.0E-13
sp|C5GPA7|FEN1_AJEDR Flap endonuclease 1 OS=Ajellomyces dermatitidis (strain ER-3 / ATCC MYA-2586) GN=FEN1 PE=3 SV=2 1 218 7.0E-13
sp|Q6FM28|FEN1_CANGA Flap endonuclease 1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=FEN1 PE=3 SV=1 1 209 8.0E-13
sp|C5DGG4|FEN1_LACTC Flap endonuclease 1 OS=Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284) GN=FEN1 PE=3 SV=1 1 209 8.0E-13
sp|D1ZT73|FEN1_SORMK Flap endonuclease 1 OS=Sordaria macrospora (strain ATCC MYA-333 / DSM 997 / K(L3346) / K-hell) GN=FEN1 PE=3 SV=1 1 218 9.0E-13
sp|Q9M2Z3|GENL2_ARATH Flap endonuclease GEN-like 2 OS=Arabidopsis thaliana GN=GEN2 PE=2 SV=2 34 225 1.0E-12
sp|Q7Q323|FEN1_ANOGA Flap endonuclease 1 OS=Anopheles gambiae GN=Fen1 PE=3 SV=2 1 215 1.0E-12
sp|A7UW97|FEN1_NEUCR Flap endonuclease 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=dnr-8 PE=3 SV=2 30 218 1.0E-12
sp|Q6C116|FEN1_YARLI Flap endonuclease 1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=FEN1 PE=3 SV=1 1 213 1.0E-12
sp|P26793|FEN1_YEAST Flap endonuclease 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RAD27 PE=1 SV=1 1 253 1.0E-12
sp|C8ZC62|FEN1_YEAS8 Flap endonuclease 1 OS=Saccharomyces cerevisiae (strain Lalvin EC1118 / Prise de mousse) GN=RAD27 PE=3 SV=1 1 253 1.0E-12
sp|A6ZZK4|FEN1_YEAS7 Flap endonuclease 1 OS=Saccharomyces cerevisiae (strain YJM789) GN=RAD27 PE=3 SV=1 1 253 1.0E-12
sp|C7GVJ8|FEN1_YEAS2 Flap endonuclease 1 OS=Saccharomyces cerevisiae (strain JAY291) GN=RAD27 PE=3 SV=1 1 253 1.0E-12
sp|P35689|ERCC5_MOUSE DNA repair protein complementing XP-G cells homolog OS=Mus musculus GN=Ercc5 PE=1 SV=4 87 317 2.0E-12
sp|Q5I4H3|FEN1_XIPMA Flap endonuclease 1 OS=Xiphophorus maculatus GN=fen1 PE=2 SV=1 30 218 2.0E-12
sp|Q9VRJ0|GEN_DROME Flap endonuclease GEN OS=Drosophila melanogaster GN=Gen PE=1 SV=1 28 202 2.0E-12
sp|A2BMI0|FEN_HYPBU Flap endonuclease 1 OS=Hyperthermus butylicus (strain DSM 5456 / JCM 9403 / PLM1-5) GN=fen PE=3 SV=1 35 219 2.0E-12
sp|Q8SS91|FEN1_ENCCU Flap endonuclease 1 OS=Encephalitozoon cuniculi (strain GB-M1) GN=FEN1 PE=3 SV=1 34 213 2.0E-12
sp|Q9N3T2|FEN1_CAEEL Flap endonuclease 1 OS=Caenorhabditis elegans GN=crn-1 PE=1 SV=1 1 218 2.0E-12
sp|B8GIA0|FEN_METPE Flap endonuclease 1 OS=Methanosphaerula palustris (strain ATCC BAA-1556 / DSM 19958 / E1-9c) GN=fen PE=3 SV=1 60 232 3.0E-12
sp|A5KAL1|FEN1_PLAVS Flap endonuclease 1 OS=Plasmodium vivax (strain Salvador I) GN=FEN1 PE=3 SV=1 1 213 3.0E-12
sp|B2VTT3|FEN1_PYRTR Flap endonuclease 1 OS=Pyrenophora tritici-repentis (strain Pt-1C-BFP) GN=fen1 PE=3 SV=2 1 282 4.0E-12
sp|A3DMG2|FEN_STAMF Flap endonuclease 1 OS=Staphylothermus marinus (strain ATCC 43588 / DSM 3639 / JCM 9404 / F1) GN=fen PE=3 SV=1 49 219 4.0E-12
sp|Q013G9|FEN1_OSTTA Flap endonuclease 1 OS=Ostreococcus tauri GN=FEN1 PE=3 SV=2 34 213 5.0E-12
sp|A3MY15|FEN_PYRCJ Flap endonuclease 1 OS=Pyrobaculum calidifontis (strain JCM 11548 / VA1) GN=fen PE=3 SV=1 35 209 7.0E-12
sp|P28706|RAD13_SCHPO DNA repair protein rad13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rad13 PE=2 SV=2 86 316 7.0E-12
sp|A1RSC7|FEN_PYRIL Flap endonuclease 1 OS=Pyrobaculum islandicum (strain DSM 4184 / JCM 9189 / GEO3) GN=fen PE=3 SV=1 1 215 8.0E-12
sp|A8AAC1|FEN_IGNH4 Flap endonuclease 1 OS=Ignicoccus hospitalis (strain KIN4/I / DSM 18386 / JCM 14125) GN=fen PE=3 SV=1 17 223 9.0E-12
sp|A4WNC4|FEN_PYRAR Flap endonuclease 1 OS=Pyrobaculum arsenaticum (strain DSM 13514 / JCM 11321) GN=fen PE=3 SV=1 35 209 9.0E-12
sp|Q5A6K8|FEN1_CANAL Flap endonuclease 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RAD27 PE=3 SV=1 30 309 9.0E-12
sp|Q4DKQ5|FEN1_TRYCC Flap endonuclease 1 OS=Trypanosoma cruzi (strain CL Brener) GN=FEN1 PE=3 SV=1 34 218 9.0E-12
sp|C5M2X8|FEN1_CANTT Flap endonuclease 1 OS=Candida tropicalis (strain ATCC MYA-3404 / T1) GN=RAD27 PE=3 SV=1 30 309 1.0E-11
sp|B0DSN9|FEN11_LACBS Flap endonuclease 1-A OS=Laccaria bicolor (strain S238N-H82 / ATCC MYA-4686) GN=FEN11 PE=3 SV=1 30 282 1.0E-11
sp|D2V434|FEN1_NAEGR Flap endonuclease 1 OS=Naegleria gruberi GN=FEN1 PE=3 SV=1 1 327 1.0E-11
sp|C9ZKW4|FEN1_TRYB9 Flap endonuclease 1 OS=Trypanosoma brucei gambiense (strain MHOM/CI/86/DAL972) GN=FEN1 PE=3 SV=1 34 218 1.0E-11
sp|Q57WW6|FEN1_TRYB2 Flap endonuclease 1 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) GN=FEN1 PE=3 SV=1 34 218 1.0E-11
sp|Q9YFY5|FEN_AERPE Flap endonuclease 1 OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=fen PE=3 SV=3 60 214 2.0E-11
sp|C1BM18|FEN1_OSMMO Flap endonuclease 1 OS=Osmerus mordax GN=fen1 PE=2 SV=1 1 218 2.0E-11
sp|C4YLS2|FEN1_CANAW Flap endonuclease 1 OS=Candida albicans (strain WO-1) GN=RAD27 PE=3 SV=1 30 309 2.0E-11
sp|Q4UFP0|FEN1_THEAN Flap endonuclease 1 OS=Theileria annulata GN=FEN1 PE=3 SV=1 1 213 3.0E-11
sp|Q12UT1|FEN_METBU Flap endonuclease 1 OS=Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M) GN=fen PE=3 SV=1 49 218 3.0E-11
sp|Q8PYF6|FEN_METMA Flap endonuclease 1 OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=fen PE=3 SV=1 49 245 3.0E-11
sp|Q97B98|FEN_THEVO Flap endonuclease 1 OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=fen PE=3 SV=1 49 214 4.0E-11
sp|B9WLQ5|FEN1_CANDC Flap endonuclease 1 OS=Candida dubliniensis (strain CD36 / ATCC MYA-646 / CBS 7987 / NCPF 3949 / NRRL Y-17841) GN=RAD27 PE=3 SV=1 30 309 4.0E-11
sp|Q4Z015|FEN1_PLABA Flap endonuclease 1 OS=Plasmodium berghei (strain Anka) GN=FEN1 PE=3 SV=1 1 213 6.0E-11
sp|A3M056|FEN1_PICST Flap endonuclease 1 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=FEN1 PE=3 SV=2 1 209 6.0E-11
sp|P0CS60|FEN1_CRYNJ Flap endonuclease 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=FEN1 PE=3 SV=1 30 218 6.0E-11
sp|P0CS61|FEN1_CRYNB Flap endonuclease 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=FEN1 PE=3 SV=1 30 218 6.0E-11
sp|A9A4B0|FEN_NITMS Flap endonuclease 1 OS=Nitrosopumilus maritimus (strain SCM1) GN=fen PE=3 SV=1 35 218 8.0E-11
sp|Q4XXP8|FEN1_PLACH Flap endonuclease 1 OS=Plasmodium chabaudi GN=FEN1 PE=3 SV=1 1 213 8.0E-11
sp|Q9HJD4|FEN_THEAC Flap endonuclease 1 OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=fen PE=3 SV=1 49 214 8.0E-11
sp|Q29FC1|GEN_DROPS Flap endonuclease GEN OS=Drosophila pseudoobscura pseudoobscura GN=Gen PE=3 SV=1 28 202 8.0E-11
sp|Q7RME3|FEN1_PLAYO Flap endonuclease 1 OS=Plasmodium yoelii yoelii GN=FEN1 PE=3 SV=1 1 213 8.0E-11
sp|A5E121|FEN1_LODEL Flap endonuclease 1 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=FEN1 PE=3 SV=1 30 209 1.0E-10
sp|A4QS18|FEN1_MAGO7 Flap endonuclease 1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=FEN1 PE=3 SV=2 51 277 1.0E-10
sp|B1YC46|FEN_PYRNV Flap endonuclease 1 OS=Pyrobaculum neutrophilum (strain DSM 2338 / JCM 9278 / V24Sta) GN=fen PE=3 SV=1 35 215 1.0E-10
sp|A0CYG2|FEN12_PARTE Flap endonuclease 1-2 OS=Paramecium tetraurelia GN=FEN1-2 PE=3 SV=1 1 312 2.0E-10
sp|Q6CLH4|FEN1_KLULA Flap endonuclease 1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=FEN1 PE=3 SV=1 30 209 2.0E-10
sp|Q46D63|FEN_METBF Flap endonuclease 1 OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=fen PE=3 SV=1 49 245 2.0E-10
sp|A8NQC2|FEN1_COPC7 Flap endonuclease 1 OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=FEN1 PE=3 SV=3 1 218 3.0E-10
sp|Q8TIY5|FEN_METAC Flap endonuclease 1 OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=fen PE=3 SV=1 49 245 7.0E-10
sp|B6JYI7|FEN1_SCHJY Flap endonuclease 1 OS=Schizosaccharomyces japonicus (strain yFS275 / FY16936) GN=rad2 PE=3 SV=1 1 218 8.0E-10
sp|A0B9M7|FEN_METTP Flap endonuclease 1 OS=Methanosaeta thermophila (strain DSM 6194 / JCM 14653 / NBRC 101360 / PT) GN=fen PE=3 SV=1 49 218 2.0E-09
sp|O27670|FEN_METTH Flap endonuclease 1 OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=fen PE=3 SV=1 1 218 5.0E-09
sp|Q8W5R1|GENL2_ORYSJ Flap endonuclease GEN-like 2 OS=Oryza sativa subsp. japonica GN=SEND1 PE=2 SV=1 34 240 9.0E-09
sp|Q60GC1|EXO1_ORYSJ Exonuclease 1 OS=Oryza sativa subsp. japonica GN=EXO1 PE=2 SV=1 1 213 2.0E-08
sp|A7AX58|FEN1_BABBO Flap endonuclease 1 OS=Babesia bovis GN=FEN1 PE=3 SV=1 1 161 4.0E-08
sp|Q18HK0|FEN_HALWD Flap endonuclease 1 OS=Haloquadratum walsbyi (strain DSM 16790 / HBSQ001) GN=fen PE=3 SV=1 80 216 4.0E-08
sp|Q5V5T7|FEN_HALMA Flap endonuclease 1 OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=fen PE=3 SV=1 87 215 2.0E-07
sp|Q2NFD4|FEN_METST Flap endonuclease 1 OS=Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3) GN=fen PE=3 SV=1 51 211 3.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0004518 nuclease activity Yes
GO:0003824 catalytic activity No
GO:0016788 hydrolase activity, acting on ester bonds No
GO:0003674 molecular_function No
GO:0016787 hydrolase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 52 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|6270
MGIKGIYRELGTGRRVSLSKLAADSFGSEGRPFRIAIDVAIWQFQAQAARGGTNPAIRTLFYRLVRLLGTPIQPI
FVFDGPHKPAFKRNKRSKKVNGIATAQAKLLIRLFGFVIHDAPGEAEAECALLQQHGIVDAVLSEDVDTIMFGCT
NTLRNWSAEGKTAGSPTHVSLYNVDDVNLANLGLNREGMVLVALMSGGDYLPEGIPGCGVKVACEAARAGFGNSV
CRLKLSDTSGIESWRSSLIHELRSNNGKHFRCKHPALTIADDFPNLEILRYYTHPVVSQESTLDSVRQKLAKRGE
IDIDSLREFTRETFDWDYRIGAIKFIRVLAPALLVHKIRHEQKDSEGYVKRVHGRRLHVSTDATPELRLSYVPSE
VVPIDLSNEVDQEINYDRQGLALNSDDDFEGAVEDKDAAEENKPTAVKTFDVSKPELVWVLEKVVRQCLPKAVQE
WDKEQEAKAAKAAAKPSARAKVKKSNMAHGALDGFVRVIKPPDRALATTFENRSQLPGFSSAGSRCSRLPPSQTS
LQSQQAVQRRLSSHLALQGRRLLLESRLRPEVCSTAAQWCVVLGRPWFGPLLKMTSLVR*
Coding >OphauB2|6270
ATGGGCATCAAAGGCATCTATCGCGAGCTGGGCACAGGGAGGCGTGTCTCCCTGTCAAAACTTGCTGCCGACAGC
TTCGGCTCTGAGGGCAGACCTTTTCGAATAGCCATCGATGTCGCCATTTGGCAGTTTCAGGCTCAAGCCGCCCGA
GGCGGAACAAACCCAGCCATTCGAACCCTCTTCTACCGCCTTGTCAGGCTACTCGGAACCCCGATACAGCCCATC
TTCGTTTTTGACGGGCCTCACAAGCCCGCTTTCAAGAGAAACAAGCGCTCGAAAAAGGTCAACGGCATCGCAACG
GCTCAGGCCAAACTGCTGATTCGACTCTTTGGATTCGTCATCCACGATGCGCCAGGAGAGGCCGAGGCTGAATGC
GCTCTGCTACAACAACACGGCATCGTGGACGCTGTGCTGAGCGAAGATGTTGACACAATCATGTTTGGCTGCACA
AACACGCTGCGCAACTGGTCTGCTGAAGGCAAAACTGCAGGCTCGCCCACTCATGTGTCGCTCTACAACGTCGAC
GACGTCAACCTTGCCAATCTAGGACTGAACCGCGAAGGAATGGTGCTTGTTGCACTAATGAGTGGCGGCGACTAT
TTGCCTGAAGGCATTCCGGGATGCGGCGTCAAGGTGGCGTGTGAGGCTGCCAGAGCTGGTTTTGGAAACTCGGTC
TGTCGCTTGAAGCTGTCCGACACGAGCGGCATAGAGTCTTGGAGAAGCTCCCTGATACACGAGCTGAGAAGCAAC
AATGGCAAACACTTTCGCTGCAAGCACCCAGCCCTGACAATAGCCGACGATTTTCCCAATCTCGAAATCTTGCGC
TACTATACCCATCCCGTCGTCTCCCAAGAATCGACGCTGGACTCGGTGCGGCAGAAACTGGCAAAGAGAGGAGAG
ATTGACATTGATTCCCTGCGCGAATTTACCAGAGAAACCTTTGACTGGGATTATCGGATAGGCGCCATCAAGTTT
ATTCGAGTCTTGGCCCCGGCTCTCCTGGTACACAAGATTCGACACGAGCAAAAGGACAGTGAGGGTTATGTCAAG
CGCGTCCACGGGCGGCGACTTCACGTGAGCACAGACGCTACGCCAGAGCTAAGGTTATCGTACGTGCCTTCTGAA
GTTGTGCCCATTGATTTGTCCAACGAGGTTGATCAGGAAATCAACTATGATCGCCAAGGCCTGGCACTCAACAGC
GATGACGACTTTGAAGGCGCTGTAGAAGACAAAGATGCGGCTGAAGAGAACAAGCCGACTGCCGTCAAGACTTTT
GATGTCAGCAAACCCGAGCTCGTGTGGGTTTTGGAAAAGGTTGTGCGGCAATGTCTCCCCAAGGCGGTGCAAGAA
TGGGACAAGGAACAAGAGGCAAAGGCGGCAAAGGCGGCTGCCAAGCCCTCAGCCCGAGCAAAGGTCAAAAAGTCA
AACATGGCTCATGGCGCTCTTGATGGGTTTGTTCGTGTCATCAAGCCTCCTGATAGAGCACTGGCGACTACCTTT
GAAAACAGGAGCCAGCTACCAGGGTTTTCCTCGGCCGGCTCTCGGTGCTCTCGGCTGCCACCTTCTCAAACCAGC
CTTCAAAGCCAGCAAGCCGTGCAGAGGCGATTGTCATCCCATCTAGCCCTGCAGGGCCGTCGTCTCCTGCTGGAA
AGCCGCCTGCGCCCAGAGGTGTGCTCGACAGCAGCCCAGTGGTGTGTGGTGCTCGGAAGACCATGGTTTGGCCCC
TTGTTGAAGATGACGAGCCTCGTTCGTTGA
Transcript >OphauB2|6270
ATGGGCATCAAAGGCATCTATCGCGAGCTGGGCACAGGGAGGCGTGTCTCCCTGTCAAAACTTGCTGCCGACAGC
TTCGGCTCTGAGGGCAGACCTTTTCGAATAGCCATCGATGTCGCCATTTGGCAGTTTCAGGCTCAAGCCGCCCGA
GGCGGAACAAACCCAGCCATTCGAACCCTCTTCTACCGCCTTGTCAGGCTACTCGGAACCCCGATACAGCCCATC
TTCGTTTTTGACGGGCCTCACAAGCCCGCTTTCAAGAGAAACAAGCGCTCGAAAAAGGTCAACGGCATCGCAACG
GCTCAGGCCAAACTGCTGATTCGACTCTTTGGATTCGTCATCCACGATGCGCCAGGAGAGGCCGAGGCTGAATGC
GCTCTGCTACAACAACACGGCATCGTGGACGCTGTGCTGAGCGAAGATGTTGACACAATCATGTTTGGCTGCACA
AACACGCTGCGCAACTGGTCTGCTGAAGGCAAAACTGCAGGCTCGCCCACTCATGTGTCGCTCTACAACGTCGAC
GACGTCAACCTTGCCAATCTAGGACTGAACCGCGAAGGAATGGTGCTTGTTGCACTAATGAGTGGCGGCGACTAT
TTGCCTGAAGGCATTCCGGGATGCGGCGTCAAGGTGGCGTGTGAGGCTGCCAGAGCTGGTTTTGGAAACTCGGTC
TGTCGCTTGAAGCTGTCCGACACGAGCGGCATAGAGTCTTGGAGAAGCTCCCTGATACACGAGCTGAGAAGCAAC
AATGGCAAACACTTTCGCTGCAAGCACCCAGCCCTGACAATAGCCGACGATTTTCCCAATCTCGAAATCTTGCGC
TACTATACCCATCCCGTCGTCTCCCAAGAATCGACGCTGGACTCGGTGCGGCAGAAACTGGCAAAGAGAGGAGAG
ATTGACATTGATTCCCTGCGCGAATTTACCAGAGAAACCTTTGACTGGGATTATCGGATAGGCGCCATCAAGTTT
ATTCGAGTCTTGGCCCCGGCTCTCCTGGTACACAAGATTCGACACGAGCAAAAGGACAGTGAGGGTTATGTCAAG
CGCGTCCACGGGCGGCGACTTCACGTGAGCACAGACGCTACGCCAGAGCTAAGGTTATCGTACGTGCCTTCTGAA
GTTGTGCCCATTGATTTGTCCAACGAGGTTGATCAGGAAATCAACTATGATCGCCAAGGCCTGGCACTCAACAGC
GATGACGACTTTGAAGGCGCTGTAGAAGACAAAGATGCGGCTGAAGAGAACAAGCCGACTGCCGTCAAGACTTTT
GATGTCAGCAAACCCGAGCTCGTGTGGGTTTTGGAAAAGGTTGTGCGGCAATGTCTCCCCAAGGCGGTGCAAGAA
TGGGACAAGGAACAAGAGGCAAAGGCGGCAAAGGCGGCTGCCAAGCCCTCAGCCCGAGCAAAGGTCAAAAAGTCA
AACATGGCTCATGGCGCTCTTGATGGGTTTGTTCGTGTCATCAAGCCTCCTGATAGAGCACTGGCGACTACCTTT
GAAAACAGGAGCCAGCTACCAGGGTTTTCCTCGGCCGGCTCTCGGTGCTCTCGGCTGCCACCTTCTCAAACCAGC
CTTCAAAGCCAGCAAGCCGTGCAGAGGCGATTGTCATCCCATCTAGCCCTGCAGGGCCGTCGTCTCCTGCTGGAA
AGCCGCCTGCGCCCAGAGGTGTGCTCGACAGCAGCCCAGTGGTGTGTGGTGCTCGGAAGACCATGGTTTGGCCCC
TTGTTGAAGATGACGAGCCTCGTTCGTTGA
Gene >OphauB2|6270
ATGGGCATCAAAGGGTAACTAGCATCTGTCTCTTCATCTTTCAGGCTGTCGAACTCACCAGTCTGCATACAGCAT
CTATCGCGAGCTGGGCACAGGGAGGCGTGTCTCCCTGTCAAAACTTGCTGCCGACAGCTTCGGCTCTGAGGGCAG
ACCTTTTCGAATAGCCATCGATGTCGCCATTTGGCAGTTTCAGGCTCAAGCCGCCCGAGGTGAGATGGATTGGTC
ATTATTTATACTCCTGGTAAAAAGACACAAACAATTAACGATGCATTAACTAGGCGGAACAAACCCAGCCATTCG
AACCCTCTTCTACCGCCTTGTCAGGCTACTCGGAACCCCGATACAGCCCATCTTCGTTTTTGACGGGCCTCACAA
GCCCGCTTTCAAGAGAAACAAGCGCTCGAAAAAGGTCAACGGCATCGCAACGGCTCAGGCCAAACTGCTGATTCG
ACTCTTTGGATTCGTCATCCACGATGCGCCAGGAGAGGCCGAGGCTGAATGCGCTCTGCTACAACAACACGGCAT
CGTGGACGCTGTGCTGAGCGAAGATGTTGACACAATCATGTTTGGCTGCACAAACACGCTGCGCAACTGGTCTGC
TGAAGGCAAAACTGCAGGCTCGCCCACTCATGTGTCGCTCTACAACGTCGACGACGTCAACCTTGCCAATCTAGG
ACTGAACCGCGAAGGAATGGTGCTTGTTGCACTAATGAGTGGCGGCGACTATTTGCCTGAAGGCATTCCGGGATG
CGGCGTCAAGGTGGCGTGTGAGGCTGCCAGAGCTGGTTTTGGAAACTCGGTCTGTCGCTTGAAGCTGTCCGACAC
GAGCGGCATAGAGTCTTGGAGAAGCTCCCTGATACACGAGCTGAGAAGCAACAATGGCAAACACTTTCGCTGCAA
GCACCCAGCCCTGACAATAGCCGACGATTTTCCCAATCTCGAAATCTTGCGCTACTATACCCATCCCGTCGTCTC
CCAAGAATCGACGCTGGACTCGGTGCGGCAGAAACTGGCAAAGAGAGGAGAGATTGACATTGATTCCCTGCGCGA
ATTTACCAGAGAAACCTTTGACTGGGATTATCGGATAGGCGCCATCAAGTTTATTCGAGTCTTGGCCCCGGCTCT
CCTGGTACACAAGATTCGACACGAGCAAAAGGACAGTGAGGGTTATGTCAAGCGCGTCCACGGGCGGCGACTTCA
CGTGAGCACAGACGCTACGCCAGAGCTAAGGTTATCGTACGTGCCTTCTGAAGTTGTGCCCATTGATTTGTCCAA
CGAGGTTGATCAGGAAATCAACTATGATCGCCAAGGCCTGGCACTCAACAGCGATGACGACTTTGAAGGCGCTGT
AGAAGACAAAGATGCGGCTGAAGAGAACAAGCCGACTGCCGTCAAGACTTTTGATGTCAGCAAACCCGAGCTCGT
GTGGGTTTTGGAAAAGGTTGTGCGGCAATGTCTCCCCAAGGCGGTGCAAGAATGGGACAAGGAACAAGAGGCAAA
GGCGGCAAAGGCGGCTGCCAAGCCCTCAGCCCGAGCAAAGGTCAAAAAGTCAAACATGGCTCATGGCGCTCTTGA
TGGGTTTGTTCGTGTCATCAAGCCTCCTGATAGAGCACTGGCGACTACCTTTGAAAACAGGAGCCAGCTACCAGG
GTTTTCCTCGGCCGGCTCTCGGTGCTCTCGGCTGCCACCTTCTCAAACCAGTAAGCAAGCTTTGAACCCGGTTGC
AAGGGAATCTGCCGGGCCTTTGGAGTTTTCTGGGAGCTCACCTATTGCTCCTAGGCCTTCAAAGCCAGCAAGCCG
TGCAGAGGCGATTGTCATCCCATCTAGCCCTGCAGGGCCGTCGTCTCCTGCTGGAAAGCCGCCTGCGCCCAGAGG
TGTGCTCGACAGCAGCCCAGTGGTGTGTGGTGCTCGGAAGACCATGGTTTGGCCCCTTGTTGAAGATGACGAGCC
TCGTTCGTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail