Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|6254
Gene name
LocationContig_56:4566..6932
Strand+
Gene length (bp)2366
Transcript length (bp)1533
Coding sequence length (bp)1533
Protein length (aa) 511

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00153 Mito_carr Mitochondrial carrier protein 1.5E-19 195 299
PF00153 Mito_carr Mitochondrial carrier protein 7.0E-20 309 402
PF00153 Mito_carr Mitochondrial carrier protein 1.1E-25 420 507
PF13499 EF-hand_7 EF-hand domain pair 2.1E-08 25 87
PF13499 EF-hand_7 EF-hand domain pair 3.1E-09 92 153
PF13405 EF-hand_6 EF-hand domain 1.1E-05 96 120
PF13202 EF-hand_5 EF hand 1.1E-05 97 116
PF13202 EF-hand_5 EF hand 1.2E-04 130 154
PF13833 EF-hand_8 EF-hand domain pair 1.6E-03 60 88

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P0CI40|CMC1_YEASX Calcium-binding mitochondrial carrier SAL1 OS=Saccharomyces cerevisiae GN=SAL1 PE=3 SV=1 16 510 2.0E-134
sp|O94502|YBT5_SCHPO Uncharacterized mitochondrial carrier C12D12.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC12D12.05c PE=3 SV=2 181 509 5.0E-94
sp|A5PJZ1|SCMC1_BOVIN Calcium-binding mitochondrial carrier protein SCaMC-1 OS=Bos taurus GN=SLC25A24 PE=2 SV=1 24 509 1.0E-81
sp|Q6NUK1|SCMC1_HUMAN Calcium-binding mitochondrial carrier protein SCaMC-1 OS=Homo sapiens GN=SLC25A24 PE=1 SV=2 20 509 5.0E-80
sp|O18757|SCMC1_RABIT Calcium-binding mitochondrial carrier protein SCaMC-1 OS=Oryctolagus cuniculus GN=SLC25A24 PE=1 SV=1 24 509 3.0E-79
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P0CI40|CMC1_YEASX Calcium-binding mitochondrial carrier SAL1 OS=Saccharomyces cerevisiae GN=SAL1 PE=3 SV=1 16 510 2.0E-134
sp|O94502|YBT5_SCHPO Uncharacterized mitochondrial carrier C12D12.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC12D12.05c PE=3 SV=2 181 509 5.0E-94
sp|A5PJZ1|SCMC1_BOVIN Calcium-binding mitochondrial carrier protein SCaMC-1 OS=Bos taurus GN=SLC25A24 PE=2 SV=1 24 509 1.0E-81
sp|Q6NUK1|SCMC1_HUMAN Calcium-binding mitochondrial carrier protein SCaMC-1 OS=Homo sapiens GN=SLC25A24 PE=1 SV=2 20 509 5.0E-80
sp|O18757|SCMC1_RABIT Calcium-binding mitochondrial carrier protein SCaMC-1 OS=Oryctolagus cuniculus GN=SLC25A24 PE=1 SV=1 24 509 3.0E-79
sp|Q66L49|SCMC1_DANRE Calcium-binding mitochondrial carrier protein SCaMC-1 OS=Danio rerio GN=slc25a24 PE=2 SV=1 28 509 2.0E-78
sp|Q8BMD8|SCMC1_MOUSE Calcium-binding mitochondrial carrier protein SCaMC-1 OS=Mus musculus GN=Slc25a24 PE=1 SV=1 24 509 2.0E-78
sp|D6W196|CMC1_YEAST Truncated non-functional calcium-binding mitochondrial carrier SAL1-1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SAL1 PE=1 SV=2 16 410 3.0E-78
sp|Q7T0U6|SCM1B_XENLA Calcium-binding mitochondrial carrier protein SCaMC-1-B OS=Xenopus laevis GN=slc25a24-b PE=2 SV=1 24 509 3.0E-77
sp|Q5XHA0|SCMC1_XENTR Calcium-binding mitochondrial carrier protein SCaMC-1 OS=Xenopus tropicalis GN=slc25a24 PE=2 SV=1 24 509 1.0E-76
sp|Q9BV35|SCMC3_HUMAN Calcium-binding mitochondrial carrier protein SCaMC-3 OS=Homo sapiens GN=SLC25A23 PE=1 SV=2 20 509 1.0E-75
sp|B0G159|MCFC_DICDI Mitochondrial substrate carrier family protein C OS=Dictyostelium discoideum GN=mcfC PE=2 SV=1 25 510 2.0E-75
sp|Q7ZY36|SCM1A_XENLA Calcium-binding mitochondrial carrier protein SCaMC-1-A OS=Xenopus laevis GN=slc25a24-a PE=2 SV=2 24 509 2.0E-75
sp|Q6GQS1|SCMC3_MOUSE Calcium-binding mitochondrial carrier protein SCaMC-3 OS=Mus musculus GN=Slc25a23 PE=1 SV=1 8 509 8.0E-74
sp|Q19529|CMC3_CAEEL Probable calcium-binding mitochondrial carrier F17E5.2 OS=Caenorhabditis elegans GN=F17E5.2 PE=3 SV=4 20 508 3.0E-72
sp|Q5XH95|SCMC2_XENTR Calcium-binding mitochondrial carrier protein SCaMC-2 OS=Xenopus tropicalis GN=slc25a25 PE=2 SV=1 20 510 2.0E-71
sp|Q7ZYD5|SCMC2_XENLA Calcium-binding mitochondrial carrier protein SCaMC-2 OS=Xenopus laevis GN=slc25a25 PE=2 SV=1 17 510 7.0E-71
sp|Q628Z2|CMC3_CAEBR Probable calcium-binding mitochondrial carrier CBG00135 OS=Caenorhabditis briggsae GN=CBG00135 PE=3 SV=1 20 508 7.0E-71
sp|Q20799|CMC2_CAEEL Putative calcium-binding mitochondrial carrier F55A11.4 OS=Caenorhabditis elegans GN=F55A11.4 PE=5 SV=1 19 509 3.0E-70
sp|Q0V7M4|SCMC2_BOVIN Calcium-binding mitochondrial carrier protein SCaMC-2 OS=Bos taurus GN=SLC25A25 PE=2 SV=1 64 510 3.0E-68
sp|Q6KCM7|SCMC2_HUMAN Calcium-binding mitochondrial carrier protein SCaMC-2 OS=Homo sapiens GN=SLC25A25 PE=1 SV=1 64 510 1.0E-67
sp|Q8K3P6|SCMC2_RAT Calcium-binding mitochondrial carrier protein SCaMC-2 OS=Rattus norvegicus GN=Slc25a25 PE=1 SV=1 64 510 5.0E-67
sp|A2ASZ8|SCMC2_MOUSE Calcium-binding mitochondrial carrier protein SCaMC-2 OS=Mus musculus GN=Slc25a25 PE=1 SV=1 64 510 6.0E-67
sp|A2CEQ0|SCM2B_DANRE Calcium-binding mitochondrial carrier protein SCaMC-2-B OS=Danio rerio GN=slc25a25b PE=3 SV=2 64 510 8.0E-67
sp|Q6NYZ6|SCM2A_DANRE Calcium-binding mitochondrial carrier protein SCaMC-2-A OS=Danio rerio GN=slc25a25a PE=2 SV=1 67 509 1.0E-64
sp|Q54MZ4|MCFB_DICDI Mitochondrial substrate carrier family protein B OS=Dictyostelium discoideum GN=mcfB PE=3 SV=1 91 509 1.0E-52
sp|Q12251|YP011_YEAST Uncharacterized mitochondrial carrier YPR011C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPR011C PE=1 SV=1 198 501 6.0E-44
sp|Q8N5S1|S2541_HUMAN Solute carrier family 25 member 41 OS=Homo sapiens GN=SLC25A41 PE=2 SV=2 197 509 2.0E-42
sp|O04619|ADNT1_ARATH Mitochondrial adenine nucleotide transporter ADNT1 OS=Arabidopsis thaliana GN=ADNT1 PE=2 SV=1 198 510 1.0E-41
sp|Q8BVN7|S2541_MOUSE Solute carrier family 25 member 41 OS=Mus musculus GN=Slc25a41 PE=2 SV=1 197 510 5.0E-41
sp|Q9SUV1|BRT1_ARATH Adenine nucleotide transporter BT1, chloroplastic/mitochondrial OS=Arabidopsis thaliana GN=BT1 PE=1 SV=1 198 507 4.0E-35
sp|Q54EV4|MCFA_DICDI Mitochondrial substrate carrier family protein A OS=Dictyostelium discoideum GN=mcfA PE=3 SV=1 198 503 2.0E-32
sp|Q54DU1|MCFP_DICDI Mitochondrial substrate carrier family protein P OS=Dictyostelium discoideum GN=mcfP PE=3 SV=1 198 501 2.0E-32
sp|Q5PQ27|S2542_XENLA Mitochondrial coenzyme A transporter SLC25A42 OS=Xenopus laevis GN=slc25a42 PE=2 SV=1 195 501 2.0E-31
sp|Q05AQ3|S2542_XENTR Mitochondrial coenzyme A transporter SLC25A42 OS=Xenopus tropicalis GN=slc25a42 PE=2 SV=1 195 501 2.0E-30
sp|P38702|LEU5_YEAST Mitochondrial carrier protein LEU5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LEU5 PE=3 SV=1 199 509 7.0E-30
sp|P29518|BT1_MAIZE Adenine nucleotide transporter BT1, chloroplastic/amyloplastic/mitochondrial OS=Zea mays GN=BT1 PE=1 SV=1 198 507 9.0E-30
sp|Q8TFH2|YIKC_SCHPO Uncharacterized mitochondrial carrier PB17E12.12c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAPB17E12.12c PE=3 SV=1 199 507 1.0E-29
sp|A7ER02|TPC1_SCLS1 Mitochondrial thiamine pyrophosphate carrier 1 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=tpc1 PE=3 SV=1 198 507 2.0E-29
sp|Q8C0K5|GDC_MOUSE Graves disease carrier protein homolog OS=Mus musculus GN=Slc25a16 PE=1 SV=1 198 505 3.0E-29
sp|O13805|YE08_SCHPO Uncharacterized mitochondrial carrier C17H9.08 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC17H9.08 PE=3 SV=1 199 509 4.0E-29
sp|O65023|EAAC_ARATH Probable envelope ADP,ATP carrier protein, chloroplastic OS=Arabidopsis thaliana GN=EAAC PE=2 SV=2 209 508 1.0E-28
sp|Q0II44|S2541_BOVIN Solute carrier family 25 member 41 OS=Bos taurus GN=SLC25A41 PE=2 SV=1 197 453 2.0E-28
sp|Q01888|GDC_BOVIN Graves disease carrier protein OS=Bos taurus GN=SLC25A16 PE=2 SV=1 198 509 2.0E-28
sp|Q0P483|S2542_DANRE Mitochondrial coenzyme A transporter SLC25A42 OS=Danio rerio GN=slc25a42 PE=2 SV=1 195 501 2.0E-28
sp|P16260|GDC_HUMAN Graves disease carrier protein OS=Homo sapiens GN=SLC25A16 PE=1 SV=3 198 509 5.0E-28
sp|A6SL61|TPC1_BOTFB Mitochondrial thiamine pyrophosphate carrier 1 OS=Botryotinia fuckeliana (strain B05.10) GN=tpc1 PE=3 SV=1 199 509 8.0E-28
sp|Q8R0Y8|S2542_MOUSE Mitochondrial coenzyme A transporter SLC25A42 OS=Mus musculus GN=Slc25a42 PE=1 SV=1 188 501 5.0E-27
sp|Q8WUT9|S2543_HUMAN Solute carrier family 25 member 43 OS=Homo sapiens GN=SLC25A43 PE=2 SV=2 188 505 7.0E-27
sp|P0C546|S2542_RAT Mitochondrial coenzyme A transporter SLC25A42 OS=Rattus norvegicus GN=Slc25a42 PE=2 SV=1 193 501 1.0E-26
sp|Q86AV5|MCFX_DICDI Mitochondrial substrate carrier family protein X OS=Dictyostelium discoideum GN=mcfX PE=3 SV=1 198 504 2.0E-26
sp|Q54RB9|CMC_DICDI Calcium-binding mitochondrial carrier protein OS=Dictyostelium discoideum GN=mcfO PE=3 SV=1 96 507 6.0E-26
sp|Q9LJX5|BRTL1_ARATH Probable mitochondrial adenine nucleotide transporter BTL1 OS=Arabidopsis thaliana GN=At3g20240 PE=2 SV=1 198 507 9.0E-26
sp|A2R5A0|TPC1_ASPNC Mitochondrial thiamine pyrophosphate carrier 1 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=tpc1 PE=3 SV=1 199 507 2.0E-25
sp|Q2UCW8|TPC1_ASPOR Mitochondrial thiamine pyrophosphate carrier 1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=tpc1 PE=3 SV=1 199 503 2.0E-25
sp|A4RF23|TPC1_MAGO7 Mitochondrial thiamine pyrophosphate carrier 1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=TPC1 PE=3 SV=2 195 507 3.0E-25
sp|P16261|GDC_RAT Graves disease carrier protein (Fragment) OS=Rattus norvegicus GN=Slc25a16 PE=2 SV=1 198 497 5.0E-25
sp|Q9DAM5|TPC_MOUSE Mitochondrial thiamine pyrophosphate carrier OS=Mus musculus GN=Slc25a19 PE=1 SV=1 199 501 6.0E-25
sp|Q86VD7|S2542_HUMAN Mitochondrial coenzyme A transporter SLC25A42 OS=Homo sapiens GN=SLC25A42 PE=2 SV=2 188 501 7.0E-25
sp|P33303|SFC1_YEAST Succinate/fumarate mitochondrial transporter OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SFC1 PE=1 SV=2 198 507 9.0E-25
sp|Q9LV81|BRTL3_ARATH Probable mitochondrial adenine nucleotide transporter BTL3 OS=Arabidopsis thaliana GN=At5g64970 PE=2 SV=1 197 507 1.0E-24
sp|A1DI57|TPC1_NEOFI Mitochondrial thiamine pyrophosphate carrier 1 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=tpc1 PE=3 SV=1 199 507 1.0E-24
sp|Q9M024|TAAC_ARATH Thylakoid ADP,ATP carrier protein, chloroplastic OS=Arabidopsis thaliana GN=TAAC PE=1 SV=1 209 508 2.0E-24
sp|Q0CEN9|TPC1_ASPTN Mitochondrial thiamine pyrophosphate carrier 1 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=tpc1 PE=3 SV=1 199 507 4.0E-24
sp|Q4X022|TPC1_ASPFU Mitochondrial thiamine pyrophosphate carrier 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=tpc1 PE=3 SV=3 199 507 9.0E-24
sp|Q9HC21|TPC_HUMAN Mitochondrial thiamine pyrophosphate carrier OS=Homo sapiens GN=SLC25A19 PE=1 SV=1 199 501 9.0E-24
sp|Q94AG6|SAMC1_ARATH S-adenosylmethionine carrier 1, chloroplastic/mitochondrial OS=Arabidopsis thaliana GN=SAMC1 PE=1 SV=1 242 507 1.0E-23
sp|A5DIS9|TPC1_PICGU Mitochondrial thiamine pyrophosphate carrier 1 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=TPC1 PE=3 SV=3 180 501 2.0E-23
sp|A6RF73|TPC1_AJECN Mitochondrial thiamine pyrophosphate carrier 1 OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=TPC1 PE=3 SV=1 200 502 2.0E-23
sp|Q1E7P0|TPC1_COCIM Mitochondrial thiamine pyrophosphate carrier 1 OS=Coccidioides immitis (strain RS) GN=TPC1 PE=3 SV=1 200 507 3.0E-23
sp|Q5IS35|TPC_MACFA Mitochondrial thiamine pyrophosphate carrier OS=Macaca fascicularis GN=SLC25A19 PE=2 SV=1 199 501 3.0E-23
sp|P02722|ADT1_BOVIN ADP/ATP translocase 1 OS=Bos taurus GN=SLC25A4 PE=1 SV=3 189 488 5.0E-23
sp|A2A3V2|S2543_MOUSE Solute carrier family 25 member 43 OS=Mus musculus GN=Slc25a43 PE=2 SV=1 188 505 6.0E-23
sp|Q5U3V7|S2543_DANRE Solute carrier family 25 member 43 OS=Danio rerio GN=slc25a43 PE=2 SV=1 185 506 7.0E-23
sp|F4HT41|SAMC2_ARATH Probable S-adenosylmethionine carrier 2, chloroplastic OS=Arabidopsis thaliana GN=SAMC2 PE=2 SV=1 242 507 1.0E-22
sp|Q9VA73|CMC_DROME Calcium-binding mitochondrial carrier protein Aralar1 OS=Drosophila melanogaster GN=aralar1 PE=2 SV=1 198 505 1.0E-22
sp|P12236|ADT3_HUMAN ADP/ATP translocase 3 OS=Homo sapiens GN=SLC25A6 PE=1 SV=4 198 507 1.0E-22
sp|O46373|ADT1_RABIT ADP/ATP translocase 1 OS=Oryctolagus cuniculus GN=SLC25A4 PE=2 SV=3 189 488 2.0E-22
sp|Q5NVC1|TPC_PONAB Mitochondrial thiamine pyrophosphate carrier OS=Pongo abelii GN=SLC25A19 PE=2 SV=1 199 501 2.0E-22
sp|Q5AVW1|TPC1_EMENI Mitochondrial thiamine pyrophosphate carrier 1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=tpc1 PE=3 SV=1 199 510 3.0E-22
sp|Q9P6L7|YKQ9_SCHPO Uncharacterized mitochondrial carrier C688.09 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC688.09 PE=3 SV=1 195 501 3.0E-22
sp|Q05962|ADT1_RAT ADP/ATP translocase 1 OS=Rattus norvegicus GN=Slc25a4 PE=1 SV=3 189 488 4.0E-22
sp|Q29RM1|TPC_BOVIN Mitochondrial thiamine pyrophosphate carrier OS=Bos taurus GN=SLC25A19 PE=2 SV=1 176 501 6.0E-22
sp|P48962|ADT1_MOUSE ADP/ATP translocase 1 OS=Mus musculus GN=Slc25a4 PE=1 SV=4 189 488 7.0E-22
sp|P32007|ADT3_BOVIN ADP/ATP translocase 3 OS=Bos taurus GN=SLC25A6 PE=1 SV=3 198 507 1.0E-21
sp|Q8SQH5|ADT2_BOVIN ADP/ATP translocase 2 OS=Bos taurus GN=SLC25A5 PE=2 SV=3 198 488 1.0E-21
sp|P05141|ADT2_HUMAN ADP/ATP translocase 2 OS=Homo sapiens GN=SLC25A5 PE=1 SV=7 198 488 2.0E-21
sp|Q5R5A1|ADT2_PONAB ADP/ATP translocase 2 OS=Pongo abelii GN=SLC25A5 PE=2 SV=3 198 488 2.0E-21
sp|Q9H2D1|MFTC_HUMAN Mitochondrial folate transporter/carrier OS=Homo sapiens GN=SLC25A32 PE=1 SV=2 198 507 2.0E-21
sp|P12235|ADT1_HUMAN ADP/ATP translocase 1 OS=Homo sapiens GN=SLC25A4 PE=1 SV=4 198 488 3.0E-21
sp|P51881|ADT2_MOUSE ADP/ATP translocase 2 OS=Mus musculus GN=Slc25a5 PE=1 SV=3 198 488 3.0E-21
sp|Q7S2H8|TPC1_NEUCR Mitochondrial thiamine pyrophosphate carrier 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=tpc-1 PE=3 SV=1 200 510 3.0E-21
sp|Q922G0|S2536_MOUSE Solute carrier family 25 member 36 OS=Mus musculus GN=Slc25a36 PE=2 SV=1 195 501 5.0E-21
sp|Q09073|ADT2_RAT ADP/ATP translocase 2 OS=Rattus norvegicus GN=Slc25a5 PE=1 SV=3 198 488 6.0E-21
sp|Q96CQ1|S2536_HUMAN Solute carrier family 25 member 36 OS=Homo sapiens GN=SLC25A36 PE=1 SV=1 195 501 6.0E-21
sp|Q95J75|MFTC_MACFA Mitochondrial folate transporter/carrier OS=Macaca fascicularis GN=SLC25A32 PE=2 SV=1 198 507 7.0E-21
sp|Q7XA87|FOLT1_ARATH Folate transporter 1, chloroplastic OS=Arabidopsis thaliana GN=FOLT1 PE=2 SV=1 200 510 9.0E-21
sp|Q9C9R4|BRTL2_ARATH Probable mitochondrial adenine nucleotide transporter BTL2 OS=Arabidopsis thaliana GN=At1g78180 PE=2 SV=1 186 507 1.0E-20
sp|Q8RWA5|NDT2_ARATH Nicotinamide adenine dinucleotide transporter 2, mitochondrial OS=Arabidopsis thaliana GN=NDT2 PE=1 SV=1 210 501 1.0E-20
sp|Q6DG32|S2536_DANRE Solute carrier family 25 member 36-A OS=Danio rerio GN=slc25a36a PE=2 SV=1 195 501 1.0E-20
sp|Q000K2|ADT2_TACAC ADP/ATP translocase 2 OS=Tachyglossus aculeatus aculeatus GN=SLC25A5 PE=2 SV=1 198 488 2.0E-20
sp|Q9FM86|ADT5_ARATH Probable ADP,ATP carrier protein At5g56450 OS=Arabidopsis thaliana GN=At5g56450 PE=2 SV=1 198 507 2.0E-20
sp|Q8BMG8|MFTC_MOUSE Mitochondrial folate transporter/carrier OS=Mus musculus GN=Slc25a32 PE=1 SV=1 198 507 3.0E-20
sp|Q10248|YD1K_SCHPO Uncharacterized mitochondrial carrier C4G9.20c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC4G9.20c PE=3 SV=2 198 502 3.0E-20
sp|Q8BH59|CMC1_MOUSE Calcium-binding mitochondrial carrier protein Aralar1 OS=Mus musculus GN=Slc25a12 PE=1 SV=1 198 505 5.0E-20
sp|Q6QRN9|ADT3_PIG ADP/ATP translocase 3 OS=Sus scrofa GN=SLC25A6 PE=2 SV=3 198 507 7.0E-20
sp|Q5XGI1|KMCP1_XENTR Kidney mitochondrial carrier protein 1 OS=Xenopus tropicalis GN=slc25a30 PE=2 SV=1 198 505 7.0E-20
sp|Q6GQ22|KMCP1_XENLA Kidney mitochondrial carrier protein 1 OS=Xenopus laevis GN=slc25a30 PE=2 SV=1 198 505 9.0E-20
sp|O97470|ADT_DICDI Mitochondrial substrate carrier family protein ancA OS=Dictyostelium discoideum GN=ancA PE=1 SV=1 199 510 9.0E-20
sp|Q54QN2|MCFM_DICDI Mitochondrial substrate carrier family protein M OS=Dictyostelium discoideum GN=mcfM PE=3 SV=1 231 507 1.0E-19
sp|Q54QI8|MCFR_DICDI Mitochondrial substrate carrier family protein R OS=Dictyostelium discoideum GN=mcfR PE=3 SV=1 198 501 1.0E-19
sp|Q8HXE3|KMCP1_MACFA Kidney mitochondrial carrier protein 1 OS=Macaca fascicularis GN=SLC25A30 PE=2 SV=1 198 505 2.0E-19
sp|Q12482|AGC1_YEAST Mitochondrial aspartate-glutamate transporter AGC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AGC1 PE=3 SV=1 198 501 4.0E-19
sp|Q75AH6|AGC1_ASHGO Mitochondrial aspartate-glutamate transporter AGC1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=AGC1 PE=3 SV=2 157 501 5.0E-19
sp|P10566|MRS3_YEAST Mitochondrial RNA-splicing protein MRS3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MRS3 PE=1 SV=4 198 507 5.0E-19
sp|Q9QXX4|CMC2_MOUSE Calcium-binding mitochondrial carrier protein Aralar2 OS=Mus musculus GN=Slc25a13 PE=1 SV=1 198 505 7.0E-19
sp|Q5ZKP7|S2536_CHICK Solute carrier family 25 member 36 OS=Gallus gallus GN=SLC25A36 PE=2 SV=1 195 501 1.0E-18
sp|Q5SVS4|KMCP1_HUMAN Kidney mitochondrial carrier protein 1 OS=Homo sapiens GN=SLC25A30 PE=1 SV=1 198 505 1.0E-18
sp|Q6CQR3|TPC1_KLULA Mitochondrial thiamine pyrophosphate carrier 1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=TPC1 PE=3 SV=1 184 503 1.0E-18
sp|Q5PQM9|KMCP1_RAT Kidney mitochondrial carrier protein 1 OS=Rattus norvegicus GN=Slc25a30 PE=2 SV=1 198 505 3.0E-18
sp|A5DX39|TPC1_LODEL Mitochondrial thiamine pyrophosphate carrier 1 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=TPC1 PE=3 SV=1 184 501 3.0E-18
sp|Q5RBC8|CMC1_PONAB Calcium-binding mitochondrial carrier protein Aralar1 OS=Pongo abelii GN=SLC25A12 PE=2 SV=1 198 505 3.0E-18
sp|O75746|CMC1_HUMAN Calcium-binding mitochondrial carrier protein Aralar1 OS=Homo sapiens GN=SLC25A12 PE=1 SV=2 198 505 3.0E-18
sp|Q9UJS0|CMC2_HUMAN Calcium-binding mitochondrial carrier protein Aralar2 OS=Homo sapiens GN=SLC25A13 PE=1 SV=2 198 505 4.0E-18
sp|Q6P036|S2533_DANRE Solute carrier family 25 member 33 OS=Danio rerio GN=slc25a33 PE=2 SV=1 186 501 4.0E-18
sp|Q54FU9|MCFW_DICDI Mitochondrial substrate carrier family protein W OS=Dictyostelium discoideum GN=mcfW PE=3 SV=1 200 507 5.0E-18
sp|P18239|ADT2_YEAST ADP,ATP carrier protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PET9 PE=1 SV=2 198 488 7.0E-18
sp|A3LVX1|TPC1_PICST Mitochondrial thiamine pyrophosphate carrier 1 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=TPC1 PE=3 SV=2 198 507 9.0E-18
sp|Q9Z2B2|UCP5_MOUSE Brain mitochondrial carrier protein 1 OS=Mus musculus GN=Slc25a14 PE=1 SV=2 170 505 9.0E-18
sp|P31692|ADT_PARKE ADP,ATP carrier protein OS=Parachlorella kessleri PE=3 SV=1 199 505 9.0E-18
sp|Q54VX4|MCFJ_DICDI Mitochondrial substrate carrier family protein J OS=Dictyostelium discoideum GN=mcfJ PE=2 SV=1 255 505 1.0E-17
sp|Q6BPW0|TPC1_DEBHA Mitochondrial thiamine pyrophosphate carrier 1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=TPC1 PE=3 SV=3 198 507 1.0E-17
sp|Q6FTE5|TPC1_CANGA Mitochondrial thiamine pyrophosphate carrier 1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=TPC1 PE=3 SV=1 184 508 2.0E-17
sp|P38087|YMC2_YEAST Carrier protein YMC2, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YMC2 PE=1 SV=1 240 508 2.0E-17
sp|O95258|UCP5_HUMAN Brain mitochondrial carrier protein 1 OS=Homo sapiens GN=SLC25A14 PE=2 SV=1 170 505 2.0E-17
sp|Q6P316|S2540_XENTR Solute carrier family 25 member 40 OS=Xenopus tropicalis GN=slc25a40 PE=2 SV=1 255 504 2.0E-17
sp|O22261|NDT1_ARATH Nicotinamide adenine dinucleotide transporter 1, chloroplastic OS=Arabidopsis thaliana GN=NDT1 PE=1 SV=2 256 510 3.0E-17
sp|Q8HXW2|CMC2_MACFA Calcium-binding mitochondrial carrier protein Aralar2 OS=Macaca fascicularis GN=SLC25A13 PE=2 SV=1 198 505 4.0E-17
sp|A6SL61|TPC1_BOTFB Mitochondrial thiamine pyrophosphate carrier 1 OS=Botryotinia fuckeliana (strain B05.10) GN=tpc1 PE=3 SV=1 311 508 5.0E-17
sp|Q2HFL6|TPC1_CHAGB Mitochondrial thiamine pyrophosphate carrier 1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=TPC1 PE=3 SV=2 200 503 5.0E-17
sp|Q9CR58|KMCP1_MOUSE Kidney mitochondrial carrier protein 1 OS=Mus musculus GN=Slc25a30 PE=1 SV=1 198 505 6.0E-17
sp|Q59Q36|TPC1_CANAL Mitochondrial thiamine pyrophosphate carrier 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=TPC1 PE=3 SV=1 198 503 6.0E-17
sp|A7ER02|TPC1_SCLS1 Mitochondrial thiamine pyrophosphate carrier 1 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=tpc1 PE=3 SV=1 305 510 9.0E-17
sp|Q5PQ27|S2542_XENLA Mitochondrial coenzyme A transporter SLC25A42 OS=Xenopus laevis GN=slc25a42 PE=2 SV=1 301 505 1.0E-16
sp|P18238|ADT3_YEAST ADP,ATP carrier protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AAC3 PE=1 SV=1 198 488 1.0E-16
sp|Q9FHX2|MFL1_ARATH Protein MITOFERRINLIKE 1, chloroplastic OS=Arabidopsis thaliana GN=MFL1 PE=2 SV=1 242 504 1.0E-16
sp|O13660|YBC9_SCHPO Uncharacterized mitochondrial carrier C27B12.09c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pi069 PE=3 SV=1 199 510 2.0E-16
sp|Q8N413|S2545_HUMAN Solute carrier family 25 member 45 OS=Homo sapiens GN=SLC25A45 PE=2 SV=2 232 508 2.0E-16
sp|Q7SXW0|S2539_DANRE Solute carrier family 25 member 39 OS=Danio rerio GN=slc25a39 PE=2 SV=1 255 504 2.0E-16
sp|Q0VCH6|S2540_BOVIN Solute carrier family 25 member 40 OS=Bos taurus GN=SLC25A40 PE=2 SV=1 255 504 2.0E-16
sp|P49382|ADT_KLULA ADP,ATP carrier protein OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=AAC PE=3 SV=1 198 488 2.0E-16
sp|Q55E45|MCFE_DICDI Mitochondrial substrate carrier family protein E OS=Dictyostelium discoideum GN=mcfE PE=3 SV=1 195 504 2.0E-16
sp|Q9BSK2|S2533_HUMAN Solute carrier family 25 member 33 OS=Homo sapiens GN=SLC25A33 PE=1 SV=1 195 501 2.0E-16
sp|P04710|ADT1_YEAST ADP,ATP carrier protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AAC1 PE=1 SV=1 198 495 3.0E-16
sp|P23500|MRS4_YEAST Mitochondrial RNA-splicing protein MRS4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MRS4 PE=1 SV=1 198 507 4.0E-16
sp|Q21153|CMC1_CAEEL Probable calcium-binding mitochondrial carrier K02F3.2 OS=Caenorhabditis elegans GN=K02F3.2 PE=3 SV=3 107 505 5.0E-16
sp|Q54BM3|MCFG_DICDI Mitochondrial substrate carrier family protein G OS=Dictyostelium discoideum GN=mcfG PE=2 SV=1 198 507 6.0E-16
sp|Q1E7P0|TPC1_COCIM Mitochondrial thiamine pyrophosphate carrier 1 OS=Coccidioides immitis (strain RS) GN=TPC1 PE=3 SV=1 313 504 7.0E-16
sp|Q1LZB3|S2533_BOVIN Solute carrier family 25 member 33 OS=Bos taurus GN=SLC25A33 PE=2 SV=1 265 501 8.0E-16
sp|O77792|UCP3_BOVIN Mitochondrial uncoupling protein 3 OS=Bos taurus GN=UCP3 PE=2 SV=1 198 507 8.0E-16
sp|Q9DB41|GHC2_MOUSE Mitochondrial glutamate carrier 2 OS=Mus musculus GN=Slc25a18 PE=1 SV=4 198 500 9.0E-16
sp|Q05AQ3|S2542_XENTR Mitochondrial coenzyme A transporter SLC25A42 OS=Xenopus tropicalis GN=slc25a42 PE=2 SV=1 302 510 1.0E-15
sp|Q54S10|MCFU_DICDI Mitochondrial substrate carrier family protein U OS=Dictyostelium discoideum GN=mcfU PE=3 SV=1 245 507 1.0E-15
sp|P40464|FLX1_YEAST Mitochondrial FAD carrier protein FLX1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FLX1 PE=3 SV=1 199 507 1.0E-15
sp|Q93XM7|MCAT_ARATH Mitochondrial carnitine/acylcarnitine carrier-like protein OS=Arabidopsis thaliana GN=BOU PE=2 SV=1 255 508 1.0E-15
sp|Q9Z2B2|UCP5_MOUSE Brain mitochondrial carrier protein 1 OS=Mus musculus GN=Slc25a14 PE=1 SV=2 301 507 2.0E-15
sp|Q26365|ADT_DROME ADP,ATP carrier protein OS=Drosophila melanogaster GN=sesB PE=2 SV=4 198 507 2.0E-15
sp|Q3TZX3|S2533_MOUSE Solute carrier family 25 member 33 OS=Mus musculus GN=Slc25a33 PE=2 SV=1 195 501 2.0E-15
sp|P53007|TXTP_HUMAN Tricarboxylate transport protein, mitochondrial OS=Homo sapiens GN=SLC25A1 PE=1 SV=2 198 507 3.0E-15
sp|Q6DFK2|S2540_XENLA Solute carrier family 25 member 40 OS=Xenopus laevis GN=slc25a40 PE=2 SV=1 255 504 3.0E-15
sp|Q0UUH1|TPC1_PHANO Mitochondrial thiamine pyrophosphate carrier 1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=TPC1 PE=3 SV=3 199 509 3.0E-15
sp|Q54FE6|MCFS_DICDI Mitochondrial substrate carrier family protein S OS=Dictyostelium discoideum GN=mcfS PE=3 SV=1 190 508 4.0E-15
sp|Q3V132|ADT4_MOUSE ADP/ATP translocase 4 OS=Mus musculus GN=Slc25a31 PE=1 SV=1 198 509 4.0E-15
sp|Q27238|ADT1_ANOGA ADP,ATP carrier protein 1 OS=Anopheles gambiae GN=AGAP006782 PE=2 SV=2 198 508 5.0E-15
sp|P40556|YIA6_YEAST Mitochondrial nicotinamide adenine dinucleotide transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YIA6 PE=1 SV=1 199 501 5.0E-15
sp|Q8TBP6|S2540_HUMAN Solute carrier family 25 member 40 OS=Homo sapiens GN=SLC25A40 PE=1 SV=1 255 504 5.0E-15
sp|Q55DY8|MFRN_DICDI Mitoferrin OS=Dictyostelium discoideum GN=mcfF PE=3 SV=1 304 507 5.0E-15
sp|Q1ECW7|S247A_DANRE Solute carrier family 25 member 47-A OS=Danio rerio GN=slc25a47a PE=2 SV=1 198 507 7.0E-15
sp|Q552L9|S2540_DICDI Mitochondrial substrate carrier family protein H OS=Dictyostelium discoideum GN=mcfH PE=3 SV=1 198 506 7.0E-15
sp|Q7PQV7|ADT2_ANOGA ADP,ATP carrier protein 2 OS=Anopheles gambiae GN=AGAP002358 PE=3 SV=2 198 507 8.0E-15
sp|Q54DU1|MCFP_DICDI Mitochondrial substrate carrier family protein P OS=Dictyostelium discoideum GN=mcfP PE=3 SV=1 198 396 9.0E-15
sp|P53257|TPC1_YEAST Mitochondrial thiamine pyrophosphate carrier 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPC1 PE=1 SV=1 182 510 1.0E-14
sp|O94370|YG04_SCHPO Uncharacterized mitochondrial carrier C1604.04 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1604.04 PE=3 SV=2 197 507 1.0E-14
sp|Q505J6|GHC2_RAT Mitochondrial glutamate carrier 2 OS=Rattus norvegicus GN=Slc25a18 PE=2 SV=2 198 500 1.0E-14
sp|Q3MHI3|S2548_BOVIN Solute carrier family 25 member 48 OS=Bos taurus GN=SLC25A48 PE=2 SV=1 234 507 1.0E-14
sp|Q6DHC3|S2540_DANRE Solute carrier family 25 member 40 OS=Danio rerio GN=slc25a40 PE=2 SV=1 255 504 1.0E-14
sp|O95258|UCP5_HUMAN Brain mitochondrial carrier protein 1 OS=Homo sapiens GN=SLC25A14 PE=2 SV=1 301 509 2.0E-14
sp|A4QNX2|S247B_DANRE Solute carrier family 25 member 47-B OS=Danio rerio GN=slc25a47b PE=2 SV=1 198 507 2.0E-14
sp|Q8CFJ7|S2545_MOUSE Solute carrier family 25 member 45 OS=Mus musculus GN=Slc25a45 PE=1 SV=1 232 501 2.0E-14
sp|Q9VQG4|COLT_DROME Congested-like trachea protein OS=Drosophila melanogaster GN=colt PE=2 SV=1 198 492 2.0E-14
sp|A6ZV78|TPC1_YEAS7 Mitochondrial thiamine pyrophosphate carrier 1 OS=Saccharomyces cerevisiae (strain YJM789) GN=TPC1 PE=3 SV=1 182 510 3.0E-14
sp|P34519|TXTP_CAEEL Putative tricarboxylate transport protein, mitochondrial OS=Caenorhabditis elegans GN=K11H3.3 PE=3 SV=1 212 502 3.0E-14
sp|Q9N2J1|UCP2_CANLF Mitochondrial uncoupling protein 2 OS=Canis lupus familiaris GN=UCP2 PE=2 SV=1 315 507 3.0E-14
sp|Q6C107|TPC1_YARLI Mitochondrial thiamine pyrophosphate carrier 1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=TPC1 PE=3 SV=1 189 503 3.0E-14
sp|P79110|TXTP_BOVIN Tricarboxylate transport protein, mitochondrial OS=Bos taurus GN=SLC25A1 PE=2 SV=1 198 507 3.0E-14
sp|Q8BH59|CMC1_MOUSE Calcium-binding mitochondrial carrier protein Aralar1 OS=Mus musculus GN=Slc25a12 PE=1 SV=1 58 507 4.0E-14
sp|Q9N2I9|UCP3_CANLF Mitochondrial uncoupling protein 3 OS=Canis lupus familiaris GN=UCP3 PE=2 SV=1 198 507 4.0E-14
sp|Q9D8K8|S2539_MOUSE Solute carrier family 25 member 39 OS=Mus musculus GN=Slc25a39 PE=2 SV=1 255 504 4.0E-14
sp|Q54VS7|TPC_DICDI Probable mitochondrial thiamine pyrophosphate carrier OS=Dictyostelium discoideum GN=mcfK PE=3 SV=1 200 507 4.0E-14
sp|Q4R8M0|ADT4_MACFA ADP/ATP translocase 4 OS=Macaca fascicularis GN=SLC25A31 PE=2 SV=1 199 504 4.0E-14
sp|A6RF73|TPC1_AJECN Mitochondrial thiamine pyrophosphate carrier 1 OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=TPC1 PE=3 SV=1 193 394 5.0E-14
sp|Q9H0C2|ADT4_HUMAN ADP/ATP translocase 4 OS=Homo sapiens GN=SLC25A31 PE=2 SV=1 199 504 5.0E-14
sp|P27080|ADT_CHLRE ADP,ATP carrier protein OS=Chlamydomonas reinhardtii GN=ABT PE=2 SV=1 198 495 6.0E-14
sp|Q9H1K4|GHC2_HUMAN Mitochondrial glutamate carrier 2 OS=Homo sapiens GN=SLC25A18 PE=1 SV=1 242 500 6.0E-14
sp|Q2YDD9|ADT4_BOVIN ADP/ATP translocase 4 OS=Bos taurus GN=SLC25A31 PE=2 SV=1 198 509 6.0E-14
sp|P04709|ADT1_MAIZE ADP,ATP carrier protein 1, mitochondrial OS=Zea mays GN=ANT1 PE=2 SV=3 198 488 7.0E-14
sp|Q9XI74|PUMP3_ARATH Mitochondrial uncoupling protein 3 OS=Arabidopsis thaliana GN=PUMP3 PE=2 SV=1 257 509 7.0E-14
sp|A6SL61|TPC1_BOTFB Mitochondrial thiamine pyrophosphate carrier 1 OS=Botryotinia fuckeliana (strain B05.10) GN=tpc1 PE=3 SV=1 198 394 1.0E-13
sp|A7TDX5|TPC1_VANPO Mitochondrial thiamine pyrophosphate carrier 1 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=TPC1 PE=3 SV=1 198 507 1.0E-13
sp|P12857|ADT2_MAIZE ADP,ATP carrier protein 2, mitochondrial OS=Zea mays GN=ANT2 PE=2 SV=2 198 488 1.0E-13
sp|Q8JZU2|TXTP_MOUSE Tricarboxylate transport protein, mitochondrial OS=Mus musculus GN=Slc25a1 PE=1 SV=1 198 507 1.0E-13
sp|P32332|OAC1_YEAST Mitochondrial oxaloacetate transport protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=OAC1 PE=1 SV=1 310 507 1.0E-13
sp|Q54DU1|MCFP_DICDI Mitochondrial substrate carrier family protein P OS=Dictyostelium discoideum GN=mcfP PE=3 SV=1 313 505 2.0E-13
sp|O75746|CMC1_HUMAN Calcium-binding mitochondrial carrier protein Aralar1 OS=Homo sapiens GN=SLC25A12 PE=1 SV=2 58 508 2.0E-13
sp|Q55DY8|MFRN_DICDI Mitoferrin OS=Dictyostelium discoideum GN=mcfF PE=3 SV=1 197 508 2.0E-13
sp|Q551X6|MCFV_DICDI Mitochondrial substrate carrier family protein V OS=Dictyostelium discoideum GN=mcfV PE=3 SV=1 193 397 2.0E-13
sp|P02723|ADT_NEUCR ADP,ATP carrier protein OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=aac PE=3 SV=1 198 488 2.0E-13
sp|Q8N8R3|MCATL_HUMAN Mitochondrial basic amino acids transporter OS=Homo sapiens GN=SLC25A29 PE=1 SV=2 198 497 2.0E-13
sp|P39953|YEA6_YEAST Mitochondrial nicotinamide adenine dinucleotide transporter 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YEA6 PE=1 SV=1 199 507 2.0E-13
sp|Q5RBC8|CMC1_PONAB Calcium-binding mitochondrial carrier protein Aralar1 OS=Pongo abelii GN=SLC25A12 PE=2 SV=1 58 508 3.0E-13
sp|Q27257|DIF1_CAEEL Protein dif-1 OS=Caenorhabditis elegans GN=dif-1 PE=2 SV=1 198 492 3.0E-13
sp|Q9W725|UCP2_CYPCA Mitochondrial uncoupling protein 2 OS=Cyprinus carpio GN=ucp2 PE=2 SV=1 315 507 3.0E-13
sp|Q12289|CRC1_YEAST Mitochondrial carnitine carrier OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CRC1 PE=1 SV=1 198 501 3.0E-13
sp|Q0II44|S2541_BOVIN Solute carrier family 25 member 41 OS=Bos taurus GN=SLC25A41 PE=2 SV=1 318 501 4.0E-13
sp|Q0P483|S2542_DANRE Mitochondrial coenzyme A transporter SLC25A42 OS=Danio rerio GN=slc25a42 PE=2 SV=1 292 505 4.0E-13
sp|O97562|UCP2_PIG Mitochondrial uncoupling protein 2 OS=Sus scrofa GN=UCP2 PE=2 SV=1 315 507 4.0E-13
sp|O22342|ADT1_GOSHI ADP,ATP carrier protein 1, mitochondrial OS=Gossypium hirsutum GN=ANT1 PE=2 SV=1 198 488 4.0E-13
sp|Q9BZJ4|S2539_HUMAN Solute carrier family 25 member 39 OS=Homo sapiens GN=SLC25A39 PE=2 SV=2 255 504 4.0E-13
sp|Q498U3|S2540_RAT Solute carrier family 25 member 40 OS=Rattus norvegicus GN=Slc25a40 PE=2 SV=2 255 504 4.0E-13
sp|O97562|UCP2_PIG Mitochondrial uncoupling protein 2 OS=Sus scrofa GN=UCP2 PE=2 SV=1 198 507 5.0E-13
sp|Q5R5A8|UCP2_PONAB Mitochondrial uncoupling protein 2 OS=Pongo abelii GN=UCP2 PE=2 SV=1 198 507 5.0E-13
sp|Q3SZI5|UCP2_BOVIN Mitochondrial uncoupling protein 2 OS=Bos taurus GN=UCP2 PE=2 SV=1 315 507 5.0E-13
sp|P55851|UCP2_HUMAN Mitochondrial uncoupling protein 2 OS=Homo sapiens GN=UCP2 PE=1 SV=1 198 507 5.0E-13
sp|P23500|MRS4_YEAST Mitochondrial RNA-splicing protein MRS4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MRS4 PE=1 SV=1 307 505 6.0E-13
sp|Q5R5A8|UCP2_PONAB Mitochondrial uncoupling protein 2 OS=Pongo abelii GN=UCP2 PE=2 SV=1 315 507 7.0E-13
sp|P55851|UCP2_HUMAN Mitochondrial uncoupling protein 2 OS=Homo sapiens GN=UCP2 PE=1 SV=1 315 507 7.0E-13
sp|P56500|UCP2_RAT Mitochondrial uncoupling protein 2 OS=Rattus norvegicus GN=Ucp2 PE=2 SV=1 315 507 7.0E-13
sp|Q9H936|GHC1_HUMAN Mitochondrial glutamate carrier 1 OS=Homo sapiens GN=SLC25A22 PE=1 SV=1 198 500 7.0E-13
sp|Q08DK4|GHC1_BOVIN Mitochondrial glutamate carrier 1 OS=Bos taurus GN=SLC25A22 PE=2 SV=1 198 500 7.0E-13
sp|P97521|MCAT_RAT Mitochondrial carnitine/acylcarnitine carrier protein OS=Rattus norvegicus GN=Slc25a20 PE=1 SV=1 198 507 7.0E-13
sp|Q1E7P0|TPC1_COCIM Mitochondrial thiamine pyrophosphate carrier 1 OS=Coccidioides immitis (strain RS) GN=TPC1 PE=3 SV=1 198 394 8.0E-13
sp|O97649|UCP3_PIG Mitochondrial uncoupling protein 3 OS=Sus scrofa GN=UCP3 PE=2 SV=1 198 507 8.0E-13
sp|P70406|UCP2_MOUSE Mitochondrial uncoupling protein 2 OS=Mus musculus GN=Ucp2 PE=1 SV=1 315 507 8.0E-13
sp|Q6ZT89|S2548_HUMAN Solute carrier family 25 member 48 OS=Homo sapiens GN=SLC25A48 PE=1 SV=2 234 507 9.0E-13
sp|Q86AV5|MCFX_DICDI Mitochondrial substrate carrier family protein X OS=Dictyostelium discoideum GN=mcfX PE=3 SV=1 313 507 1.0E-12
sp|P10566|MRS3_YEAST Mitochondrial RNA-splicing protein MRS3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MRS3 PE=1 SV=4 276 508 1.0E-12
sp|Q03829|YM39_YEAST Uncharacterized mitochondrial carrier YMR166C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YMR166C PE=1 SV=1 199 507 1.0E-12
sp|F4HT41|SAMC2_ARATH Probable S-adenosylmethionine carrier 2, chloroplastic OS=Arabidopsis thaliana GN=SAMC2 PE=2 SV=1 306 502 2.0E-12
sp|O77792|UCP3_BOVIN Mitochondrial uncoupling protein 3 OS=Bos taurus GN=UCP3 PE=2 SV=1 315 507 2.0E-12
sp|Q551X6|MCFV_DICDI Mitochondrial substrate carrier family protein V OS=Dictyostelium discoideum GN=mcfV PE=3 SV=1 424 504 2.0E-12
sp|Q17QI7|S2539_BOVIN Solute carrier family 25 member 39 OS=Bos taurus GN=SLC25A39 PE=2 SV=2 255 504 2.0E-12
sp|P25083|ADT1_SOLTU ADP,ATP carrier protein, mitochondrial OS=Solanum tuberosum GN=ANT PE=2 SV=1 198 495 2.0E-12
sp|P31691|ADT_ORYSJ ADP,ATP carrier protein, mitochondrial OS=Oryza sativa subsp. japonica GN=Os02g0718900 PE=2 SV=1 198 488 2.0E-12
sp|Q8HXY2|MCAT_MACFA Mitochondrial carnitine/acylcarnitine carrier protein OS=Macaca fascicularis GN=SLC25A20 PE=2 SV=1 306 504 2.0E-12
sp|Q09188|ADT_SCHPO ADP,ATP carrier protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=anc1 PE=2 SV=1 198 488 2.0E-12
sp|P40941|ADT2_ARATH ADP,ATP carrier protein 2, mitochondrial OS=Arabidopsis thaliana GN=AAC2 PE=2 SV=2 198 488 2.0E-12
sp|Q5SVS4|KMCP1_HUMAN Kidney mitochondrial carrier protein 1 OS=Homo sapiens GN=SLC25A30 PE=1 SV=1 312 509 3.0E-12
sp|Q4V8K4|S2539_RAT Solute carrier family 25 member 39 OS=Rattus norvegicus GN=Slc25a39 PE=2 SV=1 255 504 3.0E-12
sp|O14281|YETC_SCHPO Uncharacterized mitochondrial carrier C8C9.12c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC8C9.12c PE=3 SV=1 196 507 3.0E-12
sp|O95847|UCP4_HUMAN Mitochondrial uncoupling protein 4 OS=Homo sapiens GN=SLC25A27 PE=2 SV=1 198 509 3.0E-12
sp|Q9W720|UCP2_DANRE Mitochondrial uncoupling protein 2 OS=Danio rerio GN=ucp2 PE=2 SV=1 315 507 3.0E-12
sp|P32089|TXTP_RAT Tricarboxylate transport protein, mitochondrial OS=Rattus norvegicus GN=Slc25a1 PE=1 SV=1 198 507 3.0E-12
sp|P55916|UCP3_HUMAN Mitochondrial uncoupling protein 3 OS=Homo sapiens GN=UCP3 PE=1 SV=1 315 507 3.0E-12
sp|Q9Z2Z6|MCAT_MOUSE Mitochondrial carnitine/acylcarnitine carrier protein OS=Mus musculus GN=Slc25a20 PE=1 SV=1 306 501 3.0E-12
sp|Q9CA93|BAC2_ARATH Mitochondrial arginine transporter BAC2 OS=Arabidopsis thaliana GN=BAC2 PE=1 SV=1 265 507 3.0E-12
sp|Q5RD81|GHC1_PONAB Mitochondrial glutamate carrier 1 OS=Pongo abelii GN=SLC25A22 PE=2 SV=1 198 500 3.0E-12
sp|Q75EP3|TPC1_ASHGO Mitochondrial thiamine pyrophosphate carrier 1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=TPC1 PE=3 SV=1 184 507 3.0E-12
sp|Q6GQ22|KMCP1_XENLA Kidney mitochondrial carrier protein 1 OS=Xenopus laevis GN=slc25a30 PE=2 SV=1 312 509 4.0E-12
sp|Q12482|AGC1_YEAST Mitochondrial aspartate-glutamate transporter AGC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AGC1 PE=3 SV=1 312 507 4.0E-12
sp|Q8BGP6|S2540_MOUSE Solute carrier family 25 member 40 OS=Mus musculus GN=Slc25a40 PE=1 SV=1 255 504 4.0E-12
sp|Q94AG6|SAMC1_ARATH S-adenosylmethionine carrier 1, chloroplastic/mitochondrial OS=Arabidopsis thaliana GN=SAMC1 PE=1 SV=1 313 502 5.0E-12
sp|Q9Z2Z6|MCAT_MOUSE Mitochondrial carnitine/acylcarnitine carrier protein OS=Mus musculus GN=Slc25a20 PE=1 SV=1 199 507 5.0E-12
sp|Q8BW66|S2548_MOUSE Solute carrier family 25 member 48 OS=Mus musculus GN=Slc25a48 PE=1 SV=2 240 507 5.0E-12
sp|O43772|MCAT_HUMAN Mitochondrial carnitine/acylcarnitine carrier protein OS=Homo sapiens GN=SLC25A20 PE=1 SV=1 188 507 5.0E-12
sp|Q4X022|TPC1_ASPFU Mitochondrial thiamine pyrophosphate carrier 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=tpc1 PE=3 SV=3 198 394 6.0E-12
sp|Q9D6M3|GHC1_MOUSE Mitochondrial glutamate carrier 1 OS=Mus musculus GN=Slc25a22 PE=1 SV=1 198 500 6.0E-12
sp|P22292|M2OM_BOVIN Mitochondrial 2-oxoglutarate/malate carrier protein OS=Bos taurus GN=SLC25A11 PE=1 SV=3 305 507 7.0E-12
sp|Q287T7|MFRN1_DANRE Mitoferrin-1 OS=Danio rerio GN=slc25a37 PE=1 SV=1 197 510 9.0E-12
sp|P16261|GDC_RAT Graves disease carrier protein (Fragment) OS=Rattus norvegicus GN=Slc25a16 PE=2 SV=1 316 504 1.0E-11
sp|A1DI57|TPC1_NEOFI Mitochondrial thiamine pyrophosphate carrier 1 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=tpc1 PE=3 SV=1 198 394 1.0E-11
sp|Q5XGI1|KMCP1_XENTR Kidney mitochondrial carrier protein 1 OS=Xenopus tropicalis GN=slc25a30 PE=2 SV=1 312 509 1.0E-11
sp|Q99297|ODC2_YEAST Mitochondrial 2-oxodicarboxylate carrier 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ODC2 PE=1 SV=1 198 500 1.0E-11
sp|Q9SB52|PUMP4_ARATH Mitochondrial uncoupling protein 4 OS=Arabidopsis thaliana GN=PUMP4 PE=2 SV=1 194 507 1.0E-11
sp|O81845|PUMP1_ARATH Mitochondrial uncoupling protein 1 OS=Arabidopsis thaliana GN=PUMP1 PE=1 SV=1 308 490 1.0E-11
sp|Q7S2H8|TPC1_NEUCR Mitochondrial thiamine pyrophosphate carrier 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=tpc-1 PE=3 SV=1 198 394 2.0E-11
sp|Q6C107|TPC1_YARLI Mitochondrial thiamine pyrophosphate carrier 1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=TPC1 PE=3 SV=1 310 507 2.0E-11
sp|Q3SZI5|UCP2_BOVIN Mitochondrial uncoupling protein 2 OS=Bos taurus GN=UCP2 PE=2 SV=1 198 507 2.0E-11
sp|Q8VEM8|MPCP_MOUSE Phosphate carrier protein, mitochondrial OS=Mus musculus GN=Slc25a3 PE=1 SV=1 201 504 2.0E-11
sp|Q8BL03|MCATL_MOUSE Mitochondrial basic amino acids transporter OS=Mus musculus GN=Slc25a29 PE=1 SV=1 198 497 2.0E-11
sp|Q9NYZ2|MFRN1_HUMAN Mitoferrin-1 OS=Homo sapiens GN=SLC25A37 PE=2 SV=2 242 501 2.0E-11
sp|Q9DAM5|TPC_MOUSE Mitochondrial thiamine pyrophosphate carrier OS=Mus musculus GN=Slc25a19 PE=1 SV=1 317 506 3.0E-11
sp|Q9CR58|KMCP1_MOUSE Kidney mitochondrial carrier protein 1 OS=Mus musculus GN=Slc25a30 PE=1 SV=1 312 509 3.0E-11
sp|Q9N2J1|UCP2_CANLF Mitochondrial uncoupling protein 2 OS=Canis lupus familiaris GN=UCP2 PE=2 SV=1 198 507 3.0E-11
sp|Q8HXY2|MCAT_MACFA Mitochondrial carnitine/acylcarnitine carrier protein OS=Macaca fascicularis GN=SLC25A20 PE=2 SV=1 188 507 3.0E-11
sp|Q09461|YQ51_CAEEL Uncharacterized mitochondrial carrier C16C10.1 OS=Caenorhabditis elegans GN=C16C10.1 PE=3 SV=2 192 501 3.0E-11
sp|P53320|MTM1_YEAST Mitochondrial carrier protein MTM1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MTM1 PE=1 SV=1 255 510 3.0E-11
sp|Q9UJS0|CMC2_HUMAN Calcium-binding mitochondrial carrier protein Aralar2 OS=Homo sapiens GN=SLC25A13 PE=1 SV=2 53 508 4.0E-11
sp|O97649|UCP3_PIG Mitochondrial uncoupling protein 3 OS=Sus scrofa GN=UCP3 PE=2 SV=1 315 501 4.0E-11
sp|P56499|UCP3_RAT Mitochondrial uncoupling protein 3 OS=Rattus norvegicus GN=Ucp3 PE=2 SV=1 311 507 4.0E-11
sp|O60029|PET8_ASHGO Putative mitochondrial carrier protein PET8 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=PET8 PE=3 SV=1 242 501 4.0E-11
sp|Q54PY7|M2OM_DICDI Probable mitochondrial 2-oxoglutarate/malate carrier protein OS=Dictyostelium discoideum GN=ucpC PE=3 SV=1 307 488 4.0E-11
sp|Q7XA87|FOLT1_ARATH Folate transporter 1, chloroplastic OS=Arabidopsis thaliana GN=FOLT1 PE=2 SV=1 317 507 5.0E-11
sp|Q8HXE3|KMCP1_MACFA Kidney mitochondrial carrier protein 1 OS=Macaca fascicularis GN=SLC25A30 PE=2 SV=1 312 509 5.0E-11
sp|Q9QXX4|CMC2_MOUSE Calcium-binding mitochondrial carrier protein Aralar2 OS=Mus musculus GN=Slc25a13 PE=1 SV=1 70 508 5.0E-11
sp|Q54VX4|MCFJ_DICDI Mitochondrial substrate carrier family protein J OS=Dictyostelium discoideum GN=mcfJ PE=2 SV=1 306 507 5.0E-11
sp|P56500|UCP2_RAT Mitochondrial uncoupling protein 2 OS=Rattus norvegicus GN=Ucp2 PE=2 SV=1 198 507 5.0E-11
sp|Q08DK7|MCATL_BOVIN Mitochondrial basic amino acids transporter OS=Bos taurus GN=SLC25A29 PE=2 SV=1 198 497 5.0E-11
sp|P97521|MCAT_RAT Mitochondrial carnitine/acylcarnitine carrier protein OS=Rattus norvegicus GN=Slc25a20 PE=1 SV=1 306 501 6.0E-11
sp|Q41629|ADT1_WHEAT ADP,ATP carrier protein 1, mitochondrial OS=Triticum aestivum GN=ANT-G1 PE=3 SV=1 198 488 6.0E-11
sp|Q9VAY3|MFRN_DROME Mitoferrin OS=Drosophila melanogaster GN=mfrn PE=2 SV=1 200 501 7.0E-11
sp|P56501|UCP3_MOUSE Mitochondrial uncoupling protein 3 OS=Mus musculus GN=Ucp3 PE=1 SV=1 311 507 7.0E-11
sp|P12234|MPCP_BOVIN Phosphate carrier protein, mitochondrial OS=Bos taurus GN=SLC25A3 PE=1 SV=1 199 504 7.0E-11
sp|Q54FU9|MCFW_DICDI Mitochondrial substrate carrier family protein W OS=Dictyostelium discoideum GN=mcfW PE=3 SV=1 315 507 8.0E-11
sp|Q55E45|MCFE_DICDI Mitochondrial substrate carrier family protein E OS=Dictyostelium discoideum GN=mcfE PE=3 SV=1 311 507 8.0E-11
sp|Q5HZE0|MCATL_RAT Mitochondrial basic amino acids transporter OS=Rattus norvegicus GN=Slc25a29 PE=2 SV=1 198 497 9.0E-11
sp|Q5AVW1|TPC1_EMENI Mitochondrial thiamine pyrophosphate carrier 1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=tpc1 PE=3 SV=1 193 394 1.0E-10
sp|Q6DG32|S2536_DANRE Solute carrier family 25 member 36-A OS=Danio rerio GN=slc25a36a PE=2 SV=1 172 396 1.0E-10
sp|Q6BPW0|TPC1_DEBHA Mitochondrial thiamine pyrophosphate carrier 1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=TPC1 PE=3 SV=3 305 501 1.0E-10
sp|Q8HXW2|CMC2_MACFA Calcium-binding mitochondrial carrier protein Aralar2 OS=Macaca fascicularis GN=SLC25A13 PE=2 SV=1 71 508 1.0E-10
sp|Q27257|DIF1_CAEEL Protein dif-1 OS=Caenorhabditis elegans GN=dif-1 PE=2 SV=1 200 403 1.0E-10
sp|P70406|UCP2_MOUSE Mitochondrial uncoupling protein 2 OS=Mus musculus GN=Ucp2 PE=1 SV=1 198 507 1.0E-10
sp|Q91XD8|S2538_MOUSE Solute carrier family 25 member 38 OS=Mus musculus GN=Slc25a38 PE=2 SV=1 198 509 1.0E-10
sp|Q8LB08|ADT4_ARATH ADP,ATP carrier protein ER-ANT1 OS=Arabidopsis thaliana GN=ER-ANT1 PE=2 SV=2 198 487 1.0E-10
sp|Q10442|YDE9_SCHPO Uncharacterized mitochondrial carrier C12B10.09 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC12B10.09 PE=3 SV=1 242 490 1.0E-10
sp|Q02978|M2OM_HUMAN Mitochondrial 2-oxoglutarate/malate carrier protein OS=Homo sapiens GN=SLC25A11 PE=1 SV=3 305 507 1.0E-10
sp|Q8BGF9|S2544_MOUSE Solute carrier family 25 member 44 OS=Mus musculus GN=Slc25a44 PE=1 SV=1 210 505 1.0E-10
sp|Q499U1|S2538_RAT Solute carrier family 25 member 38 OS=Rattus norvegicus GN=Slc25a38 PE=2 SV=2 198 509 1.0E-10
sp|O65023|EAAC_ARATH Probable envelope ADP,ATP carrier protein, chloroplastic OS=Arabidopsis thaliana GN=EAAC PE=2 SV=2 188 414 2.0E-10
sp|Q5PQM9|KMCP1_RAT Kidney mitochondrial carrier protein 1 OS=Rattus norvegicus GN=Slc25a30 PE=2 SV=1 312 509 2.0E-10
sp|Q9N2I9|UCP3_CANLF Mitochondrial uncoupling protein 3 OS=Canis lupus familiaris GN=UCP3 PE=2 SV=1 315 507 2.0E-10
sp|Q9W720|UCP2_DANRE Mitochondrial uncoupling protein 2 OS=Danio rerio GN=ucp2 PE=2 SV=1 198 507 2.0E-10
sp|P55916|UCP3_HUMAN Mitochondrial uncoupling protein 3 OS=Homo sapiens GN=UCP3 PE=1 SV=1 198 507 2.0E-10
sp|B0G143|UCPB_DICDI Mitochondrial substrate carrier family protein ucpB OS=Dictyostelium discoideum GN=ucpB PE=3 SV=1 260 509 2.0E-10
sp|B0G143|UCPB_DICDI Mitochondrial substrate carrier family protein ucpB OS=Dictyostelium discoideum GN=ucpB PE=3 SV=1 315 490 2.0E-10
sp|Q4V9P0|SAMC_DANRE S-adenosylmethionine mitochondrial carrier protein OS=Danio rerio GN=slc25a26 PE=2 SV=1 314 504 2.0E-10
sp|Q23125|MFRN_CAEEL Mitoferrin OS=Caenorhabditis elegans GN=W02B12.9 PE=3 SV=1 197 501 2.0E-10
sp|Q9CR62|M2OM_MOUSE Mitochondrial 2-oxoglutarate/malate carrier protein OS=Mus musculus GN=Slc25a11 PE=1 SV=3 305 507 2.0E-10
sp|Q07167|SM16_SCHMA 16 kDa calcium-binding protein OS=Schistosoma mansoni PE=2 SV=1 61 154 2.0E-10
sp|P27081|ADT2_SOLTU ADP,ATP carrier protein, mitochondrial (Fragment) OS=Solanum tuberosum GN=ANT1 PE=2 SV=1 198 488 2.0E-10
sp|Q54W11|MCFL_DICDI Mitochondrial substrate carrier family protein L OS=Dictyostelium discoideum GN=mcfL PE=3 SV=1 186 501 2.0E-10
sp|Q54S10|MCFU_DICDI Mitochondrial substrate carrier family protein U OS=Dictyostelium discoideum GN=mcfU PE=3 SV=1 404 501 3.0E-10
sp|Q287T7|MFRN1_DANRE Mitoferrin-1 OS=Danio rerio GN=slc25a37 PE=1 SV=1 307 510 3.0E-10
sp|O49447|ADT3_ARATH ADP,ATP carrier protein 3, mitochondrial OS=Arabidopsis thaliana GN=AAC3 PE=2 SV=1 198 488 3.0E-10
sp|Q9GMZ1|UCP1_CANLF Mitochondrial brown fat uncoupling protein 1 OS=Canis lupus familiaris GN=UCP1 PE=2 SV=1 212 507 3.0E-10
sp|Q86AV5|MCFX_DICDI Mitochondrial substrate carrier family protein X OS=Dictyostelium discoideum GN=mcfX PE=3 SV=1 412 491 4.0E-10
sp|Q2UCW8|TPC1_ASPOR Mitochondrial thiamine pyrophosphate carrier 1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=tpc1 PE=3 SV=1 198 394 4.0E-10
sp|Q9VQG4|COLT_DROME Congested-like trachea protein OS=Drosophila melanogaster GN=colt PE=2 SV=1 198 387 4.0E-10
sp|Q54VS7|TPC_DICDI Probable mitochondrial thiamine pyrophosphate carrier OS=Dictyostelium discoideum GN=mcfK PE=3 SV=1 313 504 4.0E-10
sp|Q0CEN9|TPC1_ASPTN Mitochondrial thiamine pyrophosphate carrier 1 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=tpc1 PE=3 SV=1 193 394 5.0E-10
sp|Q54PY7|M2OM_DICDI Probable mitochondrial 2-oxoglutarate/malate carrier protein OS=Dictyostelium discoideum GN=ucpC PE=3 SV=1 195 502 6.0E-10
sp|Q08DK7|MCATL_BOVIN Mitochondrial basic amino acids transporter OS=Bos taurus GN=SLC25A29 PE=2 SV=1 187 409 6.0E-10
sp|Q8R0Z5|MFRN2_MOUSE Mitoferrin-2 OS=Mus musculus GN=Slc25a28 PE=2 SV=1 197 501 6.0E-10
sp|Q96A46|MFRN2_HUMAN Mitoferrin-2 OS=Homo sapiens GN=SLC25A28 PE=2 SV=1 197 501 6.0E-10
sp|Q9BQT8|ODC_HUMAN Mitochondrial 2-oxodicarboxylate carrier OS=Homo sapiens GN=SLC25A21 PE=1 SV=1 185 501 6.0E-10
sp|P38127|RIM2_YEAST Mitochondrial carrier protein RIM2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RIM2 PE=3 SV=1 184 507 6.0E-10
sp|P16036|MPCP_RAT Phosphate carrier protein, mitochondrial OS=Rattus norvegicus GN=Slc25a3 PE=1 SV=1 201 504 6.0E-10
sp|Q99JD3|ODC_RAT Mitochondrial 2-oxodicarboxylate carrier OS=Rattus norvegicus GN=Slc25a21 PE=2 SV=1 200 501 6.0E-10
sp|Q00325|MPCP_HUMAN Phosphate carrier protein, mitochondrial OS=Homo sapiens GN=SLC25A3 PE=1 SV=2 199 504 6.0E-10
sp|P38152|TXTP_YEAST Tricarboxylate transport protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CTP1 PE=2 SV=3 198 502 6.0E-10
sp|P38921|PET8_YEAST Putative mitochondrial carrier protein PET8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PET8 PE=1 SV=1 242 502 7.0E-10
sp|Q41630|ADT2_WHEAT ADP,ATP carrier protein 2, mitochondrial OS=Triticum aestivum GN=ANT-G2 PE=3 SV=1 198 488 7.0E-10
sp|P97700|M2OM_RAT Mitochondrial 2-oxoglutarate/malate carrier protein OS=Rattus norvegicus GN=Slc25a11 PE=1 SV=3 305 507 8.0E-10
sp|Q7T292|MFRN2_DANRE Mitoferrin-2 OS=Danio rerio GN=slc25a28 PE=2 SV=1 288 501 8.0E-10
sp|Q920G8|MFRN1_MOUSE Mitoferrin-1 OS=Mus musculus GN=Slc25a37 PE=1 SV=1 242 501 8.0E-10
sp|Q75AH6|AGC1_ASHGO Mitochondrial aspartate-glutamate transporter AGC1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=AGC1 PE=3 SV=2 188 434 9.0E-10
sp|A3LVX1|TPC1_PICST Mitochondrial thiamine pyrophosphate carrier 1 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=TPC1 PE=3 SV=2 308 508 9.0E-10
sp|Q08DK7|MCATL_BOVIN Mitochondrial basic amino acids transporter OS=Bos taurus GN=SLC25A29 PE=2 SV=1 317 510 9.0E-10
sp|P0C546|S2542_RAT Mitochondrial coenzyme A transporter SLC25A42 OS=Rattus norvegicus GN=Slc25a42 PE=2 SV=1 308 504 1.0E-09
sp|A2R5A0|TPC1_ASPNC Mitochondrial thiamine pyrophosphate carrier 1 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=tpc1 PE=3 SV=1 198 394 1.0E-09
sp|Q9W725|UCP2_CYPCA Mitochondrial uncoupling protein 2 OS=Cyprinus carpio GN=ucp2 PE=2 SV=1 198 507 1.0E-09
sp|Q920G8|MFRN1_MOUSE Mitoferrin-1 OS=Mus musculus GN=Slc25a37 PE=1 SV=1 307 501 1.0E-09
sp|Q9P6N6|S2538_SCHPO Solute carrier family 25 member 38 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC823.10c PE=3 SV=1 200 501 1.0E-09
sp|Q66H23|MFRN1_RAT Mitoferrin-1 OS=Rattus norvegicus GN=Slc25a37 PE=2 SV=1 242 501 1.0E-09
sp|Q9UBX3|DIC_HUMAN Mitochondrial dicarboxylate carrier OS=Homo sapiens GN=SLC25A10 PE=1 SV=2 197 509 1.0E-09
sp|Q96H78|S2544_HUMAN Solute carrier family 25 member 44 OS=Homo sapiens GN=SLC25A44 PE=2 SV=1 255 505 1.0E-09
sp|Q75AH6|AGC1_ASHGO Mitochondrial aspartate-glutamate transporter AGC1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=AGC1 PE=3 SV=2 312 504 2.0E-09
sp|Q6DHC3|S2540_DANRE Solute carrier family 25 member 40 OS=Danio rerio GN=slc25a40 PE=2 SV=1 195 409 2.0E-09
sp|P53320|MTM1_YEAST Mitochondrial carrier protein MTM1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MTM1 PE=1 SV=1 190 400 2.0E-09
sp|Q7T292|MFRN2_DANRE Mitoferrin-2 OS=Danio rerio GN=slc25a28 PE=2 SV=1 197 510 2.0E-09
sp|Q66H23|MFRN1_RAT Mitoferrin-1 OS=Rattus norvegicus GN=Slc25a37 PE=2 SV=1 307 501 2.0E-09
sp|P40035|PIC2_YEAST Mitochondrial phosphate carrier protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PIC2 PE=1 SV=1 199 509 2.0E-09
sp|Q5R7W2|MPCP_PONAB Phosphate carrier protein, mitochondrial OS=Pongo abelii GN=SLC25A3 PE=2 SV=1 199 504 2.0E-09
sp|Q9UTD6|YID3_SCHPO Uncharacterized mitochondrial carrier C227.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC227.03c PE=3 SV=1 361 507 2.0E-09
sp|Q5RD67|S2544_PONAB Solute carrier family 25 member 44 OS=Pongo abelii GN=SLC25A44 PE=2 SV=2 255 505 2.0E-09
sp|Q5RFB7|ODC_PONAB Mitochondrial 2-oxodicarboxylate carrier OS=Pongo abelii GN=SLC25A21 PE=2 SV=1 186 501 2.0E-09
sp|Q55E85|MCFD_DICDI Mitochondrial substrate carrier family protein D OS=Dictyostelium discoideum GN=mcfD PE=3 SV=1 316 507 2.0E-09
sp|Q9VBN7|SAMC_DROME S-adenosylmethionine mitochondrial carrier protein homolog OS=Drosophila melanogaster GN=CG4743 PE=2 SV=2 242 508 2.0E-09
sp|Q75AH6|AGC1_ASHGO Mitochondrial aspartate-glutamate transporter AGC1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=AGC1 PE=3 SV=2 420 508 3.0E-09
sp|A4QNX2|S247B_DANRE Solute carrier family 25 member 47-B OS=Danio rerio GN=slc25a47b PE=2 SV=1 419 502 3.0E-09
sp|Q12289|CRC1_YEAST Mitochondrial carnitine carrier OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CRC1 PE=1 SV=1 200 403 3.0E-09
sp|Q9NYZ2|MFRN1_HUMAN Mitoferrin-1 OS=Homo sapiens GN=SLC25A37 PE=2 SV=2 307 510 3.0E-09
sp|P25874|UCP1_HUMAN Mitochondrial brown fat uncoupling protein 1 OS=Homo sapiens GN=UCP1 PE=2 SV=3 318 507 3.0E-09
sp|Q8R0Y8|S2542_MOUSE Mitochondrial coenzyme A transporter SLC25A42 OS=Mus musculus GN=Slc25a42 PE=1 SV=1 308 504 4.0E-09
sp|Q55E85|MCFD_DICDI Mitochondrial substrate carrier family protein D OS=Dictyostelium discoideum GN=mcfD PE=3 SV=1 198 507 4.0E-09
sp|Q8RZB5|CML10_ORYSJ Probable calcium-binding protein CML10 OS=Oryza sativa subsp. japonica GN=CML10 PE=2 SV=1 17 151 4.0E-09
sp|P31167|ADT1_ARATH ADP,ATP carrier protein 1, mitochondrial OS=Arabidopsis thaliana GN=AAC1 PE=1 SV=2 198 488 4.0E-09
sp|Q54B67|MCFZ_DICDI Mitochondrial substrate carrier family protein Z OS=Dictyostelium discoideum GN=mcfZ PE=2 SV=1 198 501 4.0E-09
sp|Q01356|ARG13_NEUCR Amino-acid transporter arg-13 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=arg-13 PE=2 SV=1 188 505 4.0E-09
sp|O13844|YFG5_SCHPO Uncharacterized mitochondrial carrier C19G12.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC19G12.05 PE=3 SV=1 198 502 4.0E-09
sp|Q9XI74|PUMP3_ARATH Mitochondrial uncoupling protein 3 OS=Arabidopsis thaliana GN=PUMP3 PE=2 SV=1 314 486 5.0E-09
sp|Q12375|ORT1_YEAST Mitochondrial ornithine transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ORT1 PE=1 SV=2 201 502 5.0E-09
sp|P32331|YMC1_YEAST Carrier protein YMC1, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YMC1 PE=3 SV=2 300 501 5.0E-09
sp|P81660|TNNC2_ANGAN Troponin C, skeletal muscle OS=Anguilla anguilla PE=1 SV=1 63 150 5.0E-09
sp|Q8RWA5|NDT2_ARATH Nicotinamide adenine dinucleotide transporter 2, mitochondrial OS=Arabidopsis thaliana GN=NDT2 PE=1 SV=1 330 508 6.0E-09
sp|Q8BL03|MCATL_MOUSE Mitochondrial basic amino acids transporter OS=Mus musculus GN=Slc25a29 PE=1 SV=1 317 510 6.0E-09
sp|Q10248|YD1K_SCHPO Uncharacterized mitochondrial carrier C4G9.20c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC4G9.20c PE=3 SV=2 310 501 7.0E-09
sp|P25874|UCP1_HUMAN Mitochondrial brown fat uncoupling protein 1 OS=Homo sapiens GN=UCP1 PE=2 SV=3 194 507 7.0E-09
sp|Q09834|YAD8_SCHPO Uncharacterized mitochondrial carrier C4G8.08 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC4G8.08 PE=3 SV=1 242 504 7.0E-09
sp|Q6DE75|S2538_XENLA Solute carrier family 25 member 38 OS=Xenopus laevis GN=slc25a38 PE=2 SV=1 183 509 7.0E-09
sp|B2MVX9|S2538_SHEEP Solute carrier family 25 member 38 OS=Ovis aries GN=SLC25A38 PE=2 SV=1 198 509 7.0E-09
sp|Q6DJ08|S2538_XENTR Solute carrier family 25 member 38 OS=Xenopus tropicalis GN=slc25a38 PE=2 SV=1 313 505 8.0E-09
sp|Q84UC7|BAC1_ARATH Mitochondrial arginine transporter BAC1 OS=Arabidopsis thaliana GN=BAC1 PE=1 SV=1 188 509 8.0E-09
sp|Q620A6|MFRN_CAEBR Mitoferrin OS=Caenorhabditis briggsae GN=CBG02884 PE=3 SV=1 242 509 9.0E-09
sp|Q86VD7|S2542_HUMAN Mitochondrial coenzyme A transporter SLC25A42 OS=Homo sapiens GN=SLC25A42 PE=2 SV=2 308 504 1.0E-08
sp|Q552L9|S2540_DICDI Mitochondrial substrate carrier family protein H OS=Dictyostelium discoideum GN=mcfH PE=3 SV=1 419 507 1.0E-08
sp|Q8CFJ7|S2545_MOUSE Solute carrier family 25 member 45 OS=Mus musculus GN=Slc25a45 PE=1 SV=1 198 401 1.0E-08
sp|Q8N8R3|MCATL_HUMAN Mitochondrial basic amino acids transporter OS=Homo sapiens GN=SLC25A29 PE=1 SV=2 317 508 1.0E-08
sp|P56501|UCP3_MOUSE Mitochondrial uncoupling protein 3 OS=Mus musculus GN=Ucp3 PE=1 SV=1 198 507 1.0E-08
sp|Q6DJ08|S2538_XENTR Solute carrier family 25 member 38 OS=Xenopus tropicalis GN=slc25a38 PE=2 SV=1 198 509 1.0E-08
sp|Q55GE2|ODC_DICDI Probable mitochondrial 2-oxodicarboxylate carrier OS=Dictyostelium discoideum GN=mcfT PE=3 SV=1 282 501 1.0E-08
sp|Q9ZWG1|PUMP2_ARATH Mitochondrial uncoupling protein 2 OS=Arabidopsis thaliana GN=PUMP2 PE=2 SV=1 198 507 1.0E-08
sp|Q9C5M0|DTC_ARATH Mitochondrial dicarboxylate/tricarboxylate transporter DTC OS=Arabidopsis thaliana GN=DTC PE=1 SV=1 311 488 1.0E-08
sp|Q8BZ09|ODC_MOUSE Mitochondrial 2-oxodicarboxylate carrier OS=Mus musculus GN=Slc25a21 PE=1 SV=1 200 501 1.0E-08
sp|D6W196|CMC1_YEAST Truncated non-functional calcium-binding mitochondrial carrier SAL1-1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SAL1 PE=1 SV=2 299 449 2.0E-08
sp|Q9VA73|CMC_DROME Calcium-binding mitochondrial carrier protein Aralar1 OS=Drosophila melanogaster GN=aralar1 PE=2 SV=1 311 504 2.0E-08
sp|Q96CQ1|S2536_HUMAN Solute carrier family 25 member 36 OS=Homo sapiens GN=SLC25A36 PE=1 SV=1 172 396 2.0E-08
sp|O22261|NDT1_ARATH Nicotinamide adenine dinucleotide transporter 1, chloroplastic OS=Arabidopsis thaliana GN=NDT1 PE=1 SV=2 330 508 2.0E-08
sp|Q8N413|S2545_HUMAN Solute carrier family 25 member 45 OS=Homo sapiens GN=SLC25A45 PE=2 SV=2 198 396 2.0E-08
sp|P40556|YIA6_YEAST Mitochondrial nicotinamide adenine dinucleotide transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YIA6 PE=1 SV=1 422 505 2.0E-08
sp|Q54VS7|TPC_DICDI Probable mitochondrial thiamine pyrophosphate carrier OS=Dictyostelium discoideum GN=mcfK PE=3 SV=1 199 394 2.0E-08
sp|Q9CA93|BAC2_ARATH Mitochondrial arginine transporter BAC2 OS=Arabidopsis thaliana GN=BAC2 PE=1 SV=1 331 507 2.0E-08
sp|O81845|PUMP1_ARATH Mitochondrial uncoupling protein 1 OS=Arabidopsis thaliana GN=PUMP1 PE=1 SV=1 198 505 2.0E-08
sp|Q9VAY3|MFRN_DROME Mitoferrin OS=Drosophila melanogaster GN=mfrn PE=2 SV=1 316 509 2.0E-08
sp|Q9BQT8|ODC_HUMAN Mitochondrial 2-oxodicarboxylate carrier OS=Homo sapiens GN=SLC25A21 PE=1 SV=1 426 508 2.0E-08
sp|P38921|PET8_YEAST Putative mitochondrial carrier protein PET8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PET8 PE=1 SV=1 318 505 2.0E-08
sp|Q55GE2|ODC_DICDI Probable mitochondrial 2-oxodicarboxylate carrier OS=Dictyostelium discoideum GN=mcfT PE=3 SV=1 313 482 2.0E-08
sp|Q06850|CDPK1_ARATH Calcium-dependent protein kinase 1 OS=Arabidopsis thaliana GN=CPK1 PE=1 SV=1 25 150 2.0E-08
sp|O23184|CML19_ARATH Calcium-binding protein CML19 OS=Arabidopsis thaliana GN=CML19 PE=1 SV=1 13 154 2.0E-08
sp|Q944H5|MTM1_ARATH Mitochondrial carrier protein MTM1 OS=Arabidopsis thaliana GN=MTM1 PE=2 SV=1 255 510 2.0E-08
sp|Q96DW6|S2538_HUMAN Solute carrier family 25 member 38 OS=Homo sapiens GN=SLC25A38 PE=1 SV=1 198 509 2.0E-08
sp|Q5EAC0|S2538_BOVIN Solute carrier family 25 member 38 OS=Bos taurus GN=SLC25A38 PE=2 SV=2 198 509 2.0E-08
sp|P62343|CDPK1_PLAFK Calcium-dependent protein kinase 1 OS=Plasmodium falciparum (isolate K1 / Thailand) GN=CPK1 PE=1 SV=2 28 154 2.0E-08
sp|P62344|CDPK1_PLAF7 Calcium-dependent protein kinase 1 OS=Plasmodium falciparum (isolate 3D7) GN=CPK1 PE=3 SV=2 28 154 2.0E-08
sp|P40614|MPCP_CAEEL Phosphate carrier protein, mitochondrial OS=Caenorhabditis elegans GN=F01G4.6 PE=2 SV=1 199 509 2.0E-08
sp|P04575|UCP1_MESAU Mitochondrial brown fat uncoupling protein 1 OS=Mesocricetus auratus GN=UCP1 PE=1 SV=3 309 507 2.0E-08
sp|Q29RM1|TPC_BOVIN Mitochondrial thiamine pyrophosphate carrier OS=Bos taurus GN=SLC25A19 PE=2 SV=1 306 506 3.0E-08
sp|P38087|YMC2_YEAST Carrier protein YMC2, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YMC2 PE=1 SV=1 320 501 3.0E-08
sp|P56499|UCP3_RAT Mitochondrial uncoupling protein 3 OS=Rattus norvegicus GN=Ucp3 PE=2 SV=1 198 507 3.0E-08
sp|Q5HZE0|MCATL_RAT Mitochondrial basic amino acids transporter OS=Rattus norvegicus GN=Slc25a29 PE=2 SV=1 317 510 3.0E-08
sp|Q641C8|SAMC_XENLA S-adenosylmethionine mitochondrial carrier protein OS=Xenopus laevis GN=slc25a26 PE=2 SV=1 242 490 3.0E-08
sp|Q8JZU2|TXTP_MOUSE Tricarboxylate transport protein, mitochondrial OS=Mus musculus GN=Slc25a1 PE=1 SV=1 296 499 4.0E-08
sp|Q8N8R3|MCATL_HUMAN Mitochondrial basic amino acids transporter OS=Homo sapiens GN=SLC25A29 PE=1 SV=2 187 405 4.0E-08
sp|A0JN87|ODC_BOVIN Mitochondrial 2-oxodicarboxylate carrier OS=Bos taurus GN=SLC25A21 PE=2 SV=1 424 508 4.0E-08
sp|Q9M038|SFC1_ARATH Mitochondrial succinate-fumarate transporter 1 OS=Arabidopsis thaliana GN=SFC1 PE=2 SV=1 308 488 4.0E-08
sp|Q8IBS5|CDPK4_PLAF7 Calcium-dependent protein kinase 4 OS=Plasmodium falciparum (isolate 3D7) GN=CPK4 PE=1 SV=3 28 155 4.0E-08
sp|Q552L9|S2540_DICDI Mitochondrial substrate carrier family protein H OS=Dictyostelium discoideum GN=mcfH PE=3 SV=1 318 507 5.0E-08
sp|P27080|ADT_CHLRE ADP,ATP carrier protein OS=Chlamydomonas reinhardtii GN=ABT PE=2 SV=1 316 504 5.0E-08
sp|Q551X6|MCFV_DICDI Mitochondrial substrate carrier family protein V OS=Dictyostelium discoideum GN=mcfV PE=3 SV=1 316 504 5.0E-08
sp|P63317|TNNC1_PIG Troponin C, slow skeletal and cardiac muscles OS=Sus scrofa GN=TNNC1 PE=1 SV=1 63 154 5.0E-08
sp|P63315|TNNC1_BOVIN Troponin C, slow skeletal and cardiac muscles OS=Bos taurus GN=TNNC1 PE=1 SV=1 63 154 5.0E-08
sp|Q7RAH3|CDPK1_PLAYO Calcium-dependent protein kinase 1 OS=Plasmodium yoelii yoelii GN=CPK1 PE=3 SV=3 28 150 6.0E-08
sp|P31692|ADT_PARKE ADP,ATP carrier protein OS=Parachlorella kessleri PE=3 SV=1 302 482 7.0E-08
sp|Q9VQG4|COLT_DROME Congested-like trachea protein OS=Drosophila melanogaster GN=colt PE=2 SV=1 316 501 7.0E-08
sp|Q76P23|PM34_DICDI Mitochondrial substrate carrier family protein Q OS=Dictyostelium discoideum GN=mcfQ PE=2 SV=1 189 499 7.0E-08
sp|P09860|TNNC1_CHICK Troponin C, slow skeletal and cardiac muscles OS=Gallus gallus GN=TNNC1 PE=1 SV=1 63 154 7.0E-08
sp|Q86HN8|MCFY_DICDI Mitochondrial substrate carrier family protein Y OS=Dictyostelium discoideum GN=mcfY PE=3 SV=1 199 501 7.0E-08
sp|Q498U3|S2540_RAT Solute carrier family 25 member 40 OS=Rattus norvegicus GN=Slc25a40 PE=2 SV=2 302 507 8.0E-08
sp|B2MVX9|S2538_SHEEP Solute carrier family 25 member 38 OS=Ovis aries GN=SLC25A38 PE=2 SV=1 316 510 8.0E-08
sp|P02591|TNNC1_RABIT Troponin C, slow skeletal and cardiac muscles OS=Oryctolagus cuniculus GN=TNNC1 PE=1 SV=1 63 154 8.0E-08
sp|P63316|TNNC1_HUMAN Troponin C, slow skeletal and cardiac muscles OS=Homo sapiens GN=TNNC1 PE=1 SV=1 63 154 8.0E-08
sp|Q9SIQ7|CDPKO_ARATH Calcium-dependent protein kinase 24 OS=Arabidopsis thaliana GN=CPK24 PE=2 SV=1 19 171 8.0E-08
sp|O70579|PM34_MOUSE Peroxisomal membrane protein PMP34 OS=Mus musculus GN=Slc25a17 PE=1 SV=1 318 507 8.0E-08
sp|Q9P7X9|YH66_SCHPO Uncharacterized mitochondrial carrier P23A10.06 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBP23A10.06 PE=3 SV=1 182 505 8.0E-08
sp|Q03028|ODC1_YEAST Mitochondrial 2-oxodicarboxylate carrier 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ODC1 PE=1 SV=1 198 502 8.0E-08
sp|Q09665|TNNC2_CAEEL Troponin C, isoform 2 OS=Caenorhabditis elegans GN=tnc-2 PE=2 SV=1 32 154 8.0E-08
sp|Q99297|ODC2_YEAST Mitochondrial 2-oxodicarboxylate carrier 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ODC2 PE=1 SV=1 315 490 9.0E-08
sp|A0JN87|ODC_BOVIN Mitochondrial 2-oxodicarboxylate carrier OS=Bos taurus GN=SLC25A21 PE=2 SV=1 199 501 9.0E-08
sp|P19123|TNNC1_MOUSE Troponin C, slow skeletal and cardiac muscles OS=Mus musculus GN=Tnnc1 PE=1 SV=1 63 154 9.0E-08
sp|Q9QXX4|CMC2_MOUSE Calcium-binding mitochondrial carrier protein Aralar2 OS=Mus musculus GN=Slc25a13 PE=1 SV=1 188 417 1.0E-07
sp|Q6P036|S2533_DANRE Solute carrier family 25 member 33 OS=Danio rerio GN=slc25a33 PE=2 SV=1 426 504 1.0E-07
sp|P32332|OAC1_YEAST Mitochondrial oxaloacetate transport protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=OAC1 PE=1 SV=1 195 508 1.0E-07
sp|P02723|ADT_NEUCR ADP,ATP carrier protein OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=aac PE=3 SV=1 316 507 1.0E-07
sp|Q8BGP6|S2540_MOUSE Solute carrier family 25 member 40 OS=Mus musculus GN=Slc25a40 PE=1 SV=1 302 507 1.0E-07
sp|Q99JD3|ODC_RAT Mitochondrial 2-oxodicarboxylate carrier OS=Rattus norvegicus GN=Slc25a21 PE=2 SV=1 426 508 1.0E-07
sp|Q9WVD5|ORNT1_MOUSE Mitochondrial ornithine transporter 1 OS=Mus musculus GN=Slc25a15 PE=1 SV=1 240 507 1.0E-07
sp|Q86I81|MCFI_DICDI Mitochondrial substrate carrier family protein I OS=Dictyostelium discoideum GN=mcfI PE=2 SV=1 184 499 1.0E-07
sp|Q6L4D4|CML15_ORYSJ Probable calcium-binding protein CML15 OS=Oryza sativa subsp. japonica GN=CML15 PE=2 SV=1 26 151 1.0E-07
sp|Q08CI8|S238A_DANRE Solute carrier family 25 member 38-A OS=Danio rerio GN=slc25a38a PE=2 SV=2 198 509 1.0E-07
sp|Q9FY68|PUMP6_ARATH Mitochondrial uncoupling protein 6 OS=Arabidopsis thaliana GN=PUMP6 PE=2 SV=1 242 504 1.0E-07
sp|A6QR09|SAMC_BOVIN S-adenosylmethionine mitochondrial carrier protein OS=Bos taurus GN=SLC25A26 PE=2 SV=1 314 504 1.0E-07
sp|Q38870|CDPK2_ARATH Calcium-dependent protein kinase 2 OS=Arabidopsis thaliana GN=CPK2 PE=1 SV=1 25 150 1.0E-07
sp|P10246|TNNC2_MELGA Troponin C, skeletal muscle OS=Meleagris gallopavo GN=TNNC2 PE=1 SV=2 63 161 1.0E-07
sp|Q7RJG2|CDPK4_PLAYO Calcium-dependent protein kinase 4 OS=Plasmodium yoelii yoelii GN=CPK4 PE=3 SV=3 28 155 1.0E-07
sp|Q93XM7|MCAT_ARATH Mitochondrial carnitine/acylcarnitine carrier-like protein OS=Arabidopsis thaliana GN=BOU PE=2 SV=1 318 507 2.0E-07
sp|Q5RFB7|ODC_PONAB Mitochondrial 2-oxodicarboxylate carrier OS=Pongo abelii GN=SLC25A21 PE=2 SV=1 426 508 2.0E-07
sp|Q9ZWG1|PUMP2_ARATH Mitochondrial uncoupling protein 2 OS=Arabidopsis thaliana GN=PUMP2 PE=2 SV=1 309 490 2.0E-07
sp|Q9C5M0|DTC_ARATH Mitochondrial dicarboxylate/tricarboxylate transporter DTC OS=Arabidopsis thaliana GN=DTC PE=1 SV=1 241 498 2.0E-07
sp|P02589|TNNC2_PELES Troponin C, skeletal muscle OS=Pelophylax esculentus PE=1 SV=1 63 161 2.0E-07
sp|P62345|CDPK4_PLABA Calcium-dependent protein kinase 4 OS=Plasmodium berghei (strain Anka) GN=CPK4 PE=1 SV=2 28 155 2.0E-07
sp|O43808|PM34_HUMAN Peroxisomal membrane protein PMP34 OS=Homo sapiens GN=SLC25A17 PE=1 SV=1 317 507 2.0E-07
sp|P10861|UCP1_BOVIN Mitochondrial brown fat uncoupling protein 1 (Fragment) OS=Bos taurus GN=UCP1 PE=2 SV=2 318 507 2.0E-07
sp|Q9C6P3|CDPKX_ARATH Calcium-dependent protein kinase 33 OS=Arabidopsis thaliana GN=CPK33 PE=2 SV=1 25 150 2.0E-07
sp|Q9P3T7|ODC_SCHPO Probable mitochondrial 2-oxodicarboxylate carrier OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC328.09 PE=3 SV=1 198 507 2.0E-07
sp|P02586|TNNC2_RABIT Troponin C, skeletal muscle OS=Oryctolagus cuniculus GN=TNNC2 PE=1 SV=2 26 161 2.0E-07
sp|P04633|UCP1_RAT Mitochondrial brown fat uncoupling protein 1 OS=Rattus norvegicus GN=Ucp1 PE=1 SV=2 315 510 2.0E-07
sp|P14271|UCP1_RABIT Mitochondrial brown fat uncoupling protein 1 OS=Oryctolagus cuniculus GN=UCP1 PE=2 SV=1 315 507 2.0E-07
sp|P02588|TNNC2_CHICK Troponin C, skeletal muscle OS=Gallus gallus GN=TNNC2 PE=1 SV=3 63 161 2.0E-07
sp|P02585|TNNC2_HUMAN Troponin C, skeletal muscle OS=Homo sapiens GN=TNNC2 PE=1 SV=2 26 161 2.0E-07
sp|Q38868|CDPK9_ARATH Calcium-dependent protein kinase 9 OS=Arabidopsis thaliana GN=CPK9 PE=1 SV=1 25 150 2.0E-07
sp|Q922G0|S2536_MOUSE Solute carrier family 25 member 36 OS=Mus musculus GN=Slc25a36 PE=2 SV=1 172 396 3.0E-07
sp|Q5ZKP7|S2536_CHICK Solute carrier family 25 member 36 OS=Gallus gallus GN=SLC25A36 PE=2 SV=1 426 507 3.0E-07
sp|Q8N413|S2545_HUMAN Solute carrier family 25 member 45 OS=Homo sapiens GN=SLC25A45 PE=2 SV=2 315 505 3.0E-07
sp|P20801|TNNC2_MOUSE Troponin C, skeletal muscle OS=Mus musculus GN=Tnnc2 PE=1 SV=2 26 161 3.0E-07
sp|Q38872|CDPK6_ARATH Calcium-dependent protein kinase 6 OS=Arabidopsis thaliana GN=CPK6 PE=1 SV=1 25 150 3.0E-07
sp|Q9UTN1|OAC1_SCHPO Mitochondrial oxaloacetate transport protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=oac1 PE=3 SV=1 198 505 3.0E-07
sp|Q6C6I3|S2538_YARLI Solute carrier family 25 member 38 homolog OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0E09284g PE=3 SV=1 197 502 3.0E-07
sp|Q9JM83|CALM4_MOUSE Calmodulin-4 OS=Mus musculus GN=Calm4 PE=2 SV=2 26 150 3.0E-07
sp|A0PC02|UCP1_OCHDA Mitochondrial brown fat uncoupling protein 1 OS=Ochotona dauurica GN=UCP1 PE=2 SV=1 194 507 3.0E-07
sp|Q9ZV15|CDPKK_ARATH Calcium-dependent protein kinase 20 OS=Arabidopsis thaliana GN=CPK20 PE=3 SV=1 25 154 4.0E-07
sp|Q84MN0|CML4_ORYSJ Calmodulin-like protein 4 OS=Oryza sativa subsp. japonica GN=CML4 PE=2 SV=1 32 157 4.0E-07
sp|Q6Q0C1|S2547_HUMAN Solute carrier family 25 member 47 OS=Homo sapiens GN=SLC25A47 PE=2 SV=1 426 503 4.0E-07
sp|P02587|TNNC2_PIG Troponin C, skeletal muscle OS=Sus scrofa GN=TNNC2 PE=1 SV=2 26 161 4.0E-07
sp|Q55BF4|UCPA_DICDI Mitochondrial substrate carrier family protein ucpA OS=Dictyostelium discoideum GN=ucpA PE=3 SV=1 198 505 4.0E-07
sp|Q54EV4|MCFA_DICDI Mitochondrial substrate carrier family protein A OS=Dictyostelium discoideum GN=mcfA PE=3 SV=1 316 504 5.0E-07
sp|Q922G0|S2536_MOUSE Solute carrier family 25 member 36 OS=Mus musculus GN=Slc25a36 PE=2 SV=1 426 507 5.0E-07
sp|Q5HZE0|MCATL_RAT Mitochondrial basic amino acids transporter OS=Rattus norvegicus GN=Slc25a29 PE=2 SV=1 187 401 5.0E-07
sp|Q8BZ09|ODC_MOUSE Mitochondrial 2-oxodicarboxylate carrier OS=Mus musculus GN=Slc25a21 PE=1 SV=1 426 508 5.0E-07
sp|Q75A82|ANT1_ASHGO Peroxisomal adenine nucleotide transporter 1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=ANT1 PE=3 SV=1 361 507 5.0E-07
sp|P0CAT2|S238B_DANRE Solute carrier family 25 member 38-B OS=Danio rerio GN=slc25a38b PE=3 SV=2 195 509 5.0E-07
sp|Q9BXI2|ORNT2_HUMAN Mitochondrial ornithine transporter 2 OS=Homo sapiens GN=SLC25A2 PE=1 SV=3 240 507 5.0E-07
sp|Q505J6|GHC2_RAT Mitochondrial glutamate carrier 2 OS=Rattus norvegicus GN=Slc25a18 PE=2 SV=2 407 495 6.0E-07
sp|Q76PC3|YQ73_SCHPO Uncharacterized mitochondrial carrier C1442.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1442.03 PE=3 SV=1 318 506 6.0E-07
sp|P80322|TNNC_BRALA Troponin C OS=Branchiostoma lanceolatum PE=1 SV=1 32 160 6.0E-07
sp|P05936|TNNC1_COTJA Troponin C, slow skeletal and cardiac muscles OS=Coturnix coturnix japonica GN=TNNC1 PE=2 SV=1 63 154 6.0E-07
sp|P38505|CALBP_ENTHI Calcium-binding protein OS=Entamoeba histolytica PE=1 SV=2 62 154 6.0E-07
sp|Q96CQ1|S2536_HUMAN Solute carrier family 25 member 36 OS=Homo sapiens GN=SLC25A36 PE=1 SV=1 426 507 7.0E-07
sp|Q09461|YQ51_CAEEL Uncharacterized mitochondrial carrier C16C10.1 OS=Caenorhabditis elegans GN=C16C10.1 PE=3 SV=2 323 507 7.0E-07
sp|Q18P97|UCP1_SUNMU Mitochondrial brown fat uncoupling protein 1 OS=Suncus murinus GN=UCP1 PE=2 SV=1 315 507 7.0E-07
sp|Q9M7R0|ALL8_OLEEU Calcium-binding allergen Ole e 8 OS=Olea europaea PE=1 SV=1 20 154 8.0E-07
sp|Q9DB41|GHC2_MOUSE Mitochondrial glutamate carrier 2 OS=Mus musculus GN=Slc25a18 PE=1 SV=4 407 495 9.0E-07
sp|O60029|PET8_ASHGO Putative mitochondrial carrier protein PET8 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=PET8 PE=3 SV=1 314 505 9.0E-07
sp|P12242|UCP1_MOUSE Mitochondrial brown fat uncoupling protein 1 OS=Mus musculus GN=Ucp1 PE=1 SV=2 315 507 9.0E-07
sp|Q9M024|TAAC_ARATH Thylakoid ADP,ATP carrier protein, chloroplastic OS=Arabidopsis thaliana GN=TAAC PE=1 SV=1 188 397 1.0E-06
sp|Q9UJS0|CMC2_HUMAN Calcium-binding mitochondrial carrier protein Aralar2 OS=Homo sapiens GN=SLC25A13 PE=1 SV=2 188 417 1.0E-06
sp|Q8CFJ7|S2545_MOUSE Solute carrier family 25 member 45 OS=Mus musculus GN=Slc25a45 PE=1 SV=1 426 507 1.0E-06
sp|Q8CFJ7|S2545_MOUSE Solute carrier family 25 member 45 OS=Mus musculus GN=Slc25a45 PE=1 SV=1 315 505 1.0E-06
sp|Q9VQG4|COLT_DROME Congested-like trachea protein OS=Drosophila melanogaster GN=colt PE=2 SV=1 438 505 1.0E-06
sp|Q9H1K4|GHC2_HUMAN Mitochondrial glutamate carrier 2 OS=Homo sapiens GN=SLC25A18 PE=1 SV=1 426 507 1.0E-06
sp|Q27257|DIF1_CAEEL Protein dif-1 OS=Caenorhabditis elegans GN=dif-1 PE=2 SV=1 316 505 1.0E-06
sp|Q86HN8|MCFY_DICDI Mitochondrial substrate carrier family protein Y OS=Dictyostelium discoideum GN=mcfY PE=3 SV=1 322 508 1.0E-06
sp|Q9LI84|CML16_ARATH Probable calcium-binding protein CML16 OS=Arabidopsis thaliana GN=CML16 PE=2 SV=2 24 154 1.0E-06
sp|P14533|CABO_DORPE Squidulin OS=Doryteuthis pealeii PE=1 SV=1 32 150 1.0E-06
sp|Q9ER18|UCP1_PHOSU Mitochondrial brown fat uncoupling protein 1 OS=Phodopus sungorus GN=UCP1 PE=2 SV=1 194 507 1.0E-06
sp|Q70HW3|SAMC_HUMAN S-adenosylmethionine mitochondrial carrier protein OS=Homo sapiens GN=SLC25A26 PE=2 SV=1 314 504 1.0E-06
sp|Q38871|CDPK5_ARATH Calcium-dependent protein kinase 5 OS=Arabidopsis thaliana GN=CPK5 PE=2 SV=1 25 150 1.0E-06
sp|B0DK57|S2538_LACBS Solute carrier family 25 member 38 homolog OS=Laccaria bicolor (strain S238N-H82 / ATCC MYA-4686) GN=LACBIDRAFT_191230 PE=3 SV=1 198 501 1.0E-06
sp|P02722|ADT1_BOVIN ADP/ATP translocase 1 OS=Bos taurus GN=SLC25A4 PE=1 SV=3 310 507 2.0E-06
sp|P18239|ADT2_YEAST ADP,ATP carrier protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PET9 PE=1 SV=2 316 507 2.0E-06
sp|Q1LZB3|S2533_BOVIN Solute carrier family 25 member 33 OS=Bos taurus GN=SLC25A33 PE=2 SV=1 426 504 2.0E-06
sp|Q6ZT89|S2548_HUMAN Solute carrier family 25 member 48 OS=Homo sapiens GN=SLC25A48 PE=1 SV=2 198 405 2.0E-06
sp|O14281|YETC_SCHPO Uncharacterized mitochondrial carrier C8C9.12c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC8C9.12c PE=3 SV=1 297 502 2.0E-06
sp|Q8BL03|MCATL_MOUSE Mitochondrial basic amino acids transporter OS=Mus musculus GN=Slc25a29 PE=1 SV=1 187 407 2.0E-06
sp|Q8LB08|ADT4_ARATH ADP,ATP carrier protein ER-ANT1 OS=Arabidopsis thaliana GN=ER-ANT1 PE=2 SV=2 316 504 2.0E-06
sp|Q4V9P0|SAMC_DANRE S-adenosylmethionine mitochondrial carrier protein OS=Danio rerio GN=slc25a26 PE=2 SV=1 242 507 2.0E-06
sp|Q55BF4|UCPA_DICDI Mitochondrial substrate carrier family protein ucpA OS=Dictyostelium discoideum GN=ucpA PE=3 SV=1 420 508 2.0E-06
sp|Q54BF6|MCFN_DICDI Mitochondrial substrate carrier family protein N OS=Dictyostelium discoideum GN=mcfN PE=1 SV=2 195 509 2.0E-06
sp|Q9BLG0|TNNC_TODPA Troponin C OS=Todarodes pacificus PE=1 SV=3 31 155 2.0E-06
sp|Q3ZBJ8|MFRN1_BOVIN Mitoferrin-1 OS=Bos taurus GN=SLC25A37 PE=2 SV=1 411 507 2.0E-06
sp|Q9FMP5|CDPKH_ARATH Calcium-dependent protein kinase 17 OS=Arabidopsis thaliana GN=CPK17 PE=2 SV=1 25 150 2.0E-06
sp|Q9Y619|ORNT1_HUMAN Mitochondrial ornithine transporter 1 OS=Homo sapiens GN=SLC25A15 PE=1 SV=1 240 507 2.0E-06
sp|Q7DNC3|MPCP1_ARATH Mitochondrial phosphate carrier protein 1, mitochondrial OS=Arabidopsis thaliana GN=MPT1 PE=2 SV=1 199 504 2.0E-06
sp|P15845|SM20_SCHMA 20 kDa calcium-binding protein OS=Schistosoma mansoni GN=SM20 PE=2 SV=2 28 154 2.0E-06
sp|A7TIQ0|S2538_VANPO Solute carrier family 25 member 38 homolog OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=Kpol_1043p32 PE=3 SV=1 232 501 2.0E-06
sp|Q9NZT1|CALL5_HUMAN Calmodulin-like protein 5 OS=Homo sapiens GN=CALML5 PE=1 SV=2 29 154 2.0E-06
sp|O04200|PXN_ARATH Peroxisomal nicotinamide adenine dinucleotide carrier OS=Arabidopsis thaliana GN=PXN PE=1 SV=1 358 502 2.0E-06
sp|Q9FYK2|CML25_ARATH Probable calcium-binding protein CML25 OS=Arabidopsis thaliana GN=CML25 PE=2 SV=1 24 161 2.0E-06
sp|P48962|ADT1_MOUSE ADP/ATP translocase 1 OS=Mus musculus GN=Slc25a4 PE=1 SV=4 310 507 3.0E-06
sp|P12235|ADT1_HUMAN ADP/ATP translocase 1 OS=Homo sapiens GN=SLC25A4 PE=1 SV=4 308 507 3.0E-06
sp|Q000K2|ADT2_TACAC ADP/ATP translocase 2 OS=Tachyglossus aculeatus aculeatus GN=SLC25A5 PE=2 SV=1 310 507 3.0E-06
sp|Q9FM86|ADT5_ARATH Probable ADP,ATP carrier protein At5g56450 OS=Arabidopsis thaliana GN=At5g56450 PE=2 SV=1 307 486 3.0E-06
sp|P18238|ADT3_YEAST ADP,ATP carrier protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AAC3 PE=1 SV=1 316 489 3.0E-06
sp|Q9DB41|GHC2_MOUSE Mitochondrial glutamate carrier 2 OS=Mus musculus GN=Slc25a18 PE=1 SV=4 310 502 3.0E-06
sp|A7TDX5|TPC1_VANPO Mitochondrial thiamine pyrophosphate carrier 1 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=TPC1 PE=3 SV=1 305 501 3.0E-06
sp|P02599|CALM_DICDI Calmodulin OS=Dictyostelium discoideum GN=calA PE=1 SV=3 32 155 3.0E-06
sp|Q9QZD8|DIC_MOUSE Mitochondrial dicarboxylate carrier OS=Mus musculus GN=Slc25a10 PE=1 SV=2 197 509 3.0E-06
sp|A5D9W9|S2538_PICGU Solute carrier family 25 member 38 homolog OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=PGUG_00074 PE=3 SV=2 197 501 3.0E-06
sp|P38988|GGC1_YEAST Mitochondrial GTP/GDP carrier protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GGC1 PE=1 SV=1 318 502 3.0E-06
sp|Q06497|ANT1_YEAST Peroxisomal adenine nucleotide transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ANT1 PE=1 SV=1 199 488 3.0E-06
sp|Q9HC21|TPC_HUMAN Mitochondrial thiamine pyrophosphate carrier OS=Homo sapiens GN=SLC25A19 PE=1 SV=1 317 504 4.0E-06
sp|Q05962|ADT1_RAT ADP/ATP translocase 1 OS=Rattus norvegicus GN=Slc25a4 PE=1 SV=3 310 507 4.0E-06
sp|Q8SQH5|ADT2_BOVIN ADP/ATP translocase 2 OS=Bos taurus GN=SLC25A5 PE=2 SV=3 310 507 4.0E-06
sp|Q38869|CDPK4_ARATH Calcium-dependent protein kinase 4 OS=Arabidopsis thaliana GN=CPK4 PE=1 SV=1 25 150 4.0E-06
sp|Q6GLA2|SAMC_XENTR S-adenosylmethionine mitochondrial carrier protein OS=Xenopus tropicalis GN=slc25a26 PE=2 SV=1 314 504 4.0E-06
sp|Q9SZM3|CDPKQ_ARATH Calcium-dependent protein kinase 26 OS=Arabidopsis thaliana GN=CPK26 PE=2 SV=1 25 150 4.0E-06
sp|Q9M2Z8|MPCP2_ARATH Mitochondrial phosphate carrier protein 2, mitochondrial OS=Arabidopsis thaliana GN=MPT2 PE=2 SV=1 307 503 4.0E-06
sp|Q39016|CDPKB_ARATH Calcium-dependent protein kinase 11 OS=Arabidopsis thaliana GN=CPK11 PE=1 SV=2 25 150 4.0E-06
sp|P04575|UCP1_MESAU Mitochondrial brown fat uncoupling protein 1 OS=Mesocricetus auratus GN=UCP1 PE=1 SV=3 194 507 5.0E-06
sp|O49717|CDPKF_ARATH Calcium-dependent protein kinase 15 OS=Arabidopsis thaliana GN=CPK15 PE=2 SV=1 25 150 5.0E-06
sp|P41210|CATR_ATRNU Caltractin OS=Atriplex nummularia PE=2 SV=1 20 162 5.0E-06
sp|Q9M8U1|CML18_ARATH Probable calcium-binding protein CML18 OS=Arabidopsis thaliana GN=CML18 PE=1 SV=1 34 150 6.0E-06
sp|Q42396|CDPKC_ARATH Calcium-dependent protein kinase 12 OS=Arabidopsis thaliana GN=CPK12 PE=1 SV=1 25 150 6.0E-06
sp|P12236|ADT3_HUMAN ADP/ATP translocase 3 OS=Homo sapiens GN=SLC25A6 PE=1 SV=4 310 507 7.0E-06
sp|Q9VAY3|MFRN_DROME Mitoferrin OS=Drosophila melanogaster GN=mfrn PE=2 SV=1 191 397 7.0E-06
sp|Q9FZ75|CML15_ARATH Probable calcium-binding protein CML15 OS=Arabidopsis thaliana GN=CML15 PE=2 SV=1 24 154 7.0E-06
sp|Q5IS35|TPC_MACFA Mitochondrial thiamine pyrophosphate carrier OS=Macaca fascicularis GN=SLC25A19 PE=2 SV=1 317 504 8.0E-06
sp|Q5NVC1|TPC_PONAB Mitochondrial thiamine pyrophosphate carrier OS=Pongo abelii GN=SLC25A19 PE=2 SV=1 317 504 8.0E-06
sp|Q9Z2Z6|MCAT_MOUSE Mitochondrial carnitine/acylcarnitine carrier protein OS=Mus musculus GN=Slc25a20 PE=1 SV=1 189 394 8.0E-06
sp|Q09461|YQ51_CAEEL Uncharacterized mitochondrial carrier C16C10.1 OS=Caenorhabditis elegans GN=C16C10.1 PE=3 SV=2 242 404 8.0E-06
sp|Q9C9U8|CML26_ARATH Probable calcium-binding protein CML26 OS=Arabidopsis thaliana GN=CML26 PE=1 SV=1 22 154 8.0E-06
sp|Q6IS41|S2547_MOUSE Solute carrier family 25 member 47 OS=Mus musculus GN=Slc25a47 PE=2 SV=2 426 503 8.0E-06
sp|Q0DJV6|CML18_ORYSJ Probable calcium-binding protein CML18 OS=Oryza sativa subsp. japonica GN=CML18 PE=2 SV=1 25 150 8.0E-06
sp|A5A7I8|CDPK5_SOLTU Calcium-dependent protein kinase 5 OS=Solanum tuberosum GN=CPK5 PE=2 SV=1 25 150 8.0E-06
sp|O46373|ADT1_RABIT ADP/ATP translocase 1 OS=Oryctolagus cuniculus GN=SLC25A4 PE=2 SV=3 310 507 1.0E-05
sp|P51881|ADT2_MOUSE ADP/ATP translocase 2 OS=Mus musculus GN=Slc25a5 PE=1 SV=3 310 507 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0005509 calcium ion binding Yes
GO:0046872 metal ion binding No
GO:0003674 molecular_function No
GO:0005488 binding No
GO:0043167 ion binding No
GO:0043169 cation binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 25 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|6254
MGVSRLVSDVERRLYEPQNQRDVRIEALWAKLDPAGTGELDLTGLKKGFKSIDHPMKNADDLLEQIMKEVDTNHD
GKMQYKEFHAFVEQAERQLFLLFQAIDKDGNGKLDMKELQTAFRTAGLTVSNRRLADFFHDLDQNHDGFVTFDEW
RNFLIFMPARQYDSHLRAAISYYCAVVNVTPEGDSIVRDDTLQGLGYFLAGAIAGGVSRTATAPLDRLKVYLLVN
TRNSSETAATALKQGRPIDAVKNALRPFKDAVSDLYRSGGIRSFFAGNGLNIVKIMPETAIKFGSYEAVKRALAN
LEGHGDPNHISSYSKFTAGGLAGMIAQFCVYPVDTLKFRLQCETVKGGLTGGALVRQTAAKMYADGGLRACYRGV
TMGLVGMFPYSAIDMGMFEFLKTSYRTYHARLAGCHEDDVEPSNIATGMIGATSGAIGATVVYPLNVVRTRLQTQ
GTVMHKETYTGIWDVARKTIQREGYRGFYKGLTPNLLKVAPALSITWVVYENSKRALGLH*
Coding >OphauB2|6254
ATGGGCGTGTCAAGGCTCGTCAGCGACGTGGAGCGCCGTCTCTACGAGCCTCAGAACCAGCGCGATGTCCGCATA
GAGGCGCTCTGGGCCAAGCTGGACCCAGCCGGCACCGGCGAGCTTGATCTCACGGGCCTCAAAAAGGGCTTCAAA
TCCATTGACCATCCAATGAAGAATGCCGATGACTTGCTGGAGCAAATCATGAAGGAGGTAGACACCAATCACGAT
GGCAAGATGCAGTATAAAGAGTTCCACGCCTTTGTTGAGCAGGCTGAACGACAGCTCTTCCTCCTATTCCAGGCT
ATTGACAAGGACGGCAACGGCAAGCTGGACATGAAGGAGCTCCAGACGGCCTTTCGTACGGCGGGCCTGACCGTC
TCGAACCGCCGGCTGGCCGACTTCTTCCACGACCTGGACCAGAACCACGACGGCTTTGTCACGTTTGACGAATGG
CGGAATTTTCTCATCTTCATGCCGGCGCGCCAATATGATTCACATCTGCGTGCCGCCATATCCTATTACTGCGCC
GTCGTCAATGTCACCCCCGAAGGCGACTCGATTGTGCGTGACGACACTTTACAAGGCTTAGGTTACTTCCTTGCG
GGTGCCATCGCCGGCGGAGTGTCGCGCACTGCCACTGCGCCTCTTGACCGTCTCAAGGTGTACCTGCTGGTCAAC
ACGCGCAACAGCTCCGAGACTGCAGCTACTGCACTTAAGCAGGGCCGTCCAATAGACGCTGTGAAAAACGCGCTG
CGACCATTCAAAGATGCCGTCAGTGACTTATACCGCTCGGGCGGCATTCGTAGTTTTTTTGCTGGCAACGGCCTC
AACATTGTCAAGATTATGCCCGAGACGGCCATAAAGTTTGGATCGTACGAGGCGGTAAAGCGCGCACTGGCCAAC
CTGGAGGGGCACGGCGACCCCAACCACATCAGCTCTTACTCAAAGTTTACTGCCGGAGGCCTGGCTGGCATGATT
GCACAATTTTGCGTGTACCCGGTCGACACGCTCAAGTTTCGTCTGCAATGCGAGACGGTCAAGGGCGGTCTTACT
GGAGGCGCGCTCGTGCGCCAGACGGCTGCCAAGATGTATGCCGATGGCGGCCTACGGGCCTGCTATCGCGGGGTG
ACGATGGGCTTGGTGGGCATGTTCCCCTACAGTGCCATTGACATGGGCATGTTTGAGTTTCTAAAGACAAGTTAC
CGCACCTATCACGCCCGTCTGGCCGGTTGTCACGAGGATGACGTGGAGCCAAGCAACATTGCCACTGGCATGATT
GGCGCCACATCGGGTGCCATTGGCGCCACTGTTGTCTACCCTCTCAACGTTGTGCGTACCCGGCTGCAGACACAG
GGCACCGTGATGCATAAGGAGACATACACAGGCATCTGGGATGTGGCGCGCAAGACGATACAGCGCGAGGGCTAT
CGCGGCTTCTACAAGGGTCTGACGCCAAATCTCCTCAAGGTGGCTCCCGCTTTGAGCATCACCTGGGTCGTTTAC
GAGAACTCGAAGCGAGCCCTGGGACTGCATTAG
Transcript >OphauB2|6254
ATGGGCGTGTCAAGGCTCGTCAGCGACGTGGAGCGCCGTCTCTACGAGCCTCAGAACCAGCGCGATGTCCGCATA
GAGGCGCTCTGGGCCAAGCTGGACCCAGCCGGCACCGGCGAGCTTGATCTCACGGGCCTCAAAAAGGGCTTCAAA
TCCATTGACCATCCAATGAAGAATGCCGATGACTTGCTGGAGCAAATCATGAAGGAGGTAGACACCAATCACGAT
GGCAAGATGCAGTATAAAGAGTTCCACGCCTTTGTTGAGCAGGCTGAACGACAGCTCTTCCTCCTATTCCAGGCT
ATTGACAAGGACGGCAACGGCAAGCTGGACATGAAGGAGCTCCAGACGGCCTTTCGTACGGCGGGCCTGACCGTC
TCGAACCGCCGGCTGGCCGACTTCTTCCACGACCTGGACCAGAACCACGACGGCTTTGTCACGTTTGACGAATGG
CGGAATTTTCTCATCTTCATGCCGGCGCGCCAATATGATTCACATCTGCGTGCCGCCATATCCTATTACTGCGCC
GTCGTCAATGTCACCCCCGAAGGCGACTCGATTGTGCGTGACGACACTTTACAAGGCTTAGGTTACTTCCTTGCG
GGTGCCATCGCCGGCGGAGTGTCGCGCACTGCCACTGCGCCTCTTGACCGTCTCAAGGTGTACCTGCTGGTCAAC
ACGCGCAACAGCTCCGAGACTGCAGCTACTGCACTTAAGCAGGGCCGTCCAATAGACGCTGTGAAAAACGCGCTG
CGACCATTCAAAGATGCCGTCAGTGACTTATACCGCTCGGGCGGCATTCGTAGTTTTTTTGCTGGCAACGGCCTC
AACATTGTCAAGATTATGCCCGAGACGGCCATAAAGTTTGGATCGTACGAGGCGGTAAAGCGCGCACTGGCCAAC
CTGGAGGGGCACGGCGACCCCAACCACATCAGCTCTTACTCAAAGTTTACTGCCGGAGGCCTGGCTGGCATGATT
GCACAATTTTGCGTGTACCCGGTCGACACGCTCAAGTTTCGTCTGCAATGCGAGACGGTCAAGGGCGGTCTTACT
GGAGGCGCGCTCGTGCGCCAGACGGCTGCCAAGATGTATGCCGATGGCGGCCTACGGGCCTGCTATCGCGGGGTG
ACGATGGGCTTGGTGGGCATGTTCCCCTACAGTGCCATTGACATGGGCATGTTTGAGTTTCTAAAGACAAGTTAC
CGCACCTATCACGCCCGTCTGGCCGGTTGTCACGAGGATGACGTGGAGCCAAGCAACATTGCCACTGGCATGATT
GGCGCCACATCGGGTGCCATTGGCGCCACTGTTGTCTACCCTCTCAACGTTGTGCGTACCCGGCTGCAGACACAG
GGCACCGTGATGCATAAGGAGACATACACAGGCATCTGGGATGTGGCGCGCAAGACGATACAGCGCGAGGGCTAT
CGCGGCTTCTACAAGGGTCTGACGCCAAATCTCCTCAAGGTGGCTCCCGCTTTGAGCATCACCTGGGTCGTTTAC
GAGAACTCGAAGCGAGCCCTGGGACTGCATTAG
Gene >OphauB2|6254
ATGGGCGTGTCAAGGCTCGTCAGCGACGTGGAGCGCCGTCTCTACGAGCCTCAGAACCAGCGCGATGTCCGCATA
GAGGCGCTCTGGGCCAAGCTGGACCCAGCCGGCACCGGCGAGCTTGATCTCACGGGCCTCAAAAAGGGCTTCAAA
TCCATTGACCATCGTAAGCCGGGAGCCCCGGCAAGGCCATGGTGCAGCAGGCAGCTGACGCTTCTCCCGGCAGCA
ATGAAGAATGCCGATGACTTGCTGGAGCAAATCATGAAGGAGGTAGACACCAATCACGATGGCAAGATGCAGTAT
AAAGGTAGCCAGGCGGCTGGATGCCCCCGTCGAGGCCATTGCTGATGGGTGCCGCCGACAGAGTTCCACGCCTTT
GTTGAGCAGGCTGAACGACAGCTCTTCCTCCTATTCCAGGCTATTGACAAGGACGGCAACGGCAAGCTGGACATG
AAGGAGCTCCAGACGGCCTTTCGTACGGCGGGCCTGACCGTCTCGAACCGCCGGCTGGCCGACTTCTTCCACGAC
CTGGACCAGAACCACGACGGCTTTGTCACGTTTGACGAATGGCGGTAAGTGGCTGGCGTCATGGGCGCTGCTCAA
TGGCCCTCGTGCTGGTCTGGCCCAAAGACCCCGTCATGTGCTCGCGCGGGTGATATGAGGCGCCACGTCACATTC
ACTTAAGCGACGCACGCGCAGAACCGGTGCCAGTGCCCTGGGAACCGCTGTTGGCCAATCAATCCCTTTGCTGCA
TGCCCTGTCGACGTTTGACACGCTGACGCCGTTTTGAATGTCTTGCACGGCATCAGGAATTTTCTCATCTTCATG
CCGGCGCGCCAATATGATTCACATCTGCGTGCCGCCATATCCTATTACTGCGCCGTCGTCAATGTCACCCCCGAA
GGCGACTCGATTGTGCGTGACGACACTTTACAAGGCTTAGGTACGGGCGACTCCTGCATGCCGTCATCCTCTTGC
TCTCTGCGTCGCTCCCTCTTTGGCGCTCTTATCCGCCTCGCGTCTCCTTGGCCGCCGTCGACAAGCCCGCCGCCT
GCACCGTCACTGCCTGCCCCTTGTCCTGTCGCCGATGGGCATCAAGAAGCATTGTTTGCTCATGCCAAGCCCATG
GAGGCCATGGAAGCGGCTGTGCAGCCCGTGGCAGGCGCTCGACGACCCAAGCGCTACAGTCAAGACAAACAAGAG
CACGGCGGCGATGGCACCTCAGTCCAACACCCTCAGCAGTCACAGTCTGTAGCCAAAAAGAAGTCCAGACTGACA
AACCTTGTTCCCAATCCAGGTTACTTCCTTGCGGGTGCCATCGCCGGCGGAGTGTCGCGCACTGCCACTGCGCCT
CTTGACCGTCTCAAGGTGTACCTGCTGGTCAACACGCGCAACAGCTCCGAGACTGCAGCTACTGCACTTAAGCAG
GGCCGTCCAATAGACGCTGTGAAAAACGCGCTGCGACCATTCAAAGATGCCGTCAGTGACTTATACCGCTCGGGC
GGCATTCGTAGTTTTTTTGCTGGTCAGCCGGCACTCTTTTCTCCCTCGACGACAAGGTCCTCCAGTAACTGACAA
GGATGGCTTTACAGGCAACGGCCTCAACATTGTCAAGATTATGCCCGAGACGGCCATAAAGTTTGGATCGTACGA
GGCGGTAAAGCGCGCACTGGCCAACCTGGAGGGGCACGGCGACCCCAACCACATCAGCTCTTACTCAAAGTTTAC
TGCCGGAGGCCTGGCTGGCATGATTGCACAGTAAGCAGCTTCCTGGTTGCTTGTCCATGTAGTGGCCAAGGCGGC
TGACGGCGACTAGATTTTGCGTGTACCCGGTCGACACGCTCAAGTTTCGTCTGCAATGCGAGACGGTCAAGGGCG
GTCTTACTGGAGGCGCGCTCGTGCGCCAGACGGCTGCCAAGATGTATGCCGATGGCGGCCTACGGGCCTGCTATC
GCGGGGTGACGATGGGCTTGGTGGGCATGTTCCCCTACAGTGCCATTGACATGGGCATGTTTGAGTTTCTAAAGA
CAAGTTACCGCACCTATCACGCCCGTCTGGCCGGTTGTCACGAGGATGACGTGGAGCCAAGCAACATTGCCACTG
GCATGATTGGCGCCACATCGGGTGCCATTGGCGCCACTGTTGTCTACCCTCTCAACGTTGTGCGTACCCGGCTGC
AGACACAGGGCACCGTGATGCATAAGGAGACATACACAGGCATCTGGGATGTGGCGCGCAAGACGATACAGCGCG
AGGGCTATCGCGGCTTCTACAAGGGTCTGACGCCAAATCTCCTCAAGGTGGCTCCCGCTTTGAGCATCACCTGGG
TCGTTTACGAGAACTCGAAGCGAGCCCTGGGACTGCATTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail