Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|6244
Gene name
LocationContig_55:100509..101216
Strand+
Gene length (bp)707
Transcript length (bp)645
Coding sequence length (bp)645
Protein length (aa) 215

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05730 CFEM CFEM domain 5.1E-13 20 86

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|D4B2Q8|CFMB_ARTBC GPI-anchored CFEM domain protein ARB_02741 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02741 PE=1 SV=1 1 68 4.0E-06

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 18 0.45

Transmembrane Domains

Domain # Start End Length
1 190 212 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|6244
MKYATAAIFSLAALVSAQSIADIPSCALPCLMEAIKSNTKCEITDVACVCKNIEAVQGSATTCVLEKCGQDTALN
KVLPAAKALCAGASKPSSPASSAPASSSAPASSAPASSAPASSAPASSAPASSAPASSAHATSAGYPVPVTSATY
AEPSAPATSAASTDCETSAIPSPVVPPHPSGNSTVPKPPVVTAGAAAMAPAGGLALLAFGAMML*
Coding >OphauB2|6244
ATGAAGTACGCCACTGCTGCCATCTTTTCCCTCGCCGCTCTGGTCAGCGCCCAGAGCATCGCCGATATCCCCAGC
TGCGCTCTCCCCTGCCTCATGGAGGCCATCAAGAGCAACACCAAGTGCGAGATTACCGACGTGGCCTGCGTCTGC
AAGAACATTGAAGCCGTCCAGGGCTCAGCCACGACCTGCGTCCTTGAAAAGTGTGGCCAAGACACTGCTCTTAAC
AAGGTCCTCCCTGCGGCCAAGGCCCTCTGCGCAGGCGCCAGCAAGCCTTCATCCCCTGCCTCGTCTGCCCCGGCT
TCTTCCTCTGCCCCGGCCTCGTCTGCCCCAGCCTCGTCTGCTCCGGCTTCGTCTGCTCCGGCTTCCTCTGCTCCG
GCTTCCTCTGCCCCCGCCTCTTCTGCCCACGCCACCTCTGCCGGCTACCCCGTCCCCGTCACCTCGGCCACCTAC
GCCGAGCCCAGCGCCCCCGCCACCTCTGCTGCCAGCACCGACTGCGAGACGTCTGCCATTCCCTCTCCCGTCGTC
CCCCCTCACCCCTCTGGCAACAGCACCGTCCCCAAGCCTCCCGTCGTCACTGCCGGCGCTGCTGCCATGGCTCCT
GCTGGCGGCCTCGCCCTTCTCGCCTTTGGCGCCATGATGCTGTAA
Transcript >OphauB2|6244
ATGAAGTACGCCACTGCTGCCATCTTTTCCCTCGCCGCTCTGGTCAGCGCCCAGAGCATCGCCGATATCCCCAGC
TGCGCTCTCCCCTGCCTCATGGAGGCCATCAAGAGCAACACCAAGTGCGAGATTACCGACGTGGCCTGCGTCTGC
AAGAACATTGAAGCCGTCCAGGGCTCAGCCACGACCTGCGTCCTTGAAAAGTGTGGCCAAGACACTGCTCTTAAC
AAGGTCCTCCCTGCGGCCAAGGCCCTCTGCGCAGGCGCCAGCAAGCCTTCATCCCCTGCCTCGTCTGCCCCGGCT
TCTTCCTCTGCCCCGGCCTCGTCTGCCCCAGCCTCGTCTGCTCCGGCTTCGTCTGCTCCGGCTTCCTCTGCTCCG
GCTTCCTCTGCCCCCGCCTCTTCTGCCCACGCCACCTCTGCCGGCTACCCCGTCCCCGTCACCTCGGCCACCTAC
GCCGAGCCCAGCGCCCCCGCCACCTCTGCTGCCAGCACCGACTGCGAGACGTCTGCCATTCCCTCTCCCGTCGTC
CCCCCTCACCCCTCTGGCAACAGCACCGTCCCCAAGCCTCCCGTCGTCACTGCCGGCGCTGCTGCCATGGCTCCT
GCTGGCGGCCTCGCCCTTCTCGCCTTTGGCGCCATGATGCTGTAA
Gene >OphauB2|6244
ATGAAGTACGCCACTGCTGCCATCTTTTCCCTCGCCGCTCTGGTCAGCGCCCAGAGCATCGCCGATATCCCCAGC
TGCGCTCTCCCCTGCCTCATGGAGGCCATCAAGAGCAACACCAAGTGCGAGATTACCGACGTGGCCTGCGTCTGC
AAGAACATTGAAGCCGTCCAGGGCTCAGCCACGACCTGCGTCCTTGAAAAGTGTGGCCAAGACACTGCTCTTAGT
ATGTCTCCCCCTTTTCGTCATGGATGCCTACCTCTTGATCATGTCCTAATCTTGCTACAGACAAGGTCCTCCCTG
CGGCCAAGGCCCTCTGCGCAGGCGCCAGCAAGCCTTCATCCCCTGCCTCGTCTGCCCCGGCTTCTTCCTCTGCCC
CGGCCTCGTCTGCCCCAGCCTCGTCTGCTCCGGCTTCGTCTGCTCCGGCTTCCTCTGCTCCGGCTTCCTCTGCCC
CCGCCTCTTCTGCCCACGCCACCTCTGCCGGCTACCCCGTCCCCGTCACCTCGGCCACCTACGCCGAGCCCAGCG
CCCCCGCCACCTCTGCTGCCAGCACCGACTGCGAGACGTCTGCCATTCCCTCTCCCGTCGTCCCCCCTCACCCCT
CTGGCAACAGCACCGTCCCCAAGCCTCCCGTCGTCACTGCCGGCGCTGCTGCCATGGCTCCTGCTGGCGGCCTCG
CCCTTCTCGCCTTTGGCGCCATGATGCTGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail