Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|6240
Gene name
LocationContig_55:88519..89872
Strand+
Gene length (bp)1353
Transcript length (bp)1353
Coding sequence length (bp)1353
Protein length (aa) 451

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF20143 NAD_kinase_C ATP-NAD kinase C-terminal domain 7.2E-22 279 394
PF01513 NAD_kinase ATP-NAD kinase N-terminal domain 1.6E-12 136 195

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UT98|POS5_SCHPO NADH kinase pos5, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pos5 PE=3 SV=2 69 440 1.0E-54
sp|Q06892|POS5_YEAST NADH kinase POS5, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=POS5 PE=1 SV=2 62 438 6.0E-52
sp|Q9C5W3|NADK2_ARATH NAD kinase 2, chloroplastic OS=Arabidopsis thaliana GN=NADK2 PE=1 SV=1 52 394 2.0E-37
sp|Q53NI2|NADK2_ORYSJ Probable NAD kinase 2, chloroplastic OS=Oryza sativa subsp. japonica GN=Os11g0191400 PE=2 SV=1 52 395 6.0E-36
sp|Q60E60|NADK3_ORYSJ Putative NAD kinase 3 OS=Oryza sativa subsp. japonica GN=Os05g0388400 PE=3 SV=2 63 389 9.0E-34
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UT98|POS5_SCHPO NADH kinase pos5, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pos5 PE=3 SV=2 69 440 1.0E-54
sp|Q06892|POS5_YEAST NADH kinase POS5, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=POS5 PE=1 SV=2 62 438 6.0E-52
sp|Q9C5W3|NADK2_ARATH NAD kinase 2, chloroplastic OS=Arabidopsis thaliana GN=NADK2 PE=1 SV=1 52 394 2.0E-37
sp|Q53NI2|NADK2_ORYSJ Probable NAD kinase 2, chloroplastic OS=Oryza sativa subsp. japonica GN=Os11g0191400 PE=2 SV=1 52 395 6.0E-36
sp|Q60E60|NADK3_ORYSJ Putative NAD kinase 3 OS=Oryza sativa subsp. japonica GN=Os05g0388400 PE=3 SV=2 63 389 9.0E-34
sp|Q56YN3|NADK1_ARATH NAD(H) kinase 1 OS=Arabidopsis thaliana GN=NADK1 PE=1 SV=2 63 389 5.0E-32
sp|Q5JK52|NADK1_ORYSJ Probable NAD kinase 1 OS=Oryza sativa subsp. japonica GN=Os01g0957000 PE=2 SV=1 69 381 2.0E-30
sp|P32622|YEF1_YEAST ATP-NADH kinase YEF1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YEF1 PE=1 SV=1 141 396 3.0E-30
sp|P21373|UTR1_YEAST NAD(+) kinase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UTR1 PE=1 SV=2 141 394 3.0E-26
sp|P58058|NADK_MOUSE NAD kinase OS=Mus musculus GN=Nadk PE=1 SV=2 27 448 8.0E-26
sp|B0K0V4|NADK_THEPX NAD kinase OS=Thermoanaerobacter sp. (strain X514) GN=nadK PE=3 SV=1 112 386 1.0E-25
sp|B0K9E7|NADK_THEP3 NAD kinase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=nadK PE=3 SV=1 112 386 1.0E-25
sp|O95544|NADK_HUMAN NAD kinase OS=Homo sapiens GN=NADK PE=1 SV=1 27 394 7.0E-25
sp|A0L8H9|NADK_MAGMM NAD kinase OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) GN=nadK PE=3 SV=1 80 394 3.0E-23
sp|A5FJ93|NADK_FLAJ1 NAD kinase OS=Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / UW101) GN=nadK PE=3 SV=1 106 381 3.0E-23
sp|Q8RAC3|NADK_CALS4 NAD kinase OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=nadK PE=3 SV=1 112 382 1.0E-22
sp|Q2RIC1|NADK_MOOTA NAD kinase OS=Moorella thermoacetica (strain ATCC 39073) GN=nadK PE=3 SV=1 75 395 5.0E-22
sp|A9KMB6|NADK_CLOPH NAD kinase OS=Clostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) GN=nadK PE=3 SV=1 140 380 5.0E-22
sp|Q6LA56|YF4B_SCHPO Uncharacterized kinase C3H5.11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC3H5.11 PE=3 SV=1 137 412 6.0E-21
sp|Q7V3C2|NADK1_PROMP NAD kinase 1 OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=nadK1 PE=3 SV=1 141 395 1.0E-20
sp|A5N7J4|NADK_CLOK5 NAD kinase OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680) GN=nadK PE=3 SV=1 137 395 1.0E-20
sp|B9E106|NADK_CLOK1 NAD kinase OS=Clostridium kluyveri (strain NBRC 12016) GN=nadK PE=3 SV=1 137 395 1.0E-20
sp|B3E6Y9|NADK_GEOLS NAD kinase OS=Geobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) GN=nadK PE=3 SV=1 135 395 8.0E-20
sp|O67055|NADK_AQUAE NAD kinase OS=Aquifex aeolicus (strain VF5) GN=nadK PE=3 SV=1 141 392 8.0E-20
sp|A5IHZ7|NADK_LEGPC NAD kinase OS=Legionella pneumophila (strain Corby) GN=nadK PE=3 SV=1 136 396 1.0E-19
sp|A8ZWQ4|NADK_DESOH NAD kinase OS=Desulfococcus oleovorans (strain DSM 6200 / Hxd3) GN=nadK PE=3 SV=1 143 395 2.0E-19
sp|Q8A0V4|NADK_BACTN NAD kinase OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=nadK PE=3 SV=1 112 380 2.0E-19
sp|Q4FRP5|NADK_PSYA2 NAD kinase OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=nadK PE=3 SV=2 136 381 3.0E-19
sp|C4ZCY4|NADK_EUBR3 NAD kinase OS=Eubacterium rectale (strain ATCC 33656 / VPI 0990) GN=nadK PE=3 SV=1 129 389 4.0E-19
sp|Q73MB8|NADK_TREDE NAD kinase OS=Treponema denticola (strain ATCC 35405 / CIP 103919 / DSM 14222) GN=nadK PE=3 SV=1 276 395 7.0E-19
sp|Q5WSY8|NADK_LEGPL NAD kinase OS=Legionella pneumophila (strain Lens) GN=nadK PE=3 SV=1 136 396 7.0E-19
sp|Q5ZRQ7|NADK_LEGPH NAD kinase OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=nadK PE=3 SV=1 136 396 9.0E-19
sp|Q5X168|NADK_LEGPA NAD kinase OS=Legionella pneumophila (strain Paris) GN=nadK PE=3 SV=1 136 396 9.0E-19
sp|Q47NA3|NADK_THEFY NAD kinase OS=Thermobifida fusca (strain YX) GN=nadK PE=3 SV=1 76 395 1.0E-18
sp|C1A482|NADK_GEMAT NAD kinase OS=Gemmatimonas aurantiaca (strain T-27 / DSM 14586 / JCM 11422 / NBRC 100505) GN=nadK PE=3 SV=1 129 381 1.0E-18
sp|Q8Z074|NADK2_NOSS1 NAD kinase 2 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=nadK2 PE=3 SV=1 125 363 2.0E-18
sp|Q3M9K5|NADK2_ANAVT NAD kinase 2 OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=nadK2 PE=3 SV=1 125 363 2.0E-18
sp|O13863|YDU2_SCHPO Uncharacterized kinase C1B1.02c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1B1.02c PE=1 SV=1 141 408 2.0E-18
sp|B0TEJ8|NADK_HELMI NAD kinase OS=Heliobacterium modesticaldum (strain ATCC 51547 / Ice1) GN=nadK PE=3 SV=1 139 381 3.0E-18
sp|Q1ISV1|NADK_KORVE NAD kinase OS=Koribacter versatilis (strain Ellin345) GN=nadK PE=3 SV=1 145 392 3.0E-18
sp|C5A3H8|NADK_THEGJ NAD kinase OS=Thermococcus gammatolerans (strain DSM 15229 / JCM 11827 / EJ3) GN=nadK PE=3 SV=1 116 395 5.0E-18
sp|Q87RX6|NADK_VIBPA NAD kinase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=nadK PE=3 SV=1 134 394 6.0E-18
sp|A7MWW3|NADK_VIBCB NAD kinase OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=nadK PE=3 SV=1 134 394 6.0E-18
sp|B3QYG7|NADK_CHLT3 NAD kinase OS=Chloroherpeton thalassium (strain ATCC 35110 / GB-78) GN=nadK PE=3 SV=1 135 394 6.0E-18
sp|Q30RL8|NADK_SULDN NAD kinase OS=Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251) GN=nadK PE=3 SV=1 104 394 8.0E-18
sp|Q894H2|NADK_CLOTE NAD kinase OS=Clostridium tetani (strain Massachusetts / E88) GN=nadK PE=3 SV=1 137 382 8.0E-18
sp|A4SQ27|NADK_AERS4 NAD kinase OS=Aeromonas salmonicida (strain A449) GN=nadK PE=3 SV=1 115 394 8.0E-18
sp|B5EFY8|NADK_GEOBB NAD kinase OS=Geobacter bemidjiensis (strain Bem / ATCC BAA-1014 / DSM 16622) GN=nadK PE=3 SV=1 111 395 9.0E-18
sp|A4IWQ8|NADK_FRATW NAD kinase OS=Francisella tularensis subsp. tularensis (strain WY96-3418) GN=nadK PE=3 SV=1 134 394 1.0E-17
sp|Q5NF19|NADK_FRATT NAD kinase OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=nadK PE=3 SV=1 134 394 1.0E-17
sp|Q14GH2|NADK_FRAT1 NAD kinase OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=nadK PE=3 SV=1 134 394 1.0E-17
sp|B9M5P5|NADK_GEODF NAD kinase OS=Geobacter daltonii (strain DSM 22248 / JCM 15807 / FRC-32) GN=nadK PE=3 SV=1 138 395 1.0E-17
sp|A0LXV8|NADK_GRAFK NAD kinase OS=Gramella forsetii (strain KT0803) GN=nadK PE=3 SV=1 263 394 2.0E-17
sp|B2SDS9|NADK_FRATM NAD kinase OS=Francisella tularensis subsp. mediasiatica (strain FSC147) GN=nadK PE=3 SV=1 134 394 2.0E-17
sp|P73955|NADK2_SYNY3 NAD kinase 2 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=nadK2 PE=3 SV=1 125 363 2.0E-17
sp|A6LU50|NADK_CLOB8 NAD kinase OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=nadK PE=3 SV=1 140 390 3.0E-17
sp|B2RIJ4|NADK_PORG3 NAD kinase OS=Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / JCM 12257) GN=nadK PE=3 SV=1 109 381 3.0E-17
sp|Q7MN93|NADK_VIBVY NAD kinase OS=Vibrio vulnificus (strain YJ016) GN=nadK PE=3 SV=1 134 394 4.0E-17
sp|Q8DF58|NADK_VIBVU NAD kinase OS=Vibrio vulnificus (strain CMCP6) GN=nadK PE=3 SV=1 134 394 5.0E-17
sp|Q51841|NADK_PORGI NAD kinase OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) GN=nadK PE=3 SV=2 109 381 6.0E-17
sp|B9LAP2|NADK_CHLSY NAD kinase OS=Chloroflexus aurantiacus (strain ATCC 29364 / DSM 637 / Y-400-fl) GN=nadK PE=3 SV=1 136 394 6.0E-17
sp|A9WIJ8|NADK_CHLAA NAD kinase OS=Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl) GN=nadK PE=3 SV=1 136 394 6.0E-17
sp|B2SXB6|NADK_BURPP NAD kinase OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=nadK PE=3 SV=1 134 393 6.0E-17
sp|B6J7V3|NADK_COXB1 NAD kinase OS=Coxiella burnetii (strain CbuK_Q154) GN=nadK PE=3 SV=1 135 392 7.0E-17
sp|Q83C38|NADK_COXBU NAD kinase OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=nadK PE=3 SV=1 135 392 8.0E-17
sp|A9KG94|NADK_COXBN NAD kinase OS=Coxiella burnetii (strain Dugway 5J108-111) GN=nadK PE=3 SV=1 135 392 8.0E-17
sp|B6IZI4|NADK_COXB2 NAD kinase OS=Coxiella burnetii (strain CbuG_Q212) GN=nadK PE=3 SV=1 135 392 8.0E-17
sp|C3KXC0|NADK_CLOB6 NAD kinase OS=Clostridium botulinum (strain 657 / Type Ba4) GN=nadK PE=3 SV=1 137 382 8.0E-17
sp|B3PJ64|NADK_CELJU NAD kinase OS=Cellvibrio japonicus (strain Ueda107) GN=nadK PE=3 SV=1 277 394 8.0E-17
sp|Q67NC1|NADK_SYMTH NAD kinase OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=nadK PE=3 SV=1 80 395 9.0E-17
sp|A7GEJ1|NADK_CLOBL NAD kinase OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=nadK PE=3 SV=1 137 382 9.0E-17
sp|B1IMN2|NADK_CLOBK NAD kinase OS=Clostridium botulinum (strain Okra / Type B1) GN=nadK PE=3 SV=1 137 382 9.0E-17
sp|A7FUT5|NADK_CLOB1 NAD kinase OS=Clostridium botulinum (strain ATCC 19397 / Type A) GN=nadK PE=3 SV=1 137 382 9.0E-17
sp|C6A5J6|NADK_THESM NAD kinase OS=Thermococcus sibiricus (strain MM 739 / DSM 12597) GN=nadK PE=3 SV=1 123 395 9.0E-17
sp|Q39X41|NADK_GEOMG NAD kinase OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=nadK PE=3 SV=1 141 394 1.0E-16
sp|C1FPA6|NADK_CLOBJ NAD kinase OS=Clostridium botulinum (strain Kyoto / Type A2) GN=nadK PE=3 SV=1 137 382 1.0E-16
sp|C4L8Y7|NADK_TOLAT NAD kinase OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=nadK PE=3 SV=1 73 394 1.0E-16
sp|A0Q7Q7|NADK_FRATN NAD kinase OS=Francisella tularensis subsp. novicida (strain U112) GN=nadK PE=3 SV=1 134 394 1.0E-16
sp|Q0BMU7|NADK_FRATO NAD kinase OS=Francisella tularensis subsp. holarctica (strain OSU18) GN=nadK PE=3 SV=1 134 394 1.0E-16
sp|Q2A4H0|NADK_FRATH NAD kinase OS=Francisella tularensis subsp. holarctica (strain LVS) GN=nadK PE=3 SV=1 134 394 1.0E-16
sp|A7NAY2|NADK_FRATF NAD kinase OS=Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA) GN=nadK PE=3 SV=1 134 394 1.0E-16
sp|Q8RR32|NADK2_THEEB NAD kinase 2 OS=Thermosynechococcus elongatus (strain BP-1) GN=nadK2 PE=3 SV=1 125 363 1.0E-16
sp|Q145F7|NADK_BURXL NAD kinase OS=Burkholderia xenovorans (strain LB400) GN=nadK PE=3 SV=1 134 393 1.0E-16
sp|Q5L911|NADK_BACFN NAD kinase OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343) GN=nadK PE=3 SV=1 277 390 2.0E-16
sp|Q64P72|NADK_BACFR NAD kinase OS=Bacteroides fragilis (strain YCH46) GN=nadK PE=3 SV=1 277 390 2.0E-16
sp|Q6LX63|NPPNK_METMP Bifunctional NADP phosphatase/NAD kinase OS=Methanococcus maripaludis (strain S2 / LL) GN=MMP1489 PE=3 SV=1 59 392 2.0E-16
sp|Q46HL7|NADK2_PROMT NAD kinase 2 OS=Prochlorococcus marinus (strain NATL2A) GN=nadK2 PE=3 SV=1 101 364 2.0E-16
sp|A6H1D1|NADK_FLAPJ NAD kinase OS=Flavobacterium psychrophilum (strain JIP02/86 / ATCC 49511) GN=nadK PE=3 SV=1 277 381 2.0E-16
sp|B8G9X9|NADK_CHLAD NAD kinase OS=Chloroflexus aggregans (strain MD-66 / DSM 9485) GN=nadK PE=3 SV=1 135 394 3.0E-16
sp|B1KT47|NADK_CLOBM NAD kinase OS=Clostridium botulinum (strain Loch Maree / Type A3) GN=nadK PE=3 SV=1 137 382 4.0E-16
sp|Q9P7K3|YJN2_SCHPO Uncharacterized kinase C24B10.02c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC24B10.02c PE=1 SV=1 141 394 4.0E-16
sp|Q7UWB8|NADK_RHOBA NAD kinase OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=nadK PE=3 SV=1 138 395 5.0E-16
sp|B8I3A3|NADK_CLOCE NAD kinase OS=Clostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) GN=nadK PE=3 SV=1 134 394 6.0E-16
sp|Q11PL9|NADK_CYTH3 NAD kinase OS=Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469) GN=nadK PE=3 SV=1 110 381 7.0E-16
sp|Q6AL12|NADK_DESPS NAD kinase OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=nadK PE=3 SV=1 277 394 7.0E-16
sp|Q6MDK7|NADK_PARUW NAD kinase OS=Protochlamydia amoebophila (strain UWE25) GN=nadK PE=3 SV=1 138 364 8.0E-16
sp|A9N8H8|NADK_COXBR NAD kinase OS=Coxiella burnetii (strain RSA 331 / Henzerling II) GN=nadK PE=3 SV=1 135 392 9.0E-16
sp|A4XKP6|NADK_CALS8 NAD kinase OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) GN=nadK PE=3 SV=1 137 389 1.0E-15
sp|Q3A241|NADK_PELCD NAD kinase OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=nadK PE=3 SV=1 134 394 1.0E-15
sp|B2JGE9|NADK_BURP8 NAD kinase OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=nadK PE=3 SV=1 134 365 1.0E-15
sp|Q97HD7|NADK_CLOAB NAD kinase OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=nadK PE=3 SV=1 141 382 2.0E-15
sp|Q74BH6|NADK_GEOSL NAD kinase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=nadK PE=3 SV=1 141 394 2.0E-15
sp|Q1QXZ6|NADK_CHRSD NAD kinase OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=nadK PE=3 SV=1 73 371 2.0E-15
sp|A4J3G3|NADK_DESRM NAD kinase OS=Desulfotomaculum reducens (strain MI-1) GN=nadK PE=3 SV=1 135 395 2.0E-15
sp|Q7MR67|NADK_WOLSU NAD kinase OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=nadK PE=3 SV=1 136 395 3.0E-15
sp|Q3AAN2|NADK_CARHZ NAD kinase OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=nadK PE=3 SV=1 276 395 4.0E-15
sp|A1U2D4|NADK_MARHV NAD kinase OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=nadK PE=3 SV=1 75 395 4.0E-15
sp|O58801|NADK_PYRHO NAD kinase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=nadK PE=1 SV=1 125 394 4.0E-15
sp|B4SGW9|NADK_PELPB NAD kinase OS=Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1) GN=nadK PE=3 SV=1 114 365 5.0E-15
sp|C6E6I5|NADK_GEOSM NAD kinase OS=Geobacter sp. (strain M21) GN=nadK PE=3 SV=1 111 395 5.0E-15
sp|Q6A7W9|NADK_PROAC NAD kinase OS=Propionibacterium acnes (strain KPA171202 / DSM 16379) GN=nadK PE=3 SV=1 136 394 5.0E-15
sp|A7H4H1|NADK_CAMJD NAD kinase OS=Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97) GN=nadK PE=3 SV=1 111 394 7.0E-15
sp|B2A524|NADK_NATTJ NAD kinase OS=Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF) GN=nadK PE=3 SV=1 136 394 8.0E-15
sp|Q82UK6|NADK_NITEU NAD kinase OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=nadK PE=3 SV=1 75 365 9.0E-15
sp|Q47HJ4|NADK_DECAR NAD kinase OS=Dechloromonas aromatica (strain RCB) GN=nadK PE=3 SV=1 73 394 1.0E-14
sp|Q58327|NPPNK_METJA Bifunctional NADP phosphatase/NAD kinase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0917 PE=1 SV=2 147 377 1.0E-14
sp|Q5JEW5|NADK_THEKO NAD kinase OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=nadK PE=3 SV=1 277 394 1.0E-14
sp|A4SGU4|NADK_CHLPM NAD kinase OS=Chlorobium phaeovibrioides (strain DSM 265 / 1930) GN=nadK PE=3 SV=1 136 365 1.0E-14
sp|Q5YY98|NADK_NOCFA NAD kinase OS=Nocardia farcinica (strain IFM 10152) GN=nadK PE=3 SV=1 127 392 1.0E-14
sp|C3LTA3|NADK_VIBCM NAD kinase OS=Vibrio cholerae serotype O1 (strain M66-2) GN=nadK PE=3 SV=1 135 394 1.0E-14
sp|Q9KTP8|NADK_VIBCH NAD kinase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=nadK PE=3 SV=1 135 394 1.0E-14
sp|A5F368|NADK_VIBC3 NAD kinase OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=nadK PE=3 SV=1 135 394 1.0E-14
sp|Q8TXD2|NADK_METKA NAD kinase OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=nadK PE=3 SV=1 119 386 2.0E-14
sp|A6VXA6|NADK_MARMS NAD kinase OS=Marinomonas sp. (strain MWYL1) GN=nadK PE=3 SV=1 75 394 2.0E-14
sp|Q5MZV1|NADK2_SYNP6 NAD kinase 2 OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=nadK2 PE=3 SV=1 125 394 2.0E-14
sp|B3EI21|NADK_CHLL2 NAD kinase OS=Chlorobium limicola (strain DSM 245 / NBRC 103803) GN=nadK PE=3 SV=1 136 381 2.0E-14
sp|Q83GX6|NADK_TROWT NAD kinase OS=Tropheryma whipplei (strain Twist) GN=nadK PE=3 SV=1 277 392 2.0E-14
sp|Q6MII5|NADK_BDEBA NAD kinase OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=nadK PE=3 SV=1 277 395 2.0E-14
sp|B8FN99|NADK_DESAA NAD kinase OS=Desulfatibacillum alkenivorans (strain AK-01) GN=nadK PE=3 SV=1 143 395 2.0E-14
sp|Q5E3A4|NADK_VIBF1 NAD kinase OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=nadK PE=3 SV=1 277 394 2.0E-14
sp|Q83IC3|NADK_TROW8 NAD kinase OS=Tropheryma whipplei (strain TW08/27) GN=nadK PE=3 SV=1 277 392 2.0E-14
sp|Q39JD3|NADK_BURL3 NAD kinase OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=nadK PE=3 SV=1 80 393 2.0E-14
sp|Q607A2|NADK_METCA NAD kinase OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=nadK PE=3 SV=1 71 367 2.0E-14
sp|Q473L9|NADK_CUPPJ NAD kinase OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=nadK PE=3 SV=2 125 366 2.0E-14
sp|A8FL62|NADK_CAMJ8 NAD kinase OS=Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828) GN=nadK PE=3 SV=1 111 394 2.0E-14
sp|A1VZ01|NADK_CAMJJ NAD kinase OS=Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176) GN=nadK PE=3 SV=1 111 394 3.0E-14
sp|Q6FA87|NADK_ACIAD NAD kinase OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=nadK PE=3 SV=1 277 394 3.0E-14
sp|Q3JP04|NADK_BURP1 NAD kinase OS=Burkholderia pseudomallei (strain 1710b) GN=nadK PE=3 SV=2 134 393 3.0E-14
sp|Q63R41|NADK_BURPS NAD kinase OS=Burkholderia pseudomallei (strain K96243) GN=nadK PE=3 SV=1 134 393 3.0E-14
sp|Q8TKQ5|NADK_METAC NAD kinase OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=nadK PE=3 SV=1 277 382 3.0E-14
sp|Q0AHZ4|NADK_NITEC NAD kinase OS=Nitrosomonas eutropha (strain C91) GN=nadK PE=3 SV=1 136 365 3.0E-14
sp|A4XWI3|NADK_PSEMY NAD kinase OS=Pseudomonas mendocina (strain ymp) GN=nadK PE=3 SV=1 75 367 4.0E-14
sp|Q8U1V2|NADK_PYRFU NAD kinase OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=nadK PE=3 SV=1 125 394 4.0E-14
sp|C5BAK8|NADK_EDWI9 NAD kinase OS=Edwardsiella ictaluri (strain 93-146) GN=nadK PE=3 SV=1 277 395 4.0E-14
sp|Q3SHA5|NADK_THIDA NAD kinase OS=Thiobacillus denitrificans (strain ATCC 25259) GN=nadK PE=3 SV=1 128 395 7.0E-14
sp|C1F1S2|NADK_ACIC5 NAD kinase OS=Acidobacterium capsulatum (strain ATCC 51196 / DSM 11244 / JCM 7670 / NBRC 15755 / NCIMB 13165 / 161) GN=nadK PE=3 SV=1 276 392 7.0E-14
sp|Q6AGG7|NADK_LEIXX NAD kinase OS=Leifsonia xyli subsp. xyli (strain CTCB07) GN=nadK PE=3 SV=1 139 395 8.0E-14
sp|Q3B189|NADK_CHLL7 NAD kinase OS=Chlorobium luteolum (strain DSM 273 / 2530) GN=nadK PE=3 SV=1 114 365 8.0E-14
sp|A9AGC5|NADK_BURM1 NAD kinase OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=nadK PE=3 SV=1 134 393 8.0E-14
sp|Q0BI26|NADK_BURCM NAD kinase OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=nadK PE=3 SV=1 134 393 9.0E-14
sp|B1YTJ3|NADK_BURA4 NAD kinase OS=Burkholderia ambifaria (strain MC40-6) GN=nadK PE=3 SV=1 134 393 9.0E-14
sp|Q0VQV5|NADK_ALCBS NAD kinase OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=nadK PE=3 SV=1 68 366 1.0E-13
sp|A4JBR4|NADK_BURVG NAD kinase OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=nadK PE=3 SV=1 134 393 1.0E-13
sp|Q82P98|NADK1_STRAW NAD kinase 1 OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=nadK1 PE=3 SV=1 141 381 1.0E-13
sp|Q31D25|NADK1_PROM9 NAD kinase 1 OS=Prochlorococcus marinus (strain MIT 9312) GN=nadK1 PE=3 SV=1 141 386 1.0E-13
sp|B4S665|NADK_PROA2 NAD kinase OS=Prosthecochloris aestuarii (strain DSM 271 / SK 413) GN=nadK PE=3 SV=1 136 365 1.0E-13
sp|B7VJW6|NADK_VIBTL NAD kinase OS=Vibrio tasmaniensis (strain LGP32) GN=nadK PE=3 SV=1 277 394 1.0E-13
sp|Q5HVD0|NADK_CAMJR NAD kinase OS=Campylobacter jejuni (strain RM1221) GN=nadK PE=3 SV=1 111 394 1.0E-13
sp|Q12DZ0|NADK_POLSJ NAD kinase OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=nadK PE=3 SV=1 132 365 2.0E-13
sp|Q7NFK0|NADK2_GLOVI NAD kinase 2 OS=Gloeobacter violaceus (strain PCC 7421) GN=nadK2 PE=3 SV=1 136 392 2.0E-13
sp|A9BP04|NADK_DELAS NAD kinase OS=Delftia acidovorans (strain DSM 14801 / SPH-1) GN=nadK PE=3 SV=1 85 395 2.0E-13
sp|Q7VVX6|NADK_BORPE NAD kinase OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=nadK PE=3 SV=1 145 372 2.0E-13
sp|Q7W513|NADK_BORPA NAD kinase OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=nadK PE=3 SV=1 145 372 2.0E-13
sp|Q7WGH8|NADK_BORBR NAD kinase OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=nadK PE=3 SV=1 145 372 2.0E-13
sp|A7GXF7|NADK_CAMC5 NAD kinase OS=Campylobacter curvus (strain 525.92) GN=nadK PE=3 SV=1 136 392 2.0E-13
sp|Q3IKR4|NADK_PSEHT NAD kinase OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=nadK PE=3 SV=1 134 394 2.0E-13
sp|B3QLE4|NADK_CHLP8 NAD kinase OS=Chlorobaculum parvum (strain NCIB 8327) GN=nadK PE=3 SV=1 243 395 2.0E-13
sp|B3EPT7|NADK_CHLPB NAD kinase OS=Chlorobium phaeobacteroides (strain BS1) GN=nadK PE=3 SV=1 114 382 2.0E-13
sp|A5D2Z8|NADK_PELTS NAD kinase OS=Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI) GN=nadK PE=3 SV=1 135 394 2.0E-13
sp|A1V0T9|NADK_BURMS NAD kinase OS=Burkholderia mallei (strain SAVP1) GN=nadK PE=3 SV=1 134 393 3.0E-13
sp|Q62HC9|NADK_BURMA NAD kinase OS=Burkholderia mallei (strain ATCC 23344) GN=nadK PE=3 SV=1 134 393 3.0E-13
sp|B6YUD7|NADK_THEON NAD kinase OS=Thermococcus onnurineus (strain NA1) GN=nadK PE=3 SV=1 277 394 3.0E-13
sp|Q4ZVT9|NADK_PSEU2 NAD kinase OS=Pseudomonas syringae pv. syringae (strain B728a) GN=nadK PE=3 SV=1 75 366 4.0E-13
sp|Q8XW25|NADK_RALSO NAD kinase OS=Ralstonia solanacearum (strain GMI1000) GN=nadK PE=3 SV=1 136 366 4.0E-13
sp|A1K8P2|NADK_AZOSB NAD kinase OS=Azoarcus sp. (strain BH72) GN=nadK PE=3 SV=1 75 388 4.0E-13
sp|B1JW12|NADK_BURCC NAD kinase OS=Burkholderia cenocepacia (strain MC0-3) GN=nadK PE=3 SV=1 134 393 4.0E-13
sp|B1KQZ0|NADK_SHEWM NAD kinase OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=nadK PE=3 SV=1 277 394 4.0E-13
sp|B4EDZ8|NADK_BURCJ NAD kinase OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=nadK PE=3 SV=1 134 393 4.0E-13
sp|Q21XX2|NADK_RHOFT NAD kinase OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=nadK PE=3 SV=1 256 395 5.0E-13
sp|Q2SZ01|NADK_BURTA NAD kinase OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=nadK PE=3 SV=1 277 393 5.0E-13
sp|C4Z0G9|NADK_EUBE2 NAD kinase OS=Eubacterium eligens (strain ATCC 27750 / VPI C15-48) GN=nadK PE=3 SV=1 141 371 5.0E-13
sp|A0K4S0|NADK_BURCH NAD kinase OS=Burkholderia cenocepacia (strain HI2424) GN=nadK PE=3 SV=1 134 393 5.0E-13
sp|Q1BYY1|NADK_BURCA NAD kinase OS=Burkholderia cenocepacia (strain AU 1054) GN=nadK PE=3 SV=1 134 393 5.0E-13
sp|Q49897|NADK_MYCLE NAD kinase OS=Mycobacterium leprae (strain TN) GN=nadK PE=3 SV=1 123 382 6.0E-13
sp|B8ZRH2|NADK_MYCLB NAD kinase OS=Mycobacterium leprae (strain Br4923) GN=nadK PE=3 SV=1 123 382 6.0E-13
sp|Q8PTD1|NADK_METMA NAD kinase OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=nadK PE=3 SV=1 277 382 6.0E-13
sp|Q6LUA9|NADK_PHOPR NAD kinase OS=Photobacterium profundum GN=nadK PE=3 SV=1 277 394 6.0E-13
sp|B1J554|NADK_PSEPW NAD kinase OS=Pseudomonas putida (strain W619) GN=nadK PE=3 SV=1 75 366 7.0E-13
sp|Q12L24|NADK_SHEDO NAD kinase OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=nadK PE=3 SV=1 277 394 7.0E-13
sp|B8CS28|NADK_SHEPW NAD kinase OS=Shewanella piezotolerans (strain WP3 / JCM 13877) GN=nadK PE=3 SV=1 270 394 7.0E-13
sp|C4K708|NADK_HAMD5 NAD kinase OS=Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT) GN=nadK PE=3 SV=1 106 394 7.0E-13
sp|Q57L24|NADK_SALCH NAD kinase OS=Salmonella choleraesuis (strain SC-B67) GN=nadK PE=3 SV=2 277 394 8.0E-13
sp|P65774|NADK_SALTY NAD kinase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=nadK PE=1 SV=1 277 394 8.0E-13
sp|P65775|NADK_SALTI NAD kinase OS=Salmonella typhi GN=nadK PE=3 SV=1 277 394 8.0E-13
sp|B5BEA1|NADK_SALPK NAD kinase OS=Salmonella paratyphi A (strain AKU_12601) GN=nadK PE=3 SV=1 277 394 8.0E-13
sp|Q5PFG7|NADK_SALPA NAD kinase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=nadK PE=3 SV=1 277 394 8.0E-13
sp|B4T2C0|NADK_SALNS NAD kinase OS=Salmonella newport (strain SL254) GN=nadK PE=3 SV=1 277 394 8.0E-13
sp|B4TE58|NADK_SALHS NAD kinase OS=Salmonella heidelberg (strain SL476) GN=nadK PE=3 SV=1 277 394 8.0E-13
sp|B5F295|NADK_SALA4 NAD kinase OS=Salmonella agona (strain SL483) GN=nadK PE=3 SV=1 277 394 8.0E-13
sp|Q8KG83|NADK_CHLTE NAD kinase OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=nadK PE=3 SV=1 249 395 8.0E-13
sp|Q0TPE0|NADK_CLOP1 NAD kinase OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=nadK PE=3 SV=1 262 394 9.0E-13
sp|B5RD91|NADK_SALG2 NAD kinase OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=nadK PE=3 SV=1 277 394 9.0E-13
sp|B5QUH0|NADK_SALEP NAD kinase OS=Salmonella enteritidis PT4 (strain P125109) GN=nadK PE=3 SV=1 277 394 9.0E-13
sp|B5FS14|NADK_SALDC NAD kinase OS=Salmonella dublin (strain CT_02021853) GN=nadK PE=3 SV=1 277 394 9.0E-13
sp|Q87YK2|NADK_PSESM NAD kinase OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=nadK PE=3 SV=1 75 366 9.0E-13
sp|Q48FT7|NADK_PSE14 NAD kinase OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=nadK PE=3 SV=1 75 366 9.0E-13
sp|Q46AH3|NADK_METBF NAD kinase OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=nadK PE=3 SV=1 277 382 1.0E-12
sp|Q8XJE3|NADK_CLOPE NAD kinase OS=Clostridium perfringens (strain 13 / Type A) GN=nadK PE=3 SV=1 262 394 1.0E-12
sp|A1BJI4|NADK_CHLPD NAD kinase OS=Chlorobium phaeobacteroides (strain DSM 266) GN=nadK PE=3 SV=1 275 365 1.0E-12
sp|Q9RJS6|NADK1_STRCO NAD kinase 1 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=nadK1 PE=3 SV=2 141 381 1.0E-12
sp|Q0SS07|NADK_CLOPS NAD kinase OS=Clostridium perfringens (strain SM101 / Type A) GN=nadK PE=3 SV=1 276 394 1.0E-12
sp|A3QGP1|NADK_SHELP NAD kinase OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=nadK PE=3 SV=1 270 394 1.0E-12
sp|A1WGS0|NADK_VEREI NAD kinase OS=Verminephrobacter eiseniae (strain EF01-2) GN=nadK PE=3 SV=1 262 395 1.0E-12
sp|Q9PHM6|NADK_CAMJE NAD kinase OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=nadK PE=3 SV=1 111 394 1.0E-12
sp|Q7U406|NADK2_SYNPX NAD kinase 2 OS=Synechococcus sp. (strain WH8102) GN=nadK2 PE=3 SV=1 141 356 1.0E-12
sp|A2SL48|NADK_METPP NAD kinase OS=Methylibium petroleiphilum (strain PM1) GN=nadK PE=3 SV=1 277 392 1.0E-12
sp|Q9YD08|NADK_AERPE NAD kinase OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=nadK PE=3 SV=2 290 409 1.0E-12
sp|B0TQ38|NADK_SHEHH NAD kinase OS=Shewanella halifaxensis (strain HAW-EB4) GN=nadK PE=3 SV=1 270 394 2.0E-12
sp|C3K9T0|NADK_PSEFS NAD kinase OS=Pseudomonas fluorescens (strain SBW25) GN=nadK PE=3 SV=1 75 366 2.0E-12
sp|A4WDH9|NADK_ENT38 NAD kinase OS=Enterobacter sp. (strain 638) GN=nadK PE=3 SV=1 277 394 2.0E-12
sp|Q07ZD2|NADK_SHEFN NAD kinase OS=Shewanella frigidimarina (strain NCIMB 400) GN=nadK PE=3 SV=1 277 394 2.0E-12
sp|Q8DKK1|NADK1_THEEB NAD kinase 1 OS=Thermosynechococcus elongatus (strain BP-1) GN=nadK1 PE=3 SV=1 145 381 2.0E-12
sp|B4TS62|NADK_SALSV NAD kinase OS=Salmonella schwarzengrund (strain CVM19633) GN=nadK PE=3 SV=1 277 394 2.0E-12
sp|Q829B4|NADK2_STRAW NAD kinase 2 OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=nadK2 PE=3 SV=1 141 395 2.0E-12
sp|Q30Y32|NADK_DESAG NAD kinase OS=Desulfovibrio alaskensis (strain G20) GN=nadK PE=3 SV=1 277 395 2.0E-12
sp|Q2SDI1|NADK_HAHCH NAD kinase OS=Hahella chejuensis (strain KCTC 2396) GN=nadK PE=3 SV=1 136 394 2.0E-12
sp|Q3IR96|NADK_NATPD NAD kinase OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=nadK PE=3 SV=1 277 381 2.0E-12
sp|B8DKV9|NADK_DESVM NAD kinase OS=Desulfovibrio vulgaris (strain Miyazaki F / DSM 19637) GN=nadK PE=3 SV=1 88 395 2.0E-12
sp|Q3ANS5|NADK_CHLCH NAD kinase OS=Chlorobium chlorochromatii (strain CaD3) GN=nadK PE=3 SV=1 136 365 2.0E-12
sp|Q31XD1|NADK_SHIBS NAD kinase OS=Shigella boydii serotype 4 (strain Sb227) GN=nadK PE=3 SV=1 277 394 2.0E-12
sp|A1TT64|NADK_ACIAC NAD kinase OS=Acidovorax citrulli (strain AAC00-1) GN=nadK PE=3 SV=1 141 395 2.0E-12
sp|A5V6G8|NADK_SPHWW NAD kinase OS=Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273) GN=nadK PE=3 SV=1 138 365 2.0E-12
sp|B1LPC2|NADK_ECOSM NAD kinase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=nadK PE=3 SV=1 277 394 2.0E-12
sp|Q4KBJ2|NADK_PSEF5 NAD kinase OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=nadK PE=3 SV=1 75 366 2.0E-12
sp|Q7VRQ5|NADK_BLOFL NAD kinase OS=Blochmannia floridanus GN=nadK PE=3 SV=1 129 368 2.0E-12
sp|Q3YYM4|NADK_SHISS NAD kinase OS=Shigella sonnei (strain Ss046) GN=nadK PE=3 SV=1 277 394 3.0E-12
sp|P0A7B4|NADK_SHIFL NAD kinase OS=Shigella flexneri GN=nadK PE=3 SV=1 277 394 3.0E-12
sp|Q0T182|NADK_SHIF8 NAD kinase OS=Shigella flexneri serotype 5b (strain 8401) GN=nadK PE=3 SV=1 277 394 3.0E-12
sp|B2TYN7|NADK_SHIB3 NAD kinase OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=nadK PE=3 SV=1 277 394 3.0E-12
sp|Q1R8A9|NADK_ECOUT NAD kinase OS=Escherichia coli (strain UTI89 / UPEC) GN=nadK PE=3 SV=1 277 394 3.0E-12
sp|B6I636|NADK_ECOSE NAD kinase OS=Escherichia coli (strain SE11) GN=nadK PE=3 SV=1 277 394 3.0E-12
sp|B7N6K0|NADK_ECOLU NAD kinase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=nadK PE=3 SV=1 277 394 3.0E-12
sp|P0A7B3|NADK_ECOLI NAD kinase OS=Escherichia coli (strain K12) GN=nadK PE=1 SV=1 277 394 3.0E-12
sp|B1IVL9|NADK_ECOLC NAD kinase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=nadK PE=3 SV=1 277 394 3.0E-12
sp|Q8FEY7|NADK_ECOL6 NAD kinase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=nadK PE=3 SV=1 277 394 3.0E-12
sp|Q0TEM5|NADK_ECOL5 NAD kinase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=nadK PE=3 SV=1 277 394 3.0E-12
sp|A1AEE5|NADK_ECOK1 NAD kinase OS=Escherichia coli O1:K1 / APEC GN=nadK PE=3 SV=1 277 394 3.0E-12
sp|A8A3C1|NADK_ECOHS NAD kinase OS=Escherichia coli O9:H4 (strain HS) GN=nadK PE=3 SV=1 277 394 3.0E-12
sp|B1XBT5|NADK_ECODH NAD kinase OS=Escherichia coli (strain K12 / DH10B) GN=nadK PE=3 SV=1 277 394 3.0E-12
sp|C4ZYN2|NADK_ECOBW NAD kinase OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=nadK PE=3 SV=1 277 394 3.0E-12
sp|B7M984|NADK_ECO8A NAD kinase OS=Escherichia coli O8 (strain IAI1) GN=nadK PE=3 SV=1 277 394 3.0E-12
sp|B7MYQ3|NADK_ECO81 NAD kinase OS=Escherichia coli O81 (strain ED1a) GN=nadK PE=3 SV=1 277 394 3.0E-12
sp|B7LDK3|NADK_ECO55 NAD kinase OS=Escherichia coli (strain 55989 / EAEC) GN=nadK PE=3 SV=1 277 394 3.0E-12
sp|B7MIV2|NADK_ECO45 NAD kinase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=nadK PE=3 SV=1 277 394 3.0E-12
sp|B7UH63|NADK_ECO27 NAD kinase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=nadK PE=3 SV=1 277 394 3.0E-12
sp|A7ZQ55|NADK_ECO24 NAD kinase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=nadK PE=3 SV=1 277 394 3.0E-12
sp|B7NSB3|NADK_ECO7I NAD kinase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=nadK PE=3 SV=1 277 394 3.0E-12
sp|Q8EGS1|NADK_SHEON NAD kinase OS=Shewanella oneidensis (strain MR-1) GN=nadK PE=3 SV=2 126 394 3.0E-12
sp|Q3ZZJ0|NADK_DEHMC NAD kinase OS=Dehalococcoides mccartyi (strain CBDB1) GN=nadK PE=3 SV=1 277 394 3.0E-12
sp|B5Z232|NADK_ECO5E NAD kinase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=nadK PE=3 SV=1 277 394 3.0E-12
sp|P58057|NADK_ECO57 NAD kinase OS=Escherichia coli O157:H7 GN=nadK PE=3 SV=1 277 394 3.0E-12
sp|Q32CX4|NADK_SHIDS NAD kinase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=nadK PE=3 SV=1 277 394 3.0E-12
sp|A3DDM2|NADK_CLOTH NAD kinase OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=nadK PE=3 SV=1 247 393 3.0E-12
sp|A6TCM2|NADK_KLEP7 NAD kinase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=nadK PE=3 SV=1 277 394 3.0E-12
sp|B5XVJ8|NADK_KLEP3 NAD kinase OS=Klebsiella pneumoniae (strain 342) GN=nadK PE=3 SV=1 277 394 3.0E-12
sp|Q9S219|NADK2_STRCO NAD kinase 2 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=nadK2 PE=3 SV=1 141 395 3.0E-12
sp|Q3Z997|NAK_DEHM1 NAD kinase OS=Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195) GN=nadK PE=3 SV=1 268 394 3.0E-12
sp|Q3KE68|NADK_PSEPF NAD kinase OS=Pseudomonas fluorescens (strain Pf0-1) GN=nadK PE=3 SV=1 75 366 3.0E-12
sp|Q7N1U6|NADK_PHOLL NAD kinase OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=nadK PE=3 SV=1 277 395 4.0E-12
sp|A7MHX2|NADK_CROS8 NAD kinase OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=nadK PE=3 SV=1 277 394 4.0E-12
sp|Q2Y6B0|NADK_NITMU NAD kinase OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=nadK PE=3 SV=1 136 355 4.0E-12
sp|Q7V0I8|NADK2_PROMP NAD kinase 2 OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=nadK2 PE=3 SV=1 145 380 4.0E-12
sp|A1WX34|NADK_HALHL NAD kinase OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=nadK PE=3 SV=1 277 368 4.0E-12
sp|A1RLV5|NADK_SHESW NAD kinase OS=Shewanella sp. (strain W3-18-1) GN=nadK PE=3 SV=1 277 394 4.0E-12
sp|A4Y4W8|NADK_SHEPC NAD kinase OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=nadK PE=3 SV=1 277 394 4.0E-12
sp|Q7VE34|NADK1_PROMA NAD kinase 1 OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=nadK1 PE=3 SV=1 142 394 4.0E-12
sp|C1DPY6|NADK_AZOVD NAD kinase OS=Azotobacter vinelandii (strain DJ / ATCC BAA-1303) GN=nadK PE=3 SV=1 277 368 4.0E-12
sp|A1W4H1|NADK_ACISJ NAD kinase OS=Acidovorax sp. (strain JS42) GN=nadK PE=3 SV=1 262 394 5.0E-12
sp|Q0HSW4|NADK_SHESR NAD kinase OS=Shewanella sp. (strain MR-7) GN=nadK PE=3 SV=1 277 394 5.0E-12
sp|Q0HGL3|NADK_SHESM NAD kinase OS=Shewanella sp. (strain MR-4) GN=nadK PE=3 SV=1 277 394 5.0E-12
sp|A0KZB1|NADK_SHESA NAD kinase OS=Shewanella sp. (strain ANA-3) GN=nadK PE=3 SV=1 277 394 5.0E-12
sp|A1VKP7|NADK_POLNA NAD kinase OS=Polaromonas naphthalenivorans (strain CJ2) GN=nadK PE=3 SV=1 132 394 5.0E-12
sp|A5FS02|NAK_DEHMB NAD kinase OS=Dehalococcoides mccartyi (strain ATCC BAA-2100 / JCM 16839 / KCTC 5957 / BAV1) GN=nadK PE=3 SV=1 277 394 5.0E-12
sp|B2TRM3|NADK_CLOBB NAD kinase OS=Clostridium botulinum (strain Eklund 17B / Type B) GN=nadK PE=3 SV=1 269 394 5.0E-12
sp|Q7V4D8|NADK2_PROMM NAD kinase 2 OS=Prochlorococcus marinus (strain MIT 9313) GN=nadK2 PE=3 SV=1 141 356 6.0E-12
sp|A9KTL1|NADK_SHEB9 NAD kinase OS=Shewanella baltica (strain OS195) GN=nadK PE=3 SV=1 277 394 7.0E-12
sp|A6WL02|NADK_SHEB8 NAD kinase OS=Shewanella baltica (strain OS185) GN=nadK PE=3 SV=1 277 394 7.0E-12
sp|A3D2B0|NADK_SHEB5 NAD kinase OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=nadK PE=3 SV=1 277 394 7.0E-12
sp|Q9CNU2|NADK_PASMU NAD kinase OS=Pasteurella multocida (strain Pm70) GN=nadK PE=3 SV=1 277 371 8.0E-12
sp|B9ME57|NADK_ACIET NAD kinase OS=Acidovorax ebreus (strain TPSY) GN=nadK PE=3 SV=1 262 394 9.0E-12
sp|Q7V8H9|NADK1_PROMM NAD kinase 1 OS=Prochlorococcus marinus (strain MIT 9313) GN=nadK1 PE=3 SV=1 145 380 9.0E-12
sp|B2V4R1|NADK_CLOBA NAD kinase OS=Clostridium botulinum (strain Alaska E43 / Type E3) GN=nadK PE=3 SV=1 269 394 9.0E-12
sp|Q8ZH09|NADK_YERPE NAD kinase OS=Yersinia pestis GN=nadK PE=1 SV=1 277 394 1.0E-11
sp|Q66DA9|NADK_YERPS NAD kinase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=nadK PE=3 SV=1 277 394 1.0E-11
sp|Q21JY6|NADK_SACD2 NAD kinase OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=nadK PE=3 SV=1 80 370 1.0E-11
sp|Q9HKH7|NADK_THEAC NAD kinase OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=nadK PE=3 SV=1 128 395 1.0E-11
sp|Q0AZE0|NADK_SYNWW NAD kinase OS=Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen) GN=nadK PE=3 SV=1 278 394 1.0E-11
sp|Q3JBV4|NADK_NITOC NAD kinase OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=nadK PE=3 SV=1 135 394 2.0E-11
sp|P9WHV7|NADK_MYCTU NAD kinase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppnK PE=1 SV=1 123 382 2.0E-11
sp|P9WHV6|NADK_MYCTO NAD kinase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=nadK PE=3 SV=1 123 382 2.0E-11
sp|P0A5S7|NADK_MYCBO NAD kinase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=nadK PE=3 SV=1 123 382 2.0E-11
sp|A1VCX9|NADK_DESVV NAD kinase OS=Desulfovibrio vulgaris subsp. vulgaris (strain DP4) GN=nadK PE=3 SV=1 277 396 2.0E-11
sp|Q72AV2|NADK_DESVH NAD kinase OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=nadK PE=3 SV=1 277 396 2.0E-11
sp|B9MRX9|NADK_CALBD NAD kinase OS=Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / Z-1320) GN=nadK PE=3 SV=1 277 381 2.0E-11
sp|Q319M2|NADK2_PROM9 NAD kinase 2 OS=Prochlorococcus marinus (strain MIT 9312) GN=nadK2 PE=3 SV=1 145 381 2.0E-11
sp|Q9X255|NADK_THEMA NAD kinase OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=NADK PE=1 SV=1 277 356 2.0E-11
sp|Q1MPL4|NADK_LAWIP NAD kinase OS=Lawsonia intracellularis (strain PHE/MN1-00) GN=nadK PE=3 SV=1 277 396 2.0E-11
sp|B1LAU0|NADK_THESQ NAD kinase OS=Thermotoga sp. (strain RQ2) GN=nadK PE=3 SV=1 277 356 2.0E-11
sp|A5ILH3|NADK_THEP1 NAD kinase OS=Thermotoga petrophila (strain RKU-1 / ATCC BAA-488 / DSM 13995) GN=nadK PE=3 SV=1 277 356 2.0E-11
sp|Q31HB0|NADK_THICR NAD kinase OS=Thiomicrospira crunogena (strain XCL-2) GN=nadK PE=3 SV=1 135 364 2.0E-11
sp|C5CYY6|NADK_VARPS NAD kinase OS=Variovorax paradoxus (strain S110) GN=nadK PE=3 SV=1 277 394 2.0E-11
sp|C1D6U5|NADK_LARHH NAD kinase OS=Laribacter hongkongensis (strain HLHK9) GN=nadK PE=3 SV=1 134 355 2.0E-11
sp|Q7NVM0|NADK_CHRVO NAD kinase OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=nadK PE=3 SV=1 135 351 3.0E-11
sp|Q9HZC0|NADK_PSEAE NAD kinase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=nadK PE=3 SV=1 277 367 3.0E-11
sp|Q02PQ1|NADK_PSEAB NAD kinase OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=nadK PE=3 SV=1 277 367 3.0E-11
sp|B7UUY3|NADK_PSEA8 NAD kinase OS=Pseudomonas aeruginosa (strain LESB58) GN=nadK PE=3 SV=1 277 367 3.0E-11
sp|A6V2Y8|NADK_PSEA7 NAD kinase OS=Pseudomonas aeruginosa (strain PA7) GN=nadK PE=3 SV=1 277 367 3.0E-11
sp|B2VEC5|NADK_ERWT9 NAD kinase OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=nadK PE=3 SV=1 269 394 3.0E-11
sp|O30297|NADK_ARCFU NAD kinase OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=nadK PE=1 SV=1 138 363 3.0E-11
sp|A0LG64|NADK_SYNFM NAD kinase OS=Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) GN=nadK PE=3 SV=1 274 381 3.0E-11
sp|B0KFA9|NADK_PSEPG NAD kinase OS=Pseudomonas putida (strain GB-1) GN=nadK PE=3 SV=1 269 366 3.0E-11
sp|P44497|NADK_HAEIN NAD kinase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=nadK PE=1 SV=3 270 371 3.0E-11
sp|Q88LC3|NADK_PSEPK NAD kinase OS=Pseudomonas putida (strain KT2440) GN=nadK PE=3 SV=2 269 366 3.0E-11
sp|A5W6U4|NADK_PSEP1 NAD kinase OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=nadK PE=3 SV=1 269 366 3.0E-11
sp|B9KXL1|NADK_THERP NAD kinase OS=Thermomicrobium roseum (strain ATCC 27502 / DSM 5159 / P-2) GN=nadK PE=3 SV=1 241 394 3.0E-11
sp|Q1ICQ6|NADK_PSEE4 NAD kinase OS=Pseudomonas entomophila (strain L48) GN=nadK PE=3 SV=1 270 366 3.0E-11
sp|B7IE73|NADK_THEAB NAD kinase OS=Thermosipho africanus (strain TCF52B) GN=nadK PE=3 SV=1 309 368 4.0E-11
sp|Q4QPH3|NADK_HAEI8 NAD kinase OS=Haemophilus influenzae (strain 86-028NP) GN=nadK PE=3 SV=2 277 371 4.0E-11
sp|Q02A16|NADK_SOLUE NAD kinase OS=Solibacter usitatus (strain Ellin6076) GN=nadK PE=3 SV=1 138 381 4.0E-11
sp|A8GI41|NADK_SERP5 NAD kinase OS=Serratia proteamaculans (strain 568) GN=nadK PE=3 SV=1 277 394 4.0E-11
sp|Q6D8Y0|NADK_PECAS NAD kinase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=nadK PE=3 SV=1 277 394 4.0E-11
sp|Q2NS01|NADK_SODGM NAD kinase OS=Sodalis glossinidius (strain morsitans) GN=nadK PE=3 SV=1 277 394 5.0E-11
sp|Q661V4|NADK_BORBP NAD kinase OS=Borrelia bavariensis (strain ATCC BAA-2496 / DSM 23469 / PBi) GN=nadK PE=3 SV=1 143 387 5.0E-11
sp|Q17V60|NADK_HELAH NAD kinase OS=Helicobacter acinonychis (strain Sheeba) GN=nadK PE=3 SV=1 274 394 5.0E-11
sp|Q7VKR8|NADK_HAEDU NAD kinase OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=nadK PE=3 SV=2 73 381 5.0E-11
sp|Q6NHF7|NADK_CORDI NAD kinase OS=Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis) GN=nadK PE=3 SV=1 137 367 5.0E-11
sp|O26958|NADK_METTH NAD kinase OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=nadK PE=3 SV=1 277 392 6.0E-11
sp|B2S337|NADK_TREPS NAD kinase OS=Treponema pallidum subsp. pallidum (strain SS14) GN=nadK PE=3 SV=1 262 386 6.0E-11
sp|O83455|NADK_TREPA NAD kinase OS=Treponema pallidum (strain Nichols) GN=nadK PE=3 SV=1 262 386 6.0E-11
sp|Q5QXM6|NADK_IDILO NAD kinase OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=nadK PE=3 SV=1 271 394 7.0E-11
sp|Q740E9|NADK_MYCPA NAD kinase OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=nadK PE=3 SV=1 123 395 7.0E-11
sp|Q2KW92|NADK_BORA1 NAD kinase OS=Bordetella avium (strain 197N) GN=nadK PE=3 SV=1 136 372 7.0E-11
sp|A6LN85|NADK_THEM4 NAD kinase OS=Thermosipho melanesiensis (strain DSM 12029 / CIP 104789 / BI429) GN=nadK PE=3 SV=1 309 366 9.0E-11
sp|C5BL09|NADK_TERTT NAD kinase OS=Teredinibacter turnerae (strain ATCC 39867 / T7901) GN=nadK PE=3 SV=1 136 381 1.0E-10
sp|C1ASY3|NADK_RHOOB NAD kinase OS=Rhodococcus opacus (strain B4) GN=nadK PE=3 SV=1 141 394 1.0E-10
sp|Q3MBU3|NADK1_ANAVT NAD kinase 1 OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=nadK1 PE=3 SV=2 145 381 1.0E-10
sp|Q47XI3|NADK_COLP3 NAD kinase OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=nadK PE=3 SV=1 277 394 1.0E-10
sp|B9KFZ4|NADK_CAMLR NAD kinase OS=Campylobacter lari (strain RM2100 / D67 / ATCC BAA-1060) GN=nadK PE=3 SV=1 291 384 1.0E-10
sp|Q8K9V8|NADK_BUCAP NAD kinase OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=nadK PE=3 SV=1 251 366 1.0E-10
sp|Q7NND8|NADK1_GLOVI NAD kinase 1 OS=Gloeobacter violaceus (strain PCC 7421) GN=nadK1 PE=3 SV=1 293 395 2.0E-10
sp|Q8RGM4|NADK_FUSNN NAD kinase OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=nadK PE=3 SV=1 267 394 2.0E-10
sp|Q8YN19|NADK1_NOSS1 NAD kinase 1 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=nadK1 PE=3 SV=1 145 381 2.0E-10
sp|Q7VGM5|NADK_HELHP NAD kinase OS=Helicobacter hepaticus (strain ATCC 51449 / 3B1) GN=nadK PE=3 SV=1 136 396 2.0E-10
sp|Q9ZJ81|NADK_HELPJ NAD kinase OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=nadK PE=3 SV=2 271 363 2.0E-10
sp|Q9V081|NADK_PYRAB NAD kinase OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=nadK PE=3 SV=1 277 395 2.0E-10
sp|Q5FL98|NADK_LACAC NAD kinase OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) GN=nadK PE=3 SV=1 141 406 3.0E-10
sp|A8YUA3|NADK_LACH4 NAD kinase OS=Lactobacillus helveticus (strain DPC 4571) GN=nadK PE=3 SV=1 141 406 3.0E-10
sp|Q46JK2|NADK1_PROMT NAD kinase 1 OS=Prochlorococcus marinus (strain NATL2A) GN=nadK1 PE=3 SV=1 278 380 3.0E-10
sp|Q979U7|NADK_THEVO NAD kinase OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=nadK PE=3 SV=1 128 395 4.0E-10
sp|Q0SI70|NADK_RHOJR NAD kinase OS=Rhodococcus jostii (strain RHA1) GN=nadK PE=3 SV=1 141 394 5.0E-10
sp|B8GEC2|NADK_METPE NAD kinase OS=Methanosphaerula palustris (strain ATCC BAA-1556 / DSM 19958 / E1-9c) GN=nadK PE=3 SV=1 270 387 5.0E-10
sp|O25944|NADK_HELPY NAD kinase OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=nadK PE=3 SV=1 274 358 5.0E-10
sp|B5Z9F8|NADK_HELPG NAD kinase OS=Helicobacter pylori (strain G27) GN=nadK PE=3 SV=1 274 358 5.0E-10
sp|Q5N133|NADK1_SYNP6 NAD kinase 1 OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=nadK1 PE=3 SV=1 145 381 5.0E-10
sp|B6JP37|NADK_HELP2 NAD kinase OS=Helicobacter pylori (strain P12) GN=nadK PE=3 SV=1 271 386 5.0E-10
sp|B9K824|NADK_THENN NAD kinase OS=Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NS-E) GN=nadK PE=3 SV=1 277 356 6.0E-10
sp|B2UVU0|NADK_HELPS NAD kinase OS=Helicobacter pylori (strain Shi470) GN=nadK PE=3 SV=1 274 358 7.0E-10
sp|Q1CR79|NADK_HELPH NAD kinase OS=Helicobacter pylori (strain HPAG1) GN=nadK PE=3 SV=1 274 358 7.0E-10
sp|B8D789|NADK_BUCAT NAD kinase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7) GN=nadK PE=3 SV=1 277 394 8.0E-10
sp|P57282|NADK_BUCAI NAD kinase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=nadK PE=3 SV=1 277 394 8.0E-10
sp|B8D8Y4|NADK_BUCA5 NAD kinase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A) GN=nadK PE=3 SV=1 277 394 8.0E-10
sp|Q5P1G9|NADK_AROAE NAD kinase OS=Aromatoleum aromaticum (strain EbN1) GN=nadK PE=3 SV=1 128 369 8.0E-10
sp|O51291|NADK_BORBU NAD kinase OS=Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680) GN=nadK PE=3 SV=2 277 387 2.0E-09
sp|A7I809|NADK_METB6 NAD kinase OS=Methanoregula boonei (strain 6A8) GN=nadK PE=3 SV=1 303 395 2.0E-09
sp|B7J4J4|NADK_ACIF2 NAD kinase OS=Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455) GN=nadK PE=3 SV=1 141 394 2.0E-09
sp|Q65UL1|NADK_MANSM NAD kinase OS=Mannheimia succiniciproducens (strain MBEL55E) GN=nadK PE=3 SV=2 277 369 2.0E-09
sp|Q492C6|NADK_BLOPB NAD kinase OS=Blochmannia pennsylvanicus (strain BPEN) GN=nadK PE=3 SV=1 206 366 2.0E-09
sp|Q89AR9|NADK_BUCBP NAD kinase OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=nadK PE=3 SV=1 277 381 2.0E-09
sp|P74430|NADK1_SYNY3 NAD kinase 1 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=nadK1 PE=3 SV=1 136 381 2.0E-09
sp|Q9HNX7|NADK_HALSA NAD kinase OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=nadK PE=3 SV=1 277 382 3.0E-09
sp|B0R6L8|NADK_HALS3 NAD kinase OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=nadK PE=3 SV=1 277 382 3.0E-09
sp|B7GTM7|NADK_BIFLS NAD kinase OS=Bifidobacterium longum subsp. infantis (strain ATCC 15697 / DSM 20088 / JCM 1222 / NCTC 11817 / S12) GN=nadK PE=3 SV=1 277 394 3.0E-09
sp|Q8G5G8|NADK_BIFLO NAD kinase OS=Bifidobacterium longum (strain NCC 2705) GN=nadK PE=3 SV=1 277 394 4.0E-09
sp|B3DSX1|NADK_BIFLD NAD kinase OS=Bifidobacterium longum (strain DJO10A) GN=nadK PE=3 SV=1 277 394 4.0E-09
sp|Q7VAW0|NADK2_PROMA NAD kinase 2 OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=nadK2 PE=3 SV=1 278 355 4.0E-09
sp|Q7U5U5|NADK1_SYNPX NAD kinase 1 OS=Synechococcus sp. (strain WH8102) GN=nadK1 PE=3 SV=1 277 380 6.0E-09
sp|A2SQJ8|NADK_METLZ NAD kinase OS=Methanocorpusculum labreanum (strain ATCC 43576 / DSM 4855 / Z) GN=nadK PE=3 SV=1 277 394 1.0E-08
sp|Q2NEP6|NADK_METST NAD kinase OS=Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3) GN=nadK PE=3 SV=1 277 403 1.0E-08
sp|C1CRK0|NADK_STRZT NAD kinase OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=nadK PE=3 SV=1 275 363 1.0E-08
sp|C1CKG4|NADK_STRZP NAD kinase OS=Streptococcus pneumoniae (strain P1031) GN=nadK PE=3 SV=1 275 363 1.0E-08
sp|P65780|NADK_STRR6 NAD kinase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=nadK PE=3 SV=1 275 363 1.0E-08
sp|P65779|NADK_STRPN NAD kinase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=nadK PE=1 SV=1 275 363 1.0E-08
sp|C1C794|NADK_STRP7 NAD kinase OS=Streptococcus pneumoniae (strain 70585) GN=nadK PE=3 SV=1 275 363 1.0E-08
sp|Q04KI9|NADK_STRP2 NAD kinase OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=nadK PE=3 SV=1 275 363 1.0E-08
sp|C1CE84|NADK_STRZJ NAD kinase OS=Streptococcus pneumoniae (strain JJA) GN=nadK PE=3 SV=1 275 363 1.0E-08
sp|B8ZPU4|NADK_STRPJ NAD kinase OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=nadK PE=3 SV=1 275 363 1.0E-08
sp|B1IBN7|NADK_STRPI NAD kinase OS=Streptococcus pneumoniae (strain Hungary19A-6) GN=nadK PE=3 SV=1 275 363 1.0E-08
sp|A7HWM6|NADK_PARL1 NAD kinase OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=nadK PE=3 SV=1 133 344 1.0E-08
sp|B5E4L2|NADK_STRP4 NAD kinase OS=Streptococcus pneumoniae serotype 19F (strain G54) GN=nadK PE=3 SV=1 275 363 1.0E-08
sp|Q9ZDA2|NADK_RICPR NAD kinase OS=Rickettsia prowazekii (strain Madrid E) GN=nadK PE=3 SV=1 277 348 1.0E-08
sp|Q03EW6|NADK_PEDPA NAD kinase OS=Pediococcus pentosaceus (strain ATCC 25745 / 183-1w) GN=nadK PE=3 SV=1 137 367 2.0E-08
sp|A9BHU3|NADK_PETMO NAD kinase OS=Petrotoga mobilis (strain DSM 10674 / SJ95) GN=nadK PE=3 SV=1 294 356 2.0E-08
sp|B9LPF8|NADK_HALLT NAD kinase OS=Halorubrum lacusprofundi (strain ATCC 49239 / DSM 5036 / JCM 8891 / ACAM 34) GN=nadK PE=3 SV=1 299 395 3.0E-08
sp|Q68WT8|NADK_RICTY NAD kinase OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=nadK PE=3 SV=1 277 348 3.0E-08
sp|Q2FQ95|NADK_METHJ NAD kinase OS=Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1) GN=nadK PE=3 SV=1 299 403 3.0E-08
sp|B4RK90|NADK_NEIG2 NAD kinase OS=Neisseria gonorrhoeae (strain NCCP11945) GN=nadK PE=3 SV=1 277 366 3.0E-08
sp|Q5F9K3|NADK_NEIG1 NAD kinase OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=nadK PE=3 SV=1 277 366 3.0E-08
sp|A1KT64|NADK_NEIMF NAD kinase OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=nadK PE=3 SV=1 132 366 3.0E-08
sp|P65773|NADK_NEIMB NAD kinase OS=Neisseria meningitidis serogroup B (strain MC58) GN=nadK PE=3 SV=1 132 366 3.0E-08
sp|P65772|NADK_NEIMA NAD kinase OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=nadK PE=3 SV=1 132 366 3.0E-08
sp|A9M3N9|NADK_NEIM0 NAD kinase OS=Neisseria meningitidis serogroup C (strain 053442) GN=nadK PE=3 SV=1 132 366 3.0E-08
sp|Q04BL3|NADK_LACDB NAD kinase OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365) GN=nadK PE=3 SV=1 141 384 3.0E-08
sp|Q1GB65|NADK_LACDA NAD kinase OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / JCM 1002 / NBRC 13953 / NCIMB 11778) GN=nadK PE=3 SV=1 141 384 3.0E-08
sp|Q1JLR5|NADK_STRPC NAD kinase OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=nadK PE=3 SV=1 120 363 4.0E-08
sp|Q1JBT2|NADK_STRPB NAD kinase OS=Streptococcus pyogenes serotype M12 (strain MGAS2096) GN=nadK PE=3 SV=1 120 363 4.0E-08
sp|Q87DA0|NADK_XYLFT NAD kinase OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=nadK PE=3 SV=1 277 365 4.0E-08
sp|Q48TM3|NADK_STRPM NAD kinase OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=nadK PE=3 SV=1 120 363 4.0E-08
sp|Q1J6N4|NADK_STRPF NAD kinase OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=nadK PE=3 SV=1 120 363 5.0E-08
sp|Q1JGW5|NADK_STRPD NAD kinase OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=nadK PE=3 SV=1 120 363 5.0E-08
sp|P0DD17|NADK_STRPQ NAD kinase OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=nadK PE=3 SV=1 120 363 5.0E-08
sp|P65783|NADK_STRP8 NAD kinase OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=nadK PE=3 SV=1 120 363 5.0E-08
sp|Q5XC82|NADK_STRP6 NAD kinase OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=nadK PE=3 SV=2 120 363 5.0E-08
sp|P0DD16|NADK_STRP3 NAD kinase OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=nadK PE=3 SV=1 120 363 5.0E-08
sp|P65781|NADK_STRP1 NAD kinase OS=Streptococcus pyogenes serotype M1 GN=nadK PE=3 SV=1 120 363 5.0E-08
sp|Q8D391|NADK_WIGBR NAD kinase OS=Wigglesworthia glossinidia brevipalpis GN=nadK PE=3 SV=1 308 355 6.0E-08
sp|A3CU51|NADK_METMJ NAD kinase OS=Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1) GN=nadK PE=3 SV=1 309 388 6.0E-08
sp|Q5NMV7|NADK_ZYMMO NAD kinase OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=nadK PE=3 SV=1 276 365 7.0E-08
sp|Q74KC7|NADK_LACJO NAD kinase OS=Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) GN=nadK PE=3 SV=1 138 382 7.0E-08
sp|Q4ULP7|NADK_RICFE NAD kinase OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=nadK PE=3 SV=1 277 348 8.0E-08
sp|A8EYX8|NADK_RICCK NAD kinase OS=Rickettsia canadensis (strain McKiel) GN=nadK PE=3 SV=1 277 343 1.0E-07
sp|A8GNH0|NADK_RICAH NAD kinase OS=Rickettsia akari (strain Hartford) GN=nadK PE=3 SV=1 277 348 1.0E-07
sp|Q2P310|NADK_XANOM NAD kinase OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=nadK PE=3 SV=1 259 365 1.0E-07
sp|Q9PBQ0|NADK_XYLFA NAD kinase OS=Xylella fastidiosa (strain 9a5c) GN=nadK PE=3 SV=1 277 365 1.0E-07
sp|Q8DU98|NADK_STRMU NAD kinase OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=nadK PE=3 SV=1 262 381 2.0E-07
sp|A8GUT7|NADK_RICB8 NAD kinase OS=Rickettsia bellii (strain OSU 85-389) GN=nadK PE=3 SV=1 277 370 2.0E-07
sp|Q8PM39|NADK_XANAC NAD kinase OS=Xanthomonas axonopodis pv. citri (strain 306) GN=nadK PE=3 SV=1 259 365 2.0E-07
sp|Q8DZK7|NADK_STRA5 NAD kinase OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=nadK PE=3 SV=1 276 383 2.0E-07
sp|Q8E571|NADK_STRA3 NAD kinase OS=Streptococcus agalactiae serotype III (strain NEM316) GN=nadK PE=3 SV=1 276 383 2.0E-07
sp|Q3K103|NADK_STRA1 NAD kinase OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=nadK PE=3 SV=1 276 383 2.0E-07
sp|B1HNY3|NADK_LYSSC NAD kinase OS=Lysinibacillus sphaericus (strain C3-41) GN=nadK PE=3 SV=1 128 364 2.0E-07
sp|Q6L2M4|NADK_PICTO NAD kinase OS=Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828) GN=nadK PE=3 SV=1 276 394 2.0E-07
sp|Q042A7|NADK_LACGA NAD kinase OS=Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / JCM 1131 / NCIMB 11718 / AM63) GN=nadK PE=3 SV=1 138 357 2.0E-07
sp|Q3BV46|NADK_XANC5 NAD kinase OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=nadK PE=3 SV=1 259 365 3.0E-07
sp|Q8PAD9|NADK_XANCP NAD kinase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=nadK PE=3 SV=1 277 365 5.0E-07
sp|Q4UT86|NADK_XANC8 NAD kinase OS=Xanthomonas campestris pv. campestris (strain 8004) GN=nadK PE=3 SV=1 277 365 5.0E-07
sp|Q92I08|NADK_RICCN NAD kinase OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=nadK PE=3 SV=1 277 348 5.0E-07
sp|C4K0J2|NADK_RICPU NAD kinase OS=Rickettsia peacockii (strain Rustic) GN=nadK PE=3 SV=1 277 348 5.0E-07
sp|C3PNH0|NADK_RICAE NAD kinase OS=Rickettsia africae (strain ESF-5) GN=nadK PE=3 SV=1 277 348 5.0E-07
sp|C1A039|NADK_RHOE4 NAD kinase OS=Rhodococcus erythropolis (strain PR4 / NBRC 100887) GN=nadK PE=3 SV=1 277 394 6.0E-07
sp|Q8G0Z4|NADK_BRUSU NAD kinase OS=Brucella suis biovar 1 (strain 1330) GN=nadK PE=3 SV=2 263 345 6.0E-07
sp|Q1WSL8|NADK_LACS1 NAD kinase OS=Lactobacillus salivarius (strain UCC118) GN=nadK PE=3 SV=1 119 356 6.0E-07
sp|A8GS48|NADK_RICRS NAD kinase OS=Rickettsia rickettsii (strain Sheila Smith) GN=nadK PE=3 SV=1 277 348 6.0E-07
sp|B0BXL4|NADK_RICRO NAD kinase OS=Rickettsia rickettsii (strain Iowa) GN=nadK PE=3 SV=1 277 348 6.0E-07
sp|Q0C0I1|NADK_HYPNA NAD kinase OS=Hyphomonas neptunium (strain ATCC 15444) GN=nadK PE=3 SV=1 277 344 7.0E-07
sp|Q8YGW9|NADK_BRUME NAD kinase OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=nadK PE=3 SV=2 277 345 8.0E-07
sp|Q65G58|NADK2_BACLD NAD kinase 2 OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=nadK2 PE=3 SV=1 274 399 1.0E-06
sp|P58056|NADK_CAUCR NAD kinase OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=nadK PE=3 SV=1 277 344 1.0E-06
sp|Q5UXD1|NADK_HALMA NAD kinase OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=nadK PE=3 SV=1 141 344 2.0E-06
sp|Q3IZN1|NADK_RHOS4 NAD kinase OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=nadK PE=3 SV=1 277 345 3.0E-06
sp|A8AXJ8|NADK_STRGC NAD kinase OS=Streptococcus gordonii (strain Challis / ATCC 35105 / CH1 / DL1 / V288) GN=nadK PE=3 SV=1 255 381 4.0E-06
sp|A3PML8|NADK_RHOS1 NAD kinase OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=nadK PE=3 SV=1 277 345 4.0E-06
sp|A4WPE5|NADK_RHOS5 NAD kinase OS=Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3) GN=nadK PE=3 SV=1 277 345 4.0E-06
sp|Q38VN8|NADK_LACSS NAD kinase OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=nadK PE=3 SV=1 260 379 5.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0003951 NAD+ kinase activity Yes
GO:0006741 NADP biosynthetic process Yes
GO:0034641 cellular nitrogen compound metabolic process No
GO:0019637 organophosphate metabolic process No
GO:0019438 aromatic compound biosynthetic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0018130 heterocycle biosynthetic process No
GO:0006796 phosphate-containing compound metabolic process No
GO:1901293 nucleoside phosphate biosynthetic process No
GO:0016301 kinase activity No
GO:1901576 organic substance biosynthetic process No
GO:0019363 pyridine nucleotide biosynthetic process No
GO:0072525 pyridine-containing compound biosynthetic process No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:0006793 phosphorus metabolic process No
GO:0003674 molecular_function No
GO:0090407 organophosphate biosynthetic process No
GO:0008150 biological_process No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0034654 nucleobase-containing compound biosynthetic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0009117 nucleotide metabolic process No
GO:0016773 phosphotransferase activity, alcohol group as acceptor No
GO:0008152 metabolic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0072524 pyridine-containing compound metabolic process No
GO:0009165 nucleotide biosynthetic process No
GO:0046483 heterocycle metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0016740 transferase activity No
GO:0006753 nucleoside phosphate metabolic process No
GO:0009058 biosynthetic process No
GO:0044238 primary metabolic process No
GO:0009987 cellular process No
GO:1901362 organic cyclic compound biosynthetic process No
GO:0046496 nicotinamide nucleotide metabolic process No
GO:0006739 NADP metabolic process No
GO:1901566 organonitrogen compound biosynthetic process No
GO:0044237 cellular metabolic process No
GO:0071704 organic substance metabolic process No
GO:0044281 small molecule metabolic process No
GO:0019359 nicotinamide nucleotide biosynthetic process No
GO:0044249 cellular biosynthetic process No
GO:0055086 nucleobase-containing small molecule metabolic process No
GO:0019362 pyridine nucleotide metabolic process No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 21 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|6240
MPRRTMLGRLWLAPPAPCRCSATWQRAFGTTRMRRQTQQAKPSSIAQLPASITPKYLPLKKPASGHLSLHWPRPL
RNLLLVLKLDAPNAVESVVTFAKHVHEEYPNVNIIVEPYFFEMLSNRLAFPIFVADNGASLSEKVDVIATFGGDG
TFLRAASFFKLLPSVPPILSFSMGTLGFLGEWNFNDHELAWKQIYMSGCPLKSPCDATDQGKYPEWDSVRAKCDG
GRAAKILLRHRLQADLYDKEGNNITHIASDRLTRDTSCTMATPQEASPSLRAVNEISVYRGLSPHLAVVNITHNG
SSLTETMGDGALVSTPTGSTAYSLSTGGPIVHPLAKSLVLTPISPCSLSFRSLVLPFERSISLRVSPRNRSDELI
FSIDGKQCASLGRGTEVRINGEFVGRGQAGQDWHGGVPCVMRADNFDPWVAGINGLLKFNRPFGRYSADEEEAGN
*
Coding >OphauB2|6240
ATGCCCAGACGCACCATGCTAGGCCGGCTGTGGCTCGCGCCGCCTGCGCCTTGCAGGTGCTCGGCCACATGGCAA
CGCGCCTTTGGCACCACACGTATGCGACGTCAGACGCAACAGGCGAAGCCCAGCAGCATTGCGCAGCTGCCAGCC
TCCATCACTCCGAAATACCTGCCCCTCAAGAAGCCCGCCTCGGGACACCTCTCTCTGCACTGGCCGCGACCTCTG
CGAAATCTCCTCTTGGTGCTCAAGCTCGATGCGCCCAACGCTGTCGAGTCGGTGGTGACATTTGCCAAACATGTC
CACGAGGAATACCCAAACGTCAACATTATTGTTGAGCCGTATTTCTTTGAAATGCTCAGCAATAGACTGGCGTTC
CCCATCTTTGTGGCTGACAATGGCGCCAGTCTGTCGGAAAAAGTCGACGTGATAGCAACATTTGGTGGGGATGGT
ACCTTTTTGCGTGCTGCCAGCTTCTTCAAGCTCCTTCCATCCGTGCCGCCCATTTTGTCTTTCAGCATGGGCACT
CTAGGCTTTTTGGGCGAGTGGAACTTTAATGACCACGAGCTTGCATGGAAGCAAATATACATGAGCGGATGTCCT
TTGAAGAGTCCTTGTGACGCGACGGACCAAGGCAAATACCCCGAGTGGGATTCCGTAAGGGCAAAGTGCGATGGC
GGACGTGCGGCCAAGATTCTCCTGCGCCATCGCCTCCAGGCCGACCTCTATGATAAAGAGGGCAATAATATCACA
CATATAGCCTCGGATAGGTTGACGAGGGACACAAGTTGCACCATGGCGACGCCCCAAGAGGCATCTCCGTCGTTG
CGTGCCGTCAACGAGATATCTGTGTACAGGGGCTTGAGTCCGCACTTGGCAGTCGTCAACATTACTCACAACGGC
AGCTCATTAACCGAGACCATGGGCGACGGGGCTCTAGTCAGCACTCCTACAGGCTCAACGGCGTACAGCCTGAGT
ACTGGTGGCCCCATTGTTCATCCGCTGGCAAAGTCTCTTGTCCTGACACCCATAAGTCCTTGCAGCCTTAGCTTC
CGCTCTCTGGTTTTGCCGTTTGAGAGGAGCATAAGCCTACGTGTCAGTCCCCGAAACAGGAGCGACGAGCTCATC
TTCAGCATCGACGGCAAGCAGTGCGCGAGTCTTGGGCGAGGGACCGAGGTGCGCATCAATGGCGAGTTTGTGGGG
CGCGGGCAGGCAGGCCAAGACTGGCACGGCGGTGTGCCATGTGTCATGAGAGCCGACAACTTTGACCCCTGGGTT
GCAGGCATCAATGGACTGCTGAAATTCAACCGTCCCTTTGGCCGATATTCGGCCGACGAGGAGGAGGCTGGCAAT
TAA
Transcript >OphauB2|6240
ATGCCCAGACGCACCATGCTAGGCCGGCTGTGGCTCGCGCCGCCTGCGCCTTGCAGGTGCTCGGCCACATGGCAA
CGCGCCTTTGGCACCACACGTATGCGACGTCAGACGCAACAGGCGAAGCCCAGCAGCATTGCGCAGCTGCCAGCC
TCCATCACTCCGAAATACCTGCCCCTCAAGAAGCCCGCCTCGGGACACCTCTCTCTGCACTGGCCGCGACCTCTG
CGAAATCTCCTCTTGGTGCTCAAGCTCGATGCGCCCAACGCTGTCGAGTCGGTGGTGACATTTGCCAAACATGTC
CACGAGGAATACCCAAACGTCAACATTATTGTTGAGCCGTATTTCTTTGAAATGCTCAGCAATAGACTGGCGTTC
CCCATCTTTGTGGCTGACAATGGCGCCAGTCTGTCGGAAAAAGTCGACGTGATAGCAACATTTGGTGGGGATGGT
ACCTTTTTGCGTGCTGCCAGCTTCTTCAAGCTCCTTCCATCCGTGCCGCCCATTTTGTCTTTCAGCATGGGCACT
CTAGGCTTTTTGGGCGAGTGGAACTTTAATGACCACGAGCTTGCATGGAAGCAAATATACATGAGCGGATGTCCT
TTGAAGAGTCCTTGTGACGCGACGGACCAAGGCAAATACCCCGAGTGGGATTCCGTAAGGGCAAAGTGCGATGGC
GGACGTGCGGCCAAGATTCTCCTGCGCCATCGCCTCCAGGCCGACCTCTATGATAAAGAGGGCAATAATATCACA
CATATAGCCTCGGATAGGTTGACGAGGGACACAAGTTGCACCATGGCGACGCCCCAAGAGGCATCTCCGTCGTTG
CGTGCCGTCAACGAGATATCTGTGTACAGGGGCTTGAGTCCGCACTTGGCAGTCGTCAACATTACTCACAACGGC
AGCTCATTAACCGAGACCATGGGCGACGGGGCTCTAGTCAGCACTCCTACAGGCTCAACGGCGTACAGCCTGAGT
ACTGGTGGCCCCATTGTTCATCCGCTGGCAAAGTCTCTTGTCCTGACACCCATAAGTCCTTGCAGCCTTAGCTTC
CGCTCTCTGGTTTTGCCGTTTGAGAGGAGCATAAGCCTACGTGTCAGTCCCCGAAACAGGAGCGACGAGCTCATC
TTCAGCATCGACGGCAAGCAGTGCGCGAGTCTTGGGCGAGGGACCGAGGTGCGCATCAATGGCGAGTTTGTGGGG
CGCGGGCAGGCAGGCCAAGACTGGCACGGCGGTGTGCCATGTGTCATGAGAGCCGACAACTTTGACCCCTGGGTT
GCAGGCATCAATGGACTGCTGAAATTCAACCGTCCCTTTGGCCGATATTCGGCCGACGAGGAGGAGGCTGGCAAT
TAA
Gene >OphauB2|6240
ATGCCCAGACGCACCATGCTAGGCCGGCTGTGGCTCGCGCCGCCTGCGCCTTGCAGGTGCTCGGCCACATGGCAA
CGCGCCTTTGGCACCACACGTATGCGACGTCAGACGCAACAGGCGAAGCCCAGCAGCATTGCGCAGCTGCCAGCC
TCCATCACTCCGAAATACCTGCCCCTCAAGAAGCCCGCCTCGGGACACCTCTCTCTGCACTGGCCGCGACCTCTG
CGAAATCTCCTCTTGGTGCTCAAGCTCGATGCGCCCAACGCTGTCGAGTCGGTGGTGACATTTGCCAAACATGTC
CACGAGGAATACCCAAACGTCAACATTATTGTTGAGCCGTATTTCTTTGAAATGCTCAGCAATAGACTGGCGTTC
CCCATCTTTGTGGCTGACAATGGCGCCAGTCTGTCGGAAAAAGTCGACGTGATAGCAACATTTGGTGGGGATGGT
ACCTTTTTGCGTGCTGCCAGCTTCTTCAAGCTCCTTCCATCCGTGCCGCCCATTTTGTCTTTCAGCATGGGCACT
CTAGGCTTTTTGGGCGAGTGGAACTTTAATGACCACGAGCTTGCATGGAAGCAAATATACATGAGCGGATGTCCT
TTGAAGAGTCCTTGTGACGCGACGGACCAAGGCAAATACCCCGAGTGGGATTCCGTAAGGGCAAAGTGCGATGGC
GGACGTGCGGCCAAGATTCTCCTGCGCCATCGCCTCCAGGCCGACCTCTATGATAAAGAGGGCAATAATATCACA
CATATAGCCTCGGATAGGTTGACGAGGGACACAAGTTGCACCATGGCGACGCCCCAAGAGGCATCTCCGTCGTTG
CGTGCCGTCAACGAGATATCTGTGTACAGGGGCTTGAGTCCGCACTTGGCAGTCGTCAACATTACTCACAACGGC
AGCTCATTAACCGAGACCATGGGCGACGGGGCTCTAGTCAGCACTCCTACAGGCTCAACGGCGTACAGCCTGAGT
ACTGGTGGCCCCATTGTTCATCCGCTGGCAAAGTCTCTTGTCCTGACACCCATAAGTCCTTGCAGCCTTAGCTTC
CGCTCTCTGGTTTTGCCGTTTGAGAGGAGCATAAGCCTACGTGTCAGTCCCCGAAACAGGAGCGACGAGCTCATC
TTCAGCATCGACGGCAAGCAGTGCGCGAGTCTTGGGCGAGGGACCGAGGTGCGCATCAATGGCGAGTTTGTGGGG
CGCGGGCAGGCAGGCCAAGACTGGCACGGCGGTGTGCCATGTGTCATGAGAGCCGACAACTTTGACCCCTGGGTT
GCAGGCATCAATGGACTGCTGAAATTCAACCGTCCCTTTGGCCGATATTCGGCCGACGAGGAGGAGGCTGGCAAT
TAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail