Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|6239
Gene name
LocationContig_55:86148..87594
Strand-
Gene length (bp)1446
Transcript length (bp)1245
Coding sequence length (bp)1245
Protein length (aa) 415

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01553 Acyltransferase Acyltransferase 1.8E-25 128 283
PF16076 Acyltransf_C Acyltransferase C-terminus 1.5E-11 302 367

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P38226|CST26_YEAST Uncharacterized acyltransferase CST26 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CST26 PE=1 SV=1 31 392 6.0E-66
sp|O94361|YHOE_SCHPO Uncharacterized acyltransferase C428.14 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC428.14 PE=3 SV=1 41 384 8.0E-65
sp|Q12185|YD018_YEAST Uncharacterized acyltransferase YDR018C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YDR018C PE=3 SV=1 41 371 5.0E-53
sp|Q8L4Y2|LPAT4_ARATH Probable 1-acyl-sn-glycerol-3-phosphate acyltransferase 4 OS=Arabidopsis thaliana GN=LPAT4 PE=2 SV=1 39 356 1.0E-31
sp|Q9LHN4|LPAT5_ARATH Probable 1-acyl-sn-glycerol-3-phosphate acyltransferase 5 OS=Arabidopsis thaliana GN=LPAT5 PE=2 SV=1 128 356 3.0E-28
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P38226|CST26_YEAST Uncharacterized acyltransferase CST26 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CST26 PE=1 SV=1 31 392 6.0E-66
sp|O94361|YHOE_SCHPO Uncharacterized acyltransferase C428.14 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC428.14 PE=3 SV=1 41 384 8.0E-65
sp|Q12185|YD018_YEAST Uncharacterized acyltransferase YDR018C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YDR018C PE=3 SV=1 41 371 5.0E-53
sp|Q8L4Y2|LPAT4_ARATH Probable 1-acyl-sn-glycerol-3-phosphate acyltransferase 4 OS=Arabidopsis thaliana GN=LPAT4 PE=2 SV=1 39 356 1.0E-31
sp|Q9LHN4|LPAT5_ARATH Probable 1-acyl-sn-glycerol-3-phosphate acyltransferase 5 OS=Arabidopsis thaliana GN=LPAT5 PE=2 SV=1 128 356 3.0E-28
sp|Q5F3X0|LCLT1_CHICK Lysocardiolipin acyltransferase 1 OS=Gallus gallus GN=LCLAT1 PE=2 SV=1 42 393 5.0E-28
sp|Q3UN02|LCLT1_MOUSE Lysocardiolipin acyltransferase 1 OS=Mus musculus GN=Lclat1 PE=1 SV=2 42 363 1.0E-27
sp|Q6UWP7|LCLT1_HUMAN Lysocardiolipin acyltransferase 1 OS=Homo sapiens GN=LCLAT1 PE=1 SV=1 42 349 1.0E-26
sp|Q6NYV8|LCLT1_DANRE Lysocardiolipin acyltransferase 1 OS=Danio rerio GN=lclat1 PE=1 SV=1 128 359 6.0E-26
sp|Q924S1|PLCD_RAT 1-acyl-sn-glycerol-3-phosphate acyltransferase delta OS=Rattus norvegicus GN=Agpat4 PE=2 SV=1 35 356 5.0E-24
sp|Q8K4X7|PLCD_MOUSE 1-acyl-sn-glycerol-3-phosphate acyltransferase delta OS=Mus musculus GN=Agpat4 PE=1 SV=1 35 356 5.0E-24
sp|Q6IWY1|LPAT2_BRAOL 1-acyl-sn-glycerol-3-phosphate acyltransferase 2 OS=Brassica oleracea GN=LPAT2 PE=2 SV=1 47 408 8.0E-22
sp|Q9NRZ5|PLCD_HUMAN 1-acyl-sn-glycerol-3-phosphate acyltransferase delta OS=Homo sapiens GN=AGPAT4 PE=1 SV=1 35 356 2.0E-21
sp|Q5R757|PLCD_PONAB 1-acyl-sn-glycerol-3-phosphate acyltransferase delta OS=Pongo abelii GN=AGPAT4 PE=2 SV=1 35 356 2.0E-21
sp|Q9XFW4|LPAT2_BRANA 1-acyl-sn-glycerol-3-phosphate acyltransferase 2 OS=Brassica napus GN=LPAT2 PE=2 SV=1 47 395 6.0E-21
sp|Q5E9R2|PLCD_BOVIN 1-acyl-sn-glycerol-3-phosphate acyltransferase delta OS=Bos taurus GN=AGPAT4 PE=2 SV=1 50 356 7.0E-21
sp|Q4R581|PLCD_MACFA 1-acyl-sn-glycerol-3-phosphate acyltransferase delta OS=Macaca fascicularis GN=AGPAT4 PE=2 SV=1 35 356 2.0E-20
sp|Q8LG50|LPAT2_ARATH 1-acyl-sn-glycerol-3-phosphate acyltransferase 2 OS=Arabidopsis thaliana GN=LPAT2 PE=1 SV=2 128 395 8.0E-19
sp|Q9NRZ7|PLCC_HUMAN 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma OS=Homo sapiens GN=AGPAT3 PE=1 SV=1 36 357 8.0E-19
sp|Q5RA57|PLCC_PONAB 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma OS=Pongo abelii GN=AGPAT3 PE=2 SV=1 36 357 3.0E-18
sp|Q41745|LPAT_MAIZE 1-acyl-sn-glycerol-3-phosphate acyltransferase PLS1 OS=Zea mays GN=PLS1 PE=2 SV=1 128 355 1.0E-17
sp|Q9NUQ2|PLCE_HUMAN 1-acyl-sn-glycerol-3-phosphate acyltransferase epsilon OS=Homo sapiens GN=AGPAT5 PE=1 SV=3 128 370 5.0E-17
sp|Q9SYC8|LPAT3_ARATH 1-acyl-sn-glycerol-3-phosphate acyltransferase 3 OS=Arabidopsis thaliana GN=LPAT3 PE=2 SV=1 128 390 5.0E-17
sp|Q9D517|PLCC_MOUSE 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma OS=Mus musculus GN=Agpat3 PE=1 SV=2 36 357 8.0E-17
sp|Q9D1E8|PLCE_MOUSE 1-acyl-sn-glycerol-3-phosphate acyltransferase epsilon OS=Mus musculus GN=Agpat5 PE=2 SV=2 128 349 3.0E-16
sp|Q92604|LGAT1_HUMAN Acyl-CoA:lysophosphatidylglycerol acyltransferase 1 OS=Homo sapiens GN=LPGAT1 PE=1 SV=1 218 397 7.0E-08
sp|Q91YX5|LGAT1_MOUSE Acyl-CoA:lysophosphatidylglycerol acyltransferase 1 OS=Mus musculus GN=Lpgat1 PE=1 SV=1 218 360 1.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016746 acyltransferase activity Yes
GO:0003824 catalytic activity No
GO:0016740 transferase activity No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 27 0.5

Transmembrane Domains

Domain # Start End Length
1 48 70 22
2 142 164 22
3 170 187 17

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|6239
MDELNDADPADSSIVASRDKREPATAHPSGRIGHGLLTQVIRGVTMVIYFITGCFLIFITQNCGIPLYWFNREWF
YAHMALTKRHFSLLIILMTQIWGSTTIRISGDASVAGEIKPAKRGGVVFSFPERMVMVANHQIYTDWIYLWWTGY
VNVPQLQGYIYIIMKESLKYIPILGTGMMLYGFIFMSRKMATDQPRMAYRLGKLRQYKVGPKGEKYLDPMWLLLF
PEGTNLAANGHRRSVQWAEKNGLRSPEHVLLPRSTGTFFCLNELKGTVDYVYDCTVAYEGIPRGKYGEHYFGLGS
TYLQGRAPKSVNLYWRKFHMDDIPLHDQQKFDVWLRNEWYKKDDLMEEYLTTGRFPAMAGATTGHIETTVRLHHV
REILQLLTVPAIVWLMWNNITKVTHFVSSAAAGRATGHV*
Coding >OphauB2|6239
ATGGACGAGCTCAACGATGCCGATCCAGCCGACAGCAGCATTGTCGCCTCGCGGGACAAGAGAGAGCCCGCCACA
GCCCATCCGTCGGGGAGAATCGGCCATGGTCTACTGACGCAGGTGATTCGAGGAGTTACAATGGTGATCTACTTC
ATCACAGGTTGTTTCCTCATCTTCATCACGCAAAACTGTGGCATCCCGCTCTACTGGTTTAACCGTGAGTGGTTT
TATGCGCACATGGCCTTGACCAAGCGACACTTTTCACTCCTTATTATCCTCATGACGCAAATATGGGGCTCGACG
ACTATTCGAATCAGCGGCGATGCATCCGTGGCAGGAGAAATTAAGCCGGCCAAGCGTGGTGGCGTCGTATTCTCC
TTTCCGGAGCGCATGGTCATGGTTGCCAACCACCAGATATACACGGACTGGATATATCTCTGGTGGACTGGCTAT
GTCAATGTGCCCCAGCTGCAGGGCTACATCTACATCATCATGAAGGAGTCGCTGAAATACATTCCCATCTTGGGG
ACAGGAATGATGCTCTATGGGTTCATCTTCATGTCAAGAAAGATGGCAACAGACCAGCCGCGCATGGCCTATCGG
CTCGGCAAACTTAGGCAGTACAAAGTCGGGCCCAAGGGCGAAAAGTACCTGGATCCCATGTGGCTTCTCCTCTTT
CCCGAAGGCACCAACCTCGCGGCCAACGGTCACAGACGCTCGGTTCAGTGGGCTGAGAAGAATGGGCTGCGGAGT
CCCGAGCATGTGCTGTTGCCCCGCAGCACGGGCACTTTTTTCTGCCTCAACGAGCTCAAGGGCACCGTTGACTAC
GTCTACGACTGCACAGTGGCGTACGAGGGCATTCCCCGGGGCAAGTATGGAGAGCATTACTTCGGGCTGGGCAGC
ACCTATCTCCAAGGCCGCGCGCCCAAGTCAGTCAATCTATACTGGCGCAAATTCCACATGGACGATATCCCGCTG
CATGACCAGCAAAAATTTGACGTGTGGCTGCGCAACGAATGGTATAAAAAAGACGACTTGATGGAGGAGTATCTC
ACGACGGGGCGCTTCCCGGCAATGGCCGGAGCAACAACGGGCCACATCGAGACTACGGTGCGATTGCACCATGTG
CGGGAGATACTCCAGCTCTTGACGGTGCCGGCCATTGTGTGGCTCATGTGGAACAATATAACAAAGGTGACGCAC
TTTGTTTCATCGGCGGCTGCTGGACGGGCGACGGGGCACGTGTAA
Transcript >OphauB2|6239
ATGGACGAGCTCAACGATGCCGATCCAGCCGACAGCAGCATTGTCGCCTCGCGGGACAAGAGAGAGCCCGCCACA
GCCCATCCGTCGGGGAGAATCGGCCATGGTCTACTGACGCAGGTGATTCGAGGAGTTACAATGGTGATCTACTTC
ATCACAGGTTGTTTCCTCATCTTCATCACGCAAAACTGTGGCATCCCGCTCTACTGGTTTAACCGTGAGTGGTTT
TATGCGCACATGGCCTTGACCAAGCGACACTTTTCACTCCTTATTATCCTCATGACGCAAATATGGGGCTCGACG
ACTATTCGAATCAGCGGCGATGCATCCGTGGCAGGAGAAATTAAGCCGGCCAAGCGTGGTGGCGTCGTATTCTCC
TTTCCGGAGCGCATGGTCATGGTTGCCAACCACCAGATATACACGGACTGGATATATCTCTGGTGGACTGGCTAT
GTCAATGTGCCCCAGCTGCAGGGCTACATCTACATCATCATGAAGGAGTCGCTGAAATACATTCCCATCTTGGGG
ACAGGAATGATGCTCTATGGGTTCATCTTCATGTCAAGAAAGATGGCAACAGACCAGCCGCGCATGGCCTATCGG
CTCGGCAAACTTAGGCAGTACAAAGTCGGGCCCAAGGGCGAAAAGTACCTGGATCCCATGTGGCTTCTCCTCTTT
CCCGAAGGCACCAACCTCGCGGCCAACGGTCACAGACGCTCGGTTCAGTGGGCTGAGAAGAATGGGCTGCGGAGT
CCCGAGCATGTGCTGTTGCCCCGCAGCACGGGCACTTTTTTCTGCCTCAACGAGCTCAAGGGCACCGTTGACTAC
GTCTACGACTGCACAGTGGCGTACGAGGGCATTCCCCGGGGCAAGTATGGAGAGCATTACTTCGGGCTGGGCAGC
ACCTATCTCCAAGGCCGCGCGCCCAAGTCAGTCAATCTATACTGGCGCAAATTCCACATGGACGATATCCCGCTG
CATGACCAGCAAAAATTTGACGTGTGGCTGCGCAACGAATGGTATAAAAAAGACGACTTGATGGAGGAGTATCTC
ACGACGGGGCGCTTCCCGGCAATGGCCGGAGCAACAACGGGCCACATCGAGACTACGGTGCGATTGCACCATGTG
CGGGAGATACTCCAGCTCTTGACGGTGCCGGCCATTGTGTGGCTCATGTGGAACAATATAACAAAGGTGACGCAC
TTTGTTTCATCGGCGGCTGCTGGACGGGCGACGGGGCACGTGTAA
Gene >OphauB2|6239
ATGGACGAGCTCAACGATGCCGATCCAGCCGACAGCAGCATTGTCGCCTCGCGGGACAAGAGAGAGCCCGCCACA
GCCCATCCGTCGGGGAGAATCGGCCATGGTCTACTGACGCAGGTGATTCGAGGAGTTACAATGGTGATCTACTTC
ATCACAGGTTGTTTCCTGTTGGTTGCTCTCCCGACTGCTCTCTCTGTCGTGTTGCTCAGTGGCCAAGGCTGACGG
CCGTCTTGTCTGTAGCATCTTCATCACGCAAAACTGTGGCATCCCGCTCTACTGGTTTAACCGTGAGTGGTTTTA
TGCGCACATGGCCTTGACCAAGCGACACTTTTCACTCCTTATTATCCTCATGACGCAAATATGGGGCTCGACGAC
TATTCGAATCAGCGGCGATGCATCCGTGGCAGGAGAAATTAAGCCGGCCAAGCGTGGTGGCGTCGTATTCTCCTT
TCCGGAGCGCATGGTCATGGTTGCCAACCACCAGGTAAGTGTGCCATGGCTGGTGTGCCGAGCAGCGCCACTGAC
TTGTGCAGATATACACGGACTGGATATATCTCTGGTGGACTGGCTATGTCAATGTGCCCCAGCTGCAGGGCTACA
TCTACATCATCATGAAGGAGTCGCTGAAATACATTCCCATCTTGGGGACAGGAATGATGCTCTATGGGTTCATCT
TCATGTCAAGAAAGATGGCAACAGACCAGCCGCGCATGGCCTATCGGCTCGGCAAACTTAGGCAGTACAAAGTCG
GGCCCAAGGGCGAAAAGTACCTGGATCCCATGTGGCTTCTCCTCTTTCCCGAAGGCACCAACCTCGCGGCCAACG
GTCACAGACGCTCGGTTCAGTGGGCTGAGAAGAATGGGCTGCGGAGTCCCGAGCATGTGCTGTTGCCCCGCAGCA
CGGGCACTTTTTTCTGCCTCAACGAGCTCAAGGGCACCGTTGACTACGTCTACGACTGCACAGTGGCGTACGAGG
GCATTCCGTAAGTTGTCCTTGGTTTTTGCTTGATGAGTTTTTTTTTTTTTTTTTTTTTTGGCCGCGGGTGACTGA
CGAGGAGGCAGCCGGGGCAAGTATGGAGAGCATTACTTCGGGCTGGGCAGCACCTATCTCCAAGGCCGCGCGCCC
AAGTCAGTCAATCTATACTGGCGCAAATTCCACATGGACGATATCCCGCTGCATGACCAGCAAAAATTTGACGTG
TGGCTGCGCAACGAATGGTATAAAAAAGACGACTTGATGGAGGAGTATCTCACGACGGGGCGCTTCCCGGCAATG
GCCGGAGCAACAACGGGCCACATCGAGACTACGGTGCGATTGCACCATGTGCGGGAGATACTCCAGCTCTTGACG
GTGCCGGCCATTGTGTGGCTCATGTGGAACAATATAACAAAGGTGACGCACTTTGTTTCATCGGCGGCTGCTGGA
CGGGCGACGGGGCACGTGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail