Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|6235
Gene name
LocationContig_55:76627..77746
Strand-
Gene length (bp)1119
Transcript length (bp)1119
Coding sequence length (bp)1119
Protein length (aa) 373

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00730 HhH-GPD HhH-GPD superfamily base excision DNA repair protein 3.3E-08 120 267

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|F4JCQ3|DG783_ARATH Putative DNA glycosylase At3g47830 OS=Arabidopsis thaliana GN=At3g47830 PE=3 SV=1 67 297 5.0E-41
sp|Q9WYK0|END3_THEMA Endonuclease III OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=nth PE=3 SV=1 118 311 1.0E-15
sp|Q9SJQ6|ROS1_ARATH Protein ROS1 OS=Arabidopsis thaliana GN=ROS1 PE=1 SV=2 150 333 9.0E-14
sp|Q8LK56|DME_ARATH Transcriptional activator DEMETER OS=Arabidopsis thaliana GN=DME PE=1 SV=2 104 301 1.0E-12
sp|Q9SR66|DML2_ARATH DEMETER-like protein 2 OS=Arabidopsis thaliana GN=DML2 PE=3 SV=2 135 301 2.0E-12
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|F4JCQ3|DG783_ARATH Putative DNA glycosylase At3g47830 OS=Arabidopsis thaliana GN=At3g47830 PE=3 SV=1 67 297 5.0E-41
sp|Q9WYK0|END3_THEMA Endonuclease III OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=nth PE=3 SV=1 118 311 1.0E-15
sp|Q9SJQ6|ROS1_ARATH Protein ROS1 OS=Arabidopsis thaliana GN=ROS1 PE=1 SV=2 150 333 9.0E-14
sp|Q8LK56|DME_ARATH Transcriptional activator DEMETER OS=Arabidopsis thaliana GN=DME PE=1 SV=2 104 301 1.0E-12
sp|Q9SR66|DML2_ARATH DEMETER-like protein 2 OS=Arabidopsis thaliana GN=DML2 PE=3 SV=2 135 301 2.0E-12
sp|O49498|DML3_ARATH DEMETER-like protein 3 OS=Arabidopsis thaliana GN=DML3 PE=2 SV=2 134 301 1.0E-11
sp|Q58829|Y1434_METJA Putative endonuclease MJ1434 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ1434 PE=3 SV=1 117 283 3.0E-11
sp|Q09907|NTH_SCHPO Endonuclease III homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=nth1 PE=1 SV=1 94 327 1.0E-10
sp|P54137|NTH_CAEEL Endonuclease III homolog OS=Caenorhabditis elegans GN=nth-1 PE=1 SV=2 198 332 5.0E-08
sp|Q89AW4|END3_BUCBP Endonuclease III OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=nth PE=3 SV=1 114 290 3.0E-07
sp|Q92GH4|END3_RICCN Endonuclease III OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=nth PE=3 SV=1 119 247 5.0E-07
sp|P39788|END3_BACSU Endonuclease III OS=Bacillus subtilis (strain 168) GN=nth PE=3 SV=1 116 288 2.0E-06
sp|P73715|END3_SYNY3 Endonuclease III OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=nth PE=3 SV=1 119 300 2.0E-06
sp|B9DFZ0|NTH2_ARATH Endonuclease III homolog 2, chloroplastic OS=Arabidopsis thaliana GN=NTH2 PE=2 SV=1 205 300 7.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0006284 base-excision repair Yes
GO:0090304 nucleic acid metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0006950 response to stress No
GO:0006725 cellular aromatic compound metabolic process No
GO:0006281 DNA repair No
GO:0008150 biological_process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0033554 cellular response to stress No
GO:0006807 nitrogen compound metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0051716 cellular response to stimulus No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0044260 cellular macromolecule metabolic process No
GO:0071704 organic substance metabolic process No
GO:0006259 DNA metabolic process No
GO:0044237 cellular metabolic process No
GO:0008152 metabolic process No
GO:0050896 response to stimulus No
GO:0009987 cellular process No
GO:0044238 primary metabolic process No
GO:0006974 cellular response to DNA damage stimulus No
GO:0046483 heterocycle metabolic process No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2454
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|540
Ophiocordyceps australis map64 (Brazil) OphauB2|6235 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|03055
Ophiocordyceps camponoti-rufipedis Ophun1|5080
Ophiocordyceps kimflemingae Ophio5|6481
Ophiocordyceps subramaniannii Hirsu2|3525

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|6235
MALLRSSARSYKRQASDEPATPSKKKRVKTDQPSASSPRRPKTTLVDRAAELRDRKLKSFAAHAQQSPFAELVHP
TPAECVLAHDILARLHGDCLRPDKVVAPKGAAGCGSSPSVLDALVRTILSQNTSDANSSRAKRSMDAEYGGSDCW
DAIVAGGQQRLQQAIKSGGLSVVKSRAILNILHQVKERHGVYSLDHLFEASDHDAMREMLSFKGVGPKTASCVLL
FCLRRASFAVDTHVHRITGLLGWRPACATREEAQAHLDARVPPQEKYPLHVLIITHGKTCAECRAGGKNLGKCEL
RRAFGKGRLKGAAGHDVERQELNVVKKEEEEEGDLDTLKILKDEVARHKDEDLVKEEDASHQDQTDKEQRKK*
Coding >OphauB2|6235
ATGGCTCTTCTTCGAAGCAGCGCCCGCAGCTACAAGCGCCAGGCCAGCGACGAGCCAGCCACTCCCAGCAAGAAG
AAGCGTGTCAAGACGGACCAACCGTCTGCCTCGTCGCCCCGGCGCCCCAAGACGACGCTTGTGGACCGCGCAGCC
GAGTTGCGGGACCGCAAGCTCAAGTCGTTTGCCGCCCATGCCCAGCAGTCGCCATTTGCCGAGCTTGTGCATCCC
ACGCCTGCCGAGTGCGTGCTGGCCCACGACATTTTGGCCAGGCTGCATGGCGATTGCCTGCGCCCGGACAAGGTG
GTGGCGCCCAAGGGAGCGGCTGGGTGCGGCAGCTCGCCCTCGGTGCTTGACGCGCTGGTGCGCACCATTCTCTCA
CAAAACACGAGCGATGCAAACAGCTCGCGTGCAAAGCGCAGCATGGACGCAGAGTATGGCGGCAGCGATTGCTGG
GATGCCATTGTTGCTGGCGGGCAGCAGCGCTTGCAGCAGGCCATTAAGTCGGGCGGGCTGAGCGTCGTCAAGTCG
CGCGCTATTTTAAATATTTTGCACCAGGTCAAGGAGCGCCATGGCGTGTATTCGCTCGACCATCTCTTTGAGGCC
TCGGATCATGATGCCATGCGCGAGATGCTCTCCTTCAAGGGTGTCGGGCCAAAGACGGCTAGCTGCGTCTTGCTG
TTTTGCTTGCGCCGTGCTAGTTTTGCTGTCGATACCCATGTCCATCGCATCACGGGCTTGCTGGGCTGGCGGCCC
GCGTGTGCGACGCGCGAAGAGGCGCAGGCCCATCTCGATGCTAGAGTGCCGCCCCAGGAAAAGTATCCCTTGCAT
GTCTTGATTATCACCCACGGCAAAACGTGTGCCGAGTGCAGAGCTGGCGGCAAGAATCTTGGCAAGTGTGAGCTA
CGAAGGGCCTTTGGCAAAGGGAGACTGAAGGGTGCGGCTGGCCATGATGTTGAGCGCCAAGAGCTCAACGTGGTA
AAGAAGGAGGAGGAGGAAGAAGGCGACTTGGACACGCTGAAAATACTAAAAGATGAAGTGGCCCGCCATAAAGAT
GAAGACCTTGTCAAAGAGGAAGATGCCTCGCATCAAGACCAGACGGATAAGGAGCAAAGGAAAAAGTAG
Transcript >OphauB2|6235
ATGGCTCTTCTTCGAAGCAGCGCCCGCAGCTACAAGCGCCAGGCCAGCGACGAGCCAGCCACTCCCAGCAAGAAG
AAGCGTGTCAAGACGGACCAACCGTCTGCCTCGTCGCCCCGGCGCCCCAAGACGACGCTTGTGGACCGCGCAGCC
GAGTTGCGGGACCGCAAGCTCAAGTCGTTTGCCGCCCATGCCCAGCAGTCGCCATTTGCCGAGCTTGTGCATCCC
ACGCCTGCCGAGTGCGTGCTGGCCCACGACATTTTGGCCAGGCTGCATGGCGATTGCCTGCGCCCGGACAAGGTG
GTGGCGCCCAAGGGAGCGGCTGGGTGCGGCAGCTCGCCCTCGGTGCTTGACGCGCTGGTGCGCACCATTCTCTCA
CAAAACACGAGCGATGCAAACAGCTCGCGTGCAAAGCGCAGCATGGACGCAGAGTATGGCGGCAGCGATTGCTGG
GATGCCATTGTTGCTGGCGGGCAGCAGCGCTTGCAGCAGGCCATTAAGTCGGGCGGGCTGAGCGTCGTCAAGTCG
CGCGCTATTTTAAATATTTTGCACCAGGTCAAGGAGCGCCATGGCGTGTATTCGCTCGACCATCTCTTTGAGGCC
TCGGATCATGATGCCATGCGCGAGATGCTCTCCTTCAAGGGTGTCGGGCCAAAGACGGCTAGCTGCGTCTTGCTG
TTTTGCTTGCGCCGTGCTAGTTTTGCTGTCGATACCCATGTCCATCGCATCACGGGCTTGCTGGGCTGGCGGCCC
GCGTGTGCGACGCGCGAAGAGGCGCAGGCCCATCTCGATGCTAGAGTGCCGCCCCAGGAAAAGTATCCCTTGCAT
GTCTTGATTATCACCCACGGCAAAACGTGTGCCGAGTGCAGAGCTGGCGGCAAGAATCTTGGCAAGTGTGAGCTA
CGAAGGGCCTTTGGCAAAGGGAGACTGAAGGGTGCGGCTGGCCATGATGTTGAGCGCCAAGAGCTCAACGTGGTA
AAGAAGGAGGAGGAGGAAGAAGGCGACTTGGACACGCTGAAAATACTAAAAGATGAAGTGGCCCGCCATAAAGAT
GAAGACCTTGTCAAAGAGGAAGATGCCTCGCATCAAGACCAGACGGATAAGGAGCAAAGGAAAAAGTAG
Gene >OphauB2|6235
ATGGCTCTTCTTCGAAGCAGCGCCCGCAGCTACAAGCGCCAGGCCAGCGACGAGCCAGCCACTCCCAGCAAGAAG
AAGCGTGTCAAGACGGACCAACCGTCTGCCTCGTCGCCCCGGCGCCCCAAGACGACGCTTGTGGACCGCGCAGCC
GAGTTGCGGGACCGCAAGCTCAAGTCGTTTGCCGCCCATGCCCAGCAGTCGCCATTTGCCGAGCTTGTGCATCCC
ACGCCTGCCGAGTGCGTGCTGGCCCACGACATTTTGGCCAGGCTGCATGGCGATTGCCTGCGCCCGGACAAGGTG
GTGGCGCCCAAGGGAGCGGCTGGGTGCGGCAGCTCGCCCTCGGTGCTTGACGCGCTGGTGCGCACCATTCTCTCA
CAAAACACGAGCGATGCAAACAGCTCGCGTGCAAAGCGCAGCATGGACGCAGAGTATGGCGGCAGCGATTGCTGG
GATGCCATTGTTGCTGGCGGGCAGCAGCGCTTGCAGCAGGCCATTAAGTCGGGCGGGCTGAGCGTCGTCAAGTCG
CGCGCTATTTTAAATATTTTGCACCAGGTCAAGGAGCGCCATGGCGTGTATTCGCTCGACCATCTCTTTGAGGCC
TCGGATCATGATGCCATGCGCGAGATGCTCTCCTTCAAGGGTGTCGGGCCAAAGACGGCTAGCTGCGTCTTGCTG
TTTTGCTTGCGCCGTGCTAGTTTTGCTGTCGATACCCATGTCCATCGCATCACGGGCTTGCTGGGCTGGCGGCCC
GCGTGTGCGACGCGCGAAGAGGCGCAGGCCCATCTCGATGCTAGAGTGCCGCCCCAGGAAAAGTATCCCTTGCAT
GTCTTGATTATCACCCACGGCAAAACGTGTGCCGAGTGCAGAGCTGGCGGCAAGAATCTTGGCAAGTGTGAGCTA
CGAAGGGCCTTTGGCAAAGGGAGACTGAAGGGTGCGGCTGGCCATGATGTTGAGCGCCAAGAGCTCAACGTGGTA
AAGAAGGAGGAGGAGGAAGAAGGCGACTTGGACACGCTGAAAATACTAAAAGATGAAGTGGCCCGCCATAAAGAT
GAAGACCTTGTCAAAGAGGAAGATGCCTCGCATCAAGACCAGACGGATAAGGAGCAAAGGAAAAAGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail