Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|6234
Gene name
LocationContig_55:75553..76315
Strand+
Gene length (bp)762
Transcript length (bp)762
Coding sequence length (bp)762
Protein length (aa) 254

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup6606
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|539
Ophiocordyceps australis map64 (Brazil) OphauB2|6234 (this protein)
Ophiocordyceps subramaniannii Hirsu2|3524

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|6234
MTKRCNGLETSIWAAPRCHSQPPRCKPRCHDFSQPLGKTSGQIHALSRAHALQRFEQTCGRIRWKAIDLSNAYGR
TQTPSHWSFSTLDAERNFKVDFHEFYIWIEQAVVLLLRVFGTTIDARPGQSTLSATHAFHHNVLMALSDELHPLH
ESLGTGDVKHALWKAKELRNRWKDVAEGQQAQTPPLKMYDLEWIVAKVMTGLDSAYAVAAQRVRQDMQTAGVDID
MQQAQAVQAEDEWQWMVEPMDWEANDSL*
Coding >OphauB2|6234
ATGACAAAACGATGCAACGGCCTTGAGACATCTATTTGGGCAGCCCCGAGATGCCATTCACAACCACCGCGCTGC
AAACCCCGCTGCCACGATTTCTCGCAGCCCCTTGGCAAAACATCAGGCCAAATACACGCCCTCTCCAGAGCCCAC
GCACTCCAGCGCTTTGAGCAAACATGCGGCCGGATTCGCTGGAAAGCAATCGACCTGAGCAACGCATACGGGCGT
ACACAAACACCCTCCCACTGGTCCTTTAGCACGCTCGACGCCGAGCGCAACTTCAAGGTTGACTTCCACGAGTTT
TATATATGGATTGAGCAGGCCGTGGTGCTGCTGCTGCGAGTCTTTGGCACGACGATTGACGCGCGCCCCGGCCAG
AGCACCTTGTCCGCCACGCATGCTTTTCACCACAATGTCCTCATGGCTCTCAGTGACGAGCTGCATCCCTTGCAT
GAGTCGCTGGGCACCGGAGACGTCAAGCACGCCTTGTGGAAGGCAAAGGAGCTGCGTAACCGGTGGAAAGACGTG
GCCGAGGGGCAGCAGGCGCAGACTCCCCCTCTCAAGATGTACGACTTGGAGTGGATCGTGGCCAAGGTGATGACG
GGTCTCGACAGTGCATATGCTGTTGCTGCGCAGAGAGTGCGTCAGGATATGCAAACTGCCGGAGTGGACATTGAC
ATGCAGCAAGCACAGGCAGTGCAGGCAGAGGATGAGTGGCAGTGGATGGTTGAGCCCATGGACTGGGAGGCCAAT
GACTCTTTATGA
Transcript >OphauB2|6234
ATGACAAAACGATGCAACGGCCTTGAGACATCTATTTGGGCAGCCCCGAGATGCCATTCACAACCACCGCGCTGC
AAACCCCGCTGCCACGATTTCTCGCAGCCCCTTGGCAAAACATCAGGCCAAATACACGCCCTCTCCAGAGCCCAC
GCACTCCAGCGCTTTGAGCAAACATGCGGCCGGATTCGCTGGAAAGCAATCGACCTGAGCAACGCATACGGGCGT
ACACAAACACCCTCCCACTGGTCCTTTAGCACGCTCGACGCCGAGCGCAACTTCAAGGTTGACTTCCACGAGTTT
TATATATGGATTGAGCAGGCCGTGGTGCTGCTGCTGCGAGTCTTTGGCACGACGATTGACGCGCGCCCCGGCCAG
AGCACCTTGTCCGCCACGCATGCTTTTCACCACAATGTCCTCATGGCTCTCAGTGACGAGCTGCATCCCTTGCAT
GAGTCGCTGGGCACCGGAGACGTCAAGCACGCCTTGTGGAAGGCAAAGGAGCTGCGTAACCGGTGGAAAGACGTG
GCCGAGGGGCAGCAGGCGCAGACTCCCCCTCTCAAGATGTACGACTTGGAGTGGATCGTGGCCAAGGTGATGACG
GGTCTCGACAGTGCATATGCTGTTGCTGCGCAGAGAGTGCGTCAGGATATGCAAACTGCCGGAGTGGACATTGAC
ATGCAGCAAGCACAGGCAGTGCAGGCAGAGGATGAGTGGCAGTGGATGGTTGAGCCCATGGACTGGGAGGCCAAT
GACTCTTTATGA
Gene >OphauB2|6234
ATGACAAAACGATGCAACGGCCTTGAGACATCTATTTGGGCAGCCCCGAGATGCCATTCACAACCACCGCGCTGC
AAACCCCGCTGCCACGATTTCTCGCAGCCCCTTGGCAAAACATCAGGCCAAATACACGCCCTCTCCAGAGCCCAC
GCACTCCAGCGCTTTGAGCAAACATGCGGCCGGATTCGCTGGAAAGCAATCGACCTGAGCAACGCATACGGGCGT
ACACAAACACCCTCCCACTGGTCCTTTAGCACGCTCGACGCCGAGCGCAACTTCAAGGTTGACTTCCACGAGTTT
TATATATGGATTGAGCAGGCCGTGGTGCTGCTGCTGCGAGTCTTTGGCACGACGATTGACGCGCGCCCCGGCCAG
AGCACCTTGTCCGCCACGCATGCTTTTCACCACAATGTCCTCATGGCTCTCAGTGACGAGCTGCATCCCTTGCAT
GAGTCGCTGGGCACCGGAGACGTCAAGCACGCCTTGTGGAAGGCAAAGGAGCTGCGTAACCGGTGGAAAGACGTG
GCCGAGGGGCAGCAGGCGCAGACTCCCCCTCTCAAGATGTACGACTTGGAGTGGATCGTGGCCAAGGTGATGACG
GGTCTCGACAGTGCATATGCTGTTGCTGCGCAGAGAGTGCGTCAGGATATGCAAACTGCCGGAGTGGACATTGAC
ATGCAGCAAGCACAGGCAGTGCAGGCAGAGGATGAGTGGCAGTGGATGGTTGAGCCCATGGACTGGGAGGCCAAT
GACTCTTTATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail