Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|6212
Gene name
LocationContig_55:28178..29841
Strand+
Gene length (bp)1663
Transcript length (bp)1590
Coding sequence length (bp)1590
Protein length (aa) 530

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13649 Methyltransf_25 Methyltransferase domain 4.9E-10 214 314
PF13489 Methyltransf_23 Methyltransferase domain 1.7E-07 207 321
PF08241 Methyltransf_11 Methyltransferase domain 5.3E-05 215 317

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0008168 methyltransferase activity Yes
GO:0003824 catalytic activity No
GO:0003674 molecular_function No
GO:0016740 transferase activity No
GO:0016741 transferase activity, transferring one-carbon groups No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 26 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|6212
MAKMAKTKEQFDFDVAFMNSASVMAIPAQRPWSSSHRRSQSKHRRSNSSSGADNHHRRFLGHSRTSSGSRSSHDT
TATSLHTDRSAAAHISMSLAGGQRSVPETSRSSHRLMHRRPSMDPSGASPESALSAAALASSGPPSSSSATAESF
SSSTSKPFITRHGRLFLNEASLPYPLPVDLVELHHQSLRTMLQIQLFGAPVCSPLLKCNPPERVLEVGCGSGVWS
MMCNVYYKSRGHGGISFTGIDIAPLCPEPTQPHTAMDWTFVRHNLLHFPWPLPQKSFDLVMIKDMSLAITERGFQ
ELLEESVKRLRPGGTLEIWDSDHLIRALRPHERGYVDPVSPEQAEAASLGAYHIGKNTPISAPQNTYFLDYNNWI
TRALAARSLSAVPCTRIGPALLQESPMLVDMKSRRLAVPLDQVRWEREGPDIVVSRDSNTSPDSKANKASPKALT
AGQIAVRSTALLTVVQQIQALGHVVREVNGKSSDEWEMWVSKMMNDVVNDNGAIWGECLEVGAWWATRQSDEAIN
ATGT*
Coding >OphauB2|6212
ATGGCCAAAATGGCCAAGACCAAGGAACAATTCGACTTTGACGTGGCCTTTATGAACTCGGCGAGCGTCATGGCC
ATTCCCGCGCAGCGTCCTTGGTCCTCGTCACATCGTCGCTCCCAAAGCAAACACCGCCGCTCCAACTCGTCGTCG
GGAGCCGACAACCATCATCGACGCTTTCTTGGTCACTCGAGGACCTCGAGCGGCAGTCGCTCCTCTCACGACACC
ACGGCCACGTCCCTGCATACGGATCGCTCCGCAGCGGCCCATATATCTATGTCCCTTGCCGGGGGACAAAGATCA
GTCCCCGAAACATCGAGGTCGTCTCACCGATTGATGCACCGGCGTCCCAGTATGGACCCTTCTGGTGCTAGTCCC
GAGTCGGCTTTATCTGCAGCCGCCCTTGCCTCTTCGGGGCCTCCATCCTCATCGTCAGCAACAGCAGAGAGTTTT
AGCTCTTCAACCTCGAAGCCCTTTATTACGCGCCACGGTCGGCTCTTTCTCAATGAAGCAAGTCTGCCATATCCA
TTGCCTGTCGACCTGGTAGAGCTCCATCACCAGTCTCTCCGCACCATGCTGCAAATACAGCTCTTTGGCGCCCCA
GTCTGCTCCCCCCTGCTCAAATGCAATCCCCCAGAGCGGGTGCTTGAGGTGGGATGCGGCTCTGGTGTTTGGAGT
ATGATGTGCAATGTCTATTACAAGAGTCGCGGCCATGGCGGAATCTCCTTTACCGGCATTGACATTGCTCCTCTA
TGCCCAGAACCCACGCAGCCCCACACCGCCATGGATTGGACTTTTGTCAGACACAACCTACTGCATTTTCCGTGG
CCACTACCTCAAAAAAGTTTTGATCTTGTCATGATCAAGGACATGAGTCTTGCCATTACGGAAAGGGGTTTCCAA
GAGCTACTCGAGGAGTCGGTCAAGCGACTGCGACCGGGCGGCACATTGGAGATTTGGGATTCAGACCATCTTATC
CGCGCACTCAGGCCGCATGAACGCGGCTATGTCGATCCGGTCAGCCCAGAGCAAGCAGAGGCTGCGAGCCTTGGC
GCCTACCACATCGGCAAGAATACACCCATTTCTGCGCCACAAAACACCTATTTTCTCGACTATAACAATTGGATC
ACACGTGCCCTAGCAGCACGTTCTCTAAGCGCCGTTCCCTGCACCCGTATCGGACCCGCTCTATTACAAGAGTCC
CCTATGTTGGTGGACATGAAGTCACGCCGCCTTGCTGTGCCCCTTGACCAAGTGCGATGGGAGCGCGAGGGCCCC
GACATTGTCGTATCCCGCGATAGCAATACGAGCCCCGATTCAAAAGCTAACAAGGCCTCACCAAAAGCTCTCACG
GCAGGGCAAATCGCCGTGCGTTCCACCGCCCTTCTTACCGTTGTACAGCAGATTCAGGCATTGGGACATGTCGTG
CGCGAAGTCAACGGCAAGAGCTCGGATGAATGGGAAATGTGGGTTAGCAAGATGATGAATGATGTTGTCAATGAT
AACGGTGCTATCTGGGGCGAATGCCTCGAGGTCGGTGCGTGGTGGGCTACAAGACAGTCAGACGAAGCCATCAAT
GCCACGGGAACATGA
Transcript >OphauB2|6212
ATGGCCAAAATGGCCAAGACCAAGGAACAATTCGACTTTGACGTGGCCTTTATGAACTCGGCGAGCGTCATGGCC
ATTCCCGCGCAGCGTCCTTGGTCCTCGTCACATCGTCGCTCCCAAAGCAAACACCGCCGCTCCAACTCGTCGTCG
GGAGCCGACAACCATCATCGACGCTTTCTTGGTCACTCGAGGACCTCGAGCGGCAGTCGCTCCTCTCACGACACC
ACGGCCACGTCCCTGCATACGGATCGCTCCGCAGCGGCCCATATATCTATGTCCCTTGCCGGGGGACAAAGATCA
GTCCCCGAAACATCGAGGTCGTCTCACCGATTGATGCACCGGCGTCCCAGTATGGACCCTTCTGGTGCTAGTCCC
GAGTCGGCTTTATCTGCAGCCGCCCTTGCCTCTTCGGGGCCTCCATCCTCATCGTCAGCAACAGCAGAGAGTTTT
AGCTCTTCAACCTCGAAGCCCTTTATTACGCGCCACGGTCGGCTCTTTCTCAATGAAGCAAGTCTGCCATATCCA
TTGCCTGTCGACCTGGTAGAGCTCCATCACCAGTCTCTCCGCACCATGCTGCAAATACAGCTCTTTGGCGCCCCA
GTCTGCTCCCCCCTGCTCAAATGCAATCCCCCAGAGCGGGTGCTTGAGGTGGGATGCGGCTCTGGTGTTTGGAGT
ATGATGTGCAATGTCTATTACAAGAGTCGCGGCCATGGCGGAATCTCCTTTACCGGCATTGACATTGCTCCTCTA
TGCCCAGAACCCACGCAGCCCCACACCGCCATGGATTGGACTTTTGTCAGACACAACCTACTGCATTTTCCGTGG
CCACTACCTCAAAAAAGTTTTGATCTTGTCATGATCAAGGACATGAGTCTTGCCATTACGGAAAGGGGTTTCCAA
GAGCTACTCGAGGAGTCGGTCAAGCGACTGCGACCGGGCGGCACATTGGAGATTTGGGATTCAGACCATCTTATC
CGCGCACTCAGGCCGCATGAACGCGGCTATGTCGATCCGGTCAGCCCAGAGCAAGCAGAGGCTGCGAGCCTTGGC
GCCTACCACATCGGCAAGAATACACCCATTTCTGCGCCACAAAACACCTATTTTCTCGACTATAACAATTGGATC
ACACGTGCCCTAGCAGCACGTTCTCTAAGCGCCGTTCCCTGCACCCGTATCGGACCCGCTCTATTACAAGAGTCC
CCTATGTTGGTGGACATGAAGTCACGCCGCCTTGCTGTGCCCCTTGACCAAGTGCGATGGGAGCGCGAGGGCCCC
GACATTGTCGTATCCCGCGATAGCAATACGAGCCCCGATTCAAAAGCTAACAAGGCCTCACCAAAAGCTCTCACG
GCAGGGCAAATCGCCGTGCGTTCCACCGCCCTTCTTACCGTTGTACAGCAGATTCAGGCATTGGGACATGTCGTG
CGCGAAGTCAACGGCAAGAGCTCGGATGAATGGGAAATGTGGGTTAGCAAGATGATGAATGATGTTGTCAATGAT
AACGGTGCTATCTGGGGCGAATGCCTCGAGGTCGGTGCGTGGTGGGCTACAAGACAGTCAGACGAAGCCATCAAT
GCCACGGGAACATGA
Gene >OphauB2|6212
ATGGCCAAAATGGCCAAGACCAAGGAACAATTCGACTTTGACGTGGCCTTTATGAACTCGGCGAGCGTCATGGCC
ATTCCCGCGCAGCGTCCTTGGTCCTCGTCACATCGTCGCTCCCAAAGCAAACACCGCCGCTCCAACTCGTCGTCG
GGAGCCGACAACCATCATCGACGCTTTCTTGGTCACTCGAGGACCTCGAGCGGCAGTCGCTCCTCTCACGACACC
ACGGCCACGTCCCTGCATACGGATCGCTCCGCAGCGGCCCATATATCTATGTCCCTTGCCGGGGGACAAAGATCA
GTCCCCGAAACATCGAGGTCGTCTCACCGATTGATGCACCGGCGTCCCAGTGTAAGCATTTTTCATTCGTCTAGC
TGCTCTTCACACTGCTCACTTGAACCATTTTTTCTCTCCTCGAACCCAGATGGACCCTTCTGGTGCTAGTCCCGA
GTCGGCTTTATCTGCAGCCGCCCTTGCCTCTTCGGGGCCTCCATCCTCATCGTCAGCAACAGCAGAGAGTTTTAG
CTCTTCAACCTCGAAGCCCTTTATTACGCGCCACGGTCGGCTCTTTCTCAATGAAGCAAGTCTGCCATATCCATT
GCCTGTCGACCTGGTAGAGCTCCATCACCAGTCTCTCCGCACCATGCTGCAAATACAGCTCTTTGGCGCCCCAGT
CTGCTCCCCCCTGCTCAAATGCAATCCCCCAGAGCGGGTGCTTGAGGTGGGATGCGGCTCTGGTGTTTGGAGTAT
GATGTGCAATGTCTATTACAAGAGTCGCGGCCATGGCGGAATCTCCTTTACCGGCATTGACATTGCTCCTCTATG
CCCAGAACCCACGCAGCCCCACACCGCCATGGATTGGACTTTTGTCAGACACAACCTACTGCATTTTCCGTGGCC
ACTACCTCAAAAAAGTTTTGATCTTGTCATGATCAAGGACATGAGTCTTGCCATTACGGAAAGGGGTTTCCAAGA
GCTACTCGAGGAGTCGGTCAAGCGACTGCGACCGGGCGGCACATTGGAGATTTGGGATTCAGACCATCTTATCCG
CGCACTCAGGCCGCATGAACGCGGCTATGTCGATCCGGTCAGCCCAGAGCAAGCAGAGGCTGCGAGCCTTGGCGC
CTACCACATCGGCAAGAATACACCCATTTCTGCGCCACAAAACACCTATTTTCTCGACTATAACAATTGGATCAC
ACGTGCCCTAGCAGCACGTTCTCTAAGCGCCGTTCCCTGCACCCGTATCGGACCCGCTCTATTACAAGAGTCCCC
TATGTTGGTGGACATGAAGTCACGCCGCCTTGCTGTGCCCCTTGACCAAGTGCGATGGGAGCGCGAGGGCCCCGA
CATTGTCGTATCCCGCGATAGCAATACGAGCCCCGATTCAAAAGCTAACAAGGCCTCACCAAAAGCTCTCACGGC
AGGGCAAATCGCCGTGCGTTCCACCGCCCTTCTTACCGTTGTACAGCAGATTCAGGCATTGGGACATGTCGTGCG
CGAAGTCAACGGCAAGAGCTCGGATGAATGGGAAATGTGGGTTAGCAAGATGATGAATGATGTTGTCAATGATAA
CGGTGCTATCTGGGGCGAATGCCTCGAGGTCGGTGCGTGGTGGGCTACAAGACAGTCAGACGAAGCCATCAATGC
CACGGGAACATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail