Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|6207
Gene name
LocationContig_55:16670..17917
Strand-
Gene length (bp)1247
Transcript length (bp)996
Coding sequence length (bp)996
Protein length (aa) 332

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02629 CoA_binding CoA binding domain 4.4E-27 39 131
PF00549 Ligase_CoA CoA-ligase 5.5E-24 184 308
PF13607 Succ_CoA_lig Succinyl-CoA ligase like flavodoxin domain 2.1E-09 178 290

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P727|SUCA_NEUCR Probable succinyl-CoA ligase [ADP-forming] subunit alpha, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=8D4.130 PE=3 SV=1 1 331 0.0E+00
sp|P53596|SUCA_CAEEL Probable succinyl-CoA ligase [ADP/GDP-forming] subunit alpha, mitochondrial OS=Caenorhabditis elegans GN=C05G5.4 PE=3 SV=1 6 326 9.0E-146
sp|P13086|SUCA_RAT Succinyl-CoA ligase [ADP/GDP-forming] subunit alpha, mitochondrial OS=Rattus norvegicus GN=Suclg1 PE=2 SV=2 3 331 7.0E-143
sp|Q8GTQ9|SUCA1_SOLLC Succinyl-CoA ligase [ADP-forming] subunit alpha-1, mitochondrial OS=Solanum lycopersicum GN=SCOA PE=1 SV=1 8 331 4.0E-140
sp|Q94522|SUCA_DROME Succinyl-CoA ligase [ADP/GDP-forming] subunit alpha, mitochondrial OS=Drosophila melanogaster GN=Scsalpha PE=2 SV=3 28 331 6.0E-138
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P727|SUCA_NEUCR Probable succinyl-CoA ligase [ADP-forming] subunit alpha, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=8D4.130 PE=3 SV=1 1 331 0.0E+00
sp|P53596|SUCA_CAEEL Probable succinyl-CoA ligase [ADP/GDP-forming] subunit alpha, mitochondrial OS=Caenorhabditis elegans GN=C05G5.4 PE=3 SV=1 6 326 9.0E-146
sp|P13086|SUCA_RAT Succinyl-CoA ligase [ADP/GDP-forming] subunit alpha, mitochondrial OS=Rattus norvegicus GN=Suclg1 PE=2 SV=2 3 331 7.0E-143
sp|Q8GTQ9|SUCA1_SOLLC Succinyl-CoA ligase [ADP-forming] subunit alpha-1, mitochondrial OS=Solanum lycopersicum GN=SCOA PE=1 SV=1 8 331 4.0E-140
sp|Q94522|SUCA_DROME Succinyl-CoA ligase [ADP/GDP-forming] subunit alpha, mitochondrial OS=Drosophila melanogaster GN=Scsalpha PE=2 SV=3 28 331 6.0E-138
sp|O13750|SUCA_SCHPO Probable succinyl-CoA ligase [ADP-forming] subunit alpha, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC16E8.17c PE=3 SV=1 14 325 9.0E-138
sp|Q8LAD2|SUCA2_ARATH Succinyl-CoA ligase [ADP-forming] subunit alpha-2, mitochondrial OS=Arabidopsis thaliana GN=At5g23250 PE=2 SV=2 37 331 9.0E-137
sp|P68209|SUCA1_ARATH Succinyl-CoA ligase [ADP-forming] subunit alpha-1, mitochondrial OS=Arabidopsis thaliana GN=At5g08300 PE=1 SV=1 37 331 2.0E-136
sp|Q9WUM5|SUCA_MOUSE Succinyl-CoA ligase [ADP/GDP-forming] subunit alpha, mitochondrial OS=Mus musculus GN=Suclg1 PE=1 SV=4 3 331 4.0E-136
sp|Q9YGD2|SUCA_COLLI Succinyl-CoA ligase subunit alpha, mitochondrial (Fragment) OS=Columba livia GN=SUCLG1 PE=1 SV=1 28 331 7.0E-136
sp|P53598|SUCA_YEAST Succinyl-CoA ligase [ADP-forming] subunit alpha, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LSC1 PE=1 SV=1 13 327 2.0E-132
sp|Q6ZL94|SUCA_ORYSJ Probable succinyl-CoA ligase [ADP-forming] subunit alpha, mitochondrial OS=Oryza sativa subsp. japonica GN=Os07g0577700 PE=1 SV=1 37 331 8.0E-132
sp|P53597|SUCA_HUMAN Succinyl-CoA ligase [ADP/GDP-forming] subunit alpha, mitochondrial OS=Homo sapiens GN=SUCLG1 PE=1 SV=4 3 331 9.0E-132
sp|Q6DQL1|SUCA2_SOLLC Succinyl-CoA ligase [ADP-forming] subunit alpha-2, mitochondrial OS=Solanum lycopersicum PE=1 SV=1 20 330 9.0E-132
sp|O19069|SUCA_PIG Succinyl-CoA ligase [ADP/GDP-forming] subunit alpha, mitochondrial OS=Sus scrofa GN=SUCLG1 PE=1 SV=2 3 331 3.0E-131
sp|Q58DR8|SUCA_BOVIN Succinyl-CoA ligase [ADP/GDP-forming] subunit alpha, mitochondrial OS=Bos taurus GN=SUCLG1 PE=2 SV=3 3 331 3.0E-130
sp|Q4ULQ8|SUCD_RICFE Succinyl-CoA ligase [ADP-forming] subunit alpha OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=sucD PE=3 SV=1 35 323 9.0E-129
sp|Q1RH56|SUCD_RICBR Succinyl-CoA ligase [ADP-forming] subunit alpha OS=Rickettsia bellii (strain RML369-C) GN=sucD PE=3 SV=1 35 323 5.0E-128
sp|P53591|SUCD_COXBU Succinyl-CoA ligase [ADP-forming] subunit alpha OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=sucD PE=3 SV=2 34 323 4.0E-126
sp|O08371|SUCD_RICPR Succinyl-CoA ligase [ADP-forming] subunit alpha OS=Rickettsia prowazekii (strain Madrid E) GN=sucD PE=3 SV=1 35 323 9.0E-126
sp|Q92I22|SUCD_RICCN Succinyl-CoA ligase [ADP-forming] subunit alpha OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=sucD PE=3 SV=1 35 323 1.0E-125
sp|P36967|SUCA_DICDI Succinyl-CoA ligase [ADP/GDP-forming] subunit alpha, mitochondrial OS=Dictyostelium discoideum GN=scsA PE=1 SV=3 28 328 2.0E-125
sp|Q9AKE1|SUCD_RICTY Succinyl-CoA ligase [ADP-forming] subunit alpha OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=sucD PE=3 SV=1 35 323 2.0E-122
sp|Q51567|SUCD_PSEAE Succinyl-CoA ligase [ADP-forming] subunit alpha OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=sucD PE=3 SV=2 34 323 5.0E-119
sp|P0AGE9|SUCD_ECOLI Succinyl-CoA ligase [ADP-forming] subunit alpha OS=Escherichia coli (strain K12) GN=sucD PE=1 SV=2 34 321 7.0E-118
sp|P0AGF0|SUCD_ECOL6 Succinyl-CoA ligase [ADP-forming] subunit alpha OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=sucD PE=3 SV=2 34 321 7.0E-118
sp|P0AGF1|SUCD_ECO57 Succinyl-CoA ligase [ADP-forming] subunit alpha OS=Escherichia coli O157:H7 GN=sucD PE=3 SV=2 34 321 7.0E-118
sp|P45102|SUCD_HAEIN Succinyl-CoA ligase [ADP-forming] subunit alpha OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=sucD PE=3 SV=1 35 321 8.0E-118
sp|P80865|SUCD_BACSU Succinyl-CoA ligase [ADP-forming] subunit alpha OS=Bacillus subtilis (strain 168) GN=sucD PE=1 SV=3 37 331 3.0E-116
sp|Q8NX01|SUCD_STAAW Succinyl-CoA ligase [ADP-forming] subunit alpha OS=Staphylococcus aureus (strain MW2) GN=sucD PE=3 SV=1 37 323 6.0E-112
sp|Q6G9W7|SUCD_STAAS Succinyl-CoA ligase [ADP-forming] subunit alpha OS=Staphylococcus aureus (strain MSSA476) GN=sucD PE=3 SV=1 37 323 6.0E-112
sp|Q6GHI9|SUCD_STAAR Succinyl-CoA ligase [ADP-forming] subunit alpha OS=Staphylococcus aureus (strain MRSA252) GN=sucD PE=3 SV=1 37 323 8.0E-112
sp|P99070|SUCD_STAAN Succinyl-CoA ligase [ADP-forming] subunit alpha OS=Staphylococcus aureus (strain N315) GN=sucD PE=1 SV=1 37 323 9.0E-112
sp|Q5HGI6|SUCD_STAAC Succinyl-CoA ligase [ADP-forming] subunit alpha OS=Staphylococcus aureus (strain COL) GN=sucD PE=3 SV=1 37 323 9.0E-112
sp|P66866|SUCD_STAAM Succinyl-CoA ligase [ADP-forming] subunit alpha OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=sucD PE=3 SV=1 37 323 9.0E-112
sp|Q5HPU4|SUCD_STAEQ Succinyl-CoA ligase [ADP-forming] subunit alpha OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=sucD PE=3 SV=1 37 323 9.0E-109
sp|Q8CPH4|SUCD_STAES Succinyl-CoA ligase [ADP-forming] subunit alpha OS=Staphylococcus epidermidis (strain ATCC 12228) GN=sucD PE=3 SV=1 37 323 1.0E-108
sp|O67547|SUCD_AQUAE Succinyl-CoA ligase [ADP-forming] subunit alpha OS=Aquifex aeolicus (strain VF5) GN=sucD PE=3 SV=1 35 321 2.0E-97
sp|O28098|SUCD2_ARCFU Succinyl-CoA ligase [ADP-forming] subunit alpha 2 OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=sucD2 PE=3 SV=1 37 319 8.0E-97
sp|O28733|SUCD1_ARCFU Succinyl-CoA ligase [ADP-forming] subunit alpha 1 OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=sucD1 PE=3 SV=1 37 307 1.0E-94
sp|P53400|SUCA2_TRIVA Succinyl-CoA ligase [GDP-forming] subunit alpha-2, mitochondrial OS=Trichomonas vaginalis GN=ALPHA-SCS2 PE=3 SV=1 35 327 9.0E-93
sp|P53595|MTKB_METEA Malate--CoA ligase subunit alpha OS=Methylobacterium extorquens (strain ATCC 14718 / DSM 1338 / AM1) GN=mtkB PE=3 SV=2 34 327 4.0E-92
sp|P53401|SUCA3_TRIVA Succinyl-CoA ligase [GDP-forming] subunit alpha-3, mitochondrial OS=Trichomonas vaginalis GN=ALPHA-SCS3 PE=3 SV=1 35 327 1.0E-91
sp|P53399|SUCA1_TRIVA Succinyl-CoA ligase [GDP-forming] subunit alpha-1, mitochondrial OS=Trichomonas vaginalis GN=ALPHA-SCS1 PE=3 SV=1 35 327 9.0E-91
sp|O26663|SUCD_METTH Succinyl-CoA ligase [ADP-forming] subunit alpha OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=sucD PE=3 SV=1 35 317 4.0E-86
sp|Q7U0Z0|SUCD_MYCBO Succinyl-CoA ligase [ADP-forming] subunit alpha OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=sucD PE=3 SV=1 34 316 2.0E-80
sp|P9WGC7|SUCD_MYCTU Succinyl-CoA ligase [ADP-forming] subunit alpha OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=sucD PE=1 SV=1 34 316 3.0E-80
sp|P9WGC6|SUCD_MYCTO Succinyl-CoA ligase [ADP-forming] subunit alpha OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=sucD PE=3 SV=1 34 316 3.0E-80
sp|P09143|SUCD_THETH Succinyl-CoA ligase [ADP-forming] subunit alpha OS=Thermus thermophilus GN=sucD PE=1 SV=1 35 310 2.0E-78
sp|Q58643|SUCD_METJA Succinyl-CoA ligase [ADP-forming] subunit alpha OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=sucD PE=1 SV=1 35 321 3.0E-76
sp|Q91V92|ACLY_MOUSE ATP-citrate synthase OS=Mus musculus GN=Acly PE=1 SV=1 77 328 6.0E-20
sp|P16638|ACLY_RAT ATP-citrate synthase OS=Rattus norvegicus GN=Acly PE=1 SV=1 77 328 6.0E-20
sp|O93988|ACL1_SORMK ATP-citrate synthase subunit 1 OS=Sordaria macrospora (strain ATCC MYA-333 / DSM 997 / K(L3346) / K-hell) GN=ACL1 PE=3 SV=1 77 326 9.0E-20
sp|Q32PF2|ACLY_BOVIN ATP-citrate synthase OS=Bos taurus GN=ACLY PE=2 SV=1 77 328 1.0E-19
sp|Q8X097|ACL1_NEUCR Probable ATP-citrate synthase subunit 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=B14D6.310 PE=3 SV=1 77 326 2.0E-19
sp|P53396|ACLY_HUMAN ATP-citrate synthase OS=Homo sapiens GN=ACLY PE=1 SV=3 77 326 2.0E-19
sp|Q2TCH3|ACLY_SHEEP ATP-citrate synthase OS=Ovis aries GN=ACLY PE=2 SV=1 77 328 7.0E-19
sp|Q54YA0|ACLY_DICDI Probable ATP-citrate synthase OS=Dictyostelium discoideum GN=acly PE=1 SV=1 69 313 7.0E-19
sp|P53585|ACLY_CAEEL Probable ATP-citrate synthase OS=Caenorhabditis elegans GN=D1005.1 PE=3 SV=1 70 331 1.0E-18
sp|Q93VT8|ACLB1_ORYSJ ATP-citrate synthase beta chain protein 1 OS=Oryza sativa subsp. japonica GN=ACLB-1 PE=2 SV=1 122 325 6.0E-18
sp|Q9P7W3|ACL1_SCHPO Probable ATP-citrate synthase subunit 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1703.07 PE=1 SV=1 77 331 8.0E-18
sp|Q9FGX1|ACLB2_ARATH ATP-citrate synthase beta chain protein 2 OS=Arabidopsis thaliana GN=ACLB-2 PE=1 SV=1 122 325 2.0E-17
sp|Q9C522|ACLB1_ARATH ATP-citrate synthase beta chain protein 1 OS=Arabidopsis thaliana GN=ACLB-1 PE=2 SV=1 122 325 6.0E-17
sp|O29057|ACD1_ARCFU Acetate--CoA ligase [ADP-forming] I OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=AF_1211 PE=1 SV=1 68 323 5.0E-08
[Show less]

GO

GO Term Description Terminal node
GO:0003824 catalytic activity Yes
GO:0003674 molecular_function No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup167
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3403
Ophiocordyceps australis 1348a (Ghana) OphauG2|927
Ophiocordyceps australis map64 (Brazil) OphauB2|3849
Ophiocordyceps australis map64 (Brazil) OphauB2|6207 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|02549
Ophiocordyceps camponoti-floridani Ophcf2|03394
Ophiocordyceps camponoti-rufipedis Ophun1|1261
Ophiocordyceps camponoti-rufipedis Ophun1|3598
Ophiocordyceps kimflemingae Ophio5|1980
Ophiocordyceps kimflemingae Ophio5|979
Ophiocordyceps subramaniannii Hirsu2|1505
Ophiocordyceps subramaniannii Hirsu2|273

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|6207
MQALCRTAQRAAVLRQTVRRHYSSAWPYAKTIENLRINSNTKVIFQGFTGKQGTFHAAQAIEYGTKVVGGTNPKK
AGTAHLGLPVFKNVSEAVKETGATATALFVPPPVAAAGIEEALNAEIPLVVCITEGIPQHDMVRITSMLRSQTKT
RLVGPNCPGIIAPGQCKIGIMPGFIHKRGRIGIVSRSGTLTYEAVNQTTQTGLGQSLVVGIGGDPFSGTSFIDCL
KVFTEDKETDGIIMIGEIGGSAEEEAAEYLKHANTVGNGKPVVSFIAGISAPPGRRMGHAGAIVSGGKGGADSKI
SALESAGVIVERSPASLGKALYDEFVRRDLL*
Coding >OphauB2|6207
ATGCAGGCTCTTTGCAGAACAGCGCAGCGCGCTGCTGTGCTTCGTCAGACTGTCCGTCGGCATTATTCATCGGCT
TGGCCCTACGCCAAGACGATTGAGAATTTGCGCATCAACTCCAACACAAAGGTCATCTTCCAAGGATTTACCGGA
AAACAAGGAACCTTTCATGCAGCGCAGGCCATTGAATACGGAACAAAGGTTGTCGGTGGAACGAATCCCAAAAAG
GCCGGCACAGCTCATCTCGGTCTGCCAGTCTTCAAGAATGTCTCTGAGGCTGTCAAGGAGACTGGCGCCACCGCC
ACGGCCCTTTTCGTCCCTCCCCCGGTAGCCGCTGCAGGTATCGAGGAGGCGCTAAATGCCGAGATACCCCTTGTT
GTCTGCATTACTGAAGGCATCCCTCAGCATGACATGGTGCGCATTACGTCGATGCTCAGGTCGCAGACCAAGACT
CGCCTGGTGGGGCCCAATTGCCCTGGCATCATCGCCCCTGGCCAATGCAAGATTGGCATCATGCCAGGCTTCATC
CACAAGCGCGGCCGTATTGGAATCGTCTCGCGGTCCGGCACTCTTACGTACGAGGCCGTCAACCAGACCACCCAG
ACCGGTCTAGGCCAGTCTCTGGTCGTTGGCATCGGCGGTGATCCTTTTAGTGGCACCAGCTTCATTGACTGCCTC
AAGGTCTTCACCGAGGACAAGGAAACGGATGGCATCATCATGATTGGCGAGATTGGCGGCTCAGCTGAAGAGGAG
GCTGCCGAATACCTCAAGCACGCCAACACGGTCGGCAACGGCAAGCCCGTTGTCTCCTTCATTGCAGGCATCTCG
GCTCCTCCTGGTCGTCGCATGGGTCACGCTGGTGCTATTGTTTCTGGTGGCAAGGGCGGCGCCGACTCCAAGATT
AGTGCTCTGGAGAGCGCCGGCGTCATCGTGGAACGTTCTCCGGCCAGTCTCGGCAAGGCTCTGTATGATGAATTT
GTCCGACGAGACTTGCTGTGA
Transcript >OphauB2|6207
ATGCAGGCTCTTTGCAGAACAGCGCAGCGCGCTGCTGTGCTTCGTCAGACTGTCCGTCGGCATTATTCATCGGCT
TGGCCCTACGCCAAGACGATTGAGAATTTGCGCATCAACTCCAACACAAAGGTCATCTTCCAAGGATTTACCGGA
AAACAAGGAACCTTTCATGCAGCGCAGGCCATTGAATACGGAACAAAGGTTGTCGGTGGAACGAATCCCAAAAAG
GCCGGCACAGCTCATCTCGGTCTGCCAGTCTTCAAGAATGTCTCTGAGGCTGTCAAGGAGACTGGCGCCACCGCC
ACGGCCCTTTTCGTCCCTCCCCCGGTAGCCGCTGCAGGTATCGAGGAGGCGCTAAATGCCGAGATACCCCTTGTT
GTCTGCATTACTGAAGGCATCCCTCAGCATGACATGGTGCGCATTACGTCGATGCTCAGGTCGCAGACCAAGACT
CGCCTGGTGGGGCCCAATTGCCCTGGCATCATCGCCCCTGGCCAATGCAAGATTGGCATCATGCCAGGCTTCATC
CACAAGCGCGGCCGTATTGGAATCGTCTCGCGGTCCGGCACTCTTACGTACGAGGCCGTCAACCAGACCACCCAG
ACCGGTCTAGGCCAGTCTCTGGTCGTTGGCATCGGCGGTGATCCTTTTAGTGGCACCAGCTTCATTGACTGCCTC
AAGGTCTTCACCGAGGACAAGGAAACGGATGGCATCATCATGATTGGCGAGATTGGCGGCTCAGCTGAAGAGGAG
GCTGCCGAATACCTCAAGCACGCCAACACGGTCGGCAACGGCAAGCCCGTTGTCTCCTTCATTGCAGGCATCTCG
GCTCCTCCTGGTCGTCGCATGGGTCACGCTGGTGCTATTGTTTCTGGTGGCAAGGGCGGCGCCGACTCCAAGATT
AGTGCTCTGGAGAGCGCCGGCGTCATCGTGGAACGTTCTCCGGCCAGTCTCGGCAAGGCTCTGTATGATGAATTT
GTCCGACGAGACTTGCTGTGA
Gene >OphauB2|6207
ATGCAGGCTCTTTGCAGAACAGCGCAGCGCGCTGCTGTGCTTCGTCAGACTGTCCGTCGGCATTATTCATCGGCT
TGGCCCTACGCCAAGACGATTGAGAATTTGCGCATCAACTCCAACACAAAGGTCATCTTCCAAGGATTTACCGGA
AAACAAGGAACGTAAGTGGTAATGTCTTACTGGCAATTCGGAATGAAATGGTACTGACAAGAGAGCTTCCCAACA
ACAGCTTTCATGCAGCGCAGGCCATTGAATACGGTGGGCTCGTCGATTTCGCAACGTCGACACATTGCACATGCT
AACTCTGCGATGCAGGAACAAAGGTTGTCGGTGGAACGAATCCCAAAAAGGCCGGCACAGCTCATCTCGGTCTGC
CAGTCTTCAAGAATGTCTCTGAGGCTGTCAAGGAGACTGGCGCCACCGCCACGGCCCTTTTCGTCCCGTACGATG
CCACATTTTGCGCGCCCAATCTATATGTCGACGCTGACTATTTTTTTCAAGTCCCCCGGTAGCCGCTGCAGGTAT
CGAGGAGGCGCTAAATGCCGAGATACCCCTTGTTGTCTGCATTACTGAAGGCATCCCTCAGCATGGCAAGTTTGC
AACAGCACATATAGGAGCCGGCTGCTCGACAGATATGCTAATATTGCATTCCCCCAGACATGGTGCGCATTACGT
CGATGCTCAGGTCGCAGACCAAGACTCGCCTGGTGGGGCCCAATTGCCCTGGCATCATCGCCCCTGGCCAATGCA
AGATTGGCATCATGCCAGGCTTCATCCACAAGCGCGGCCGTATTGGAATCGTCTCGCGGTCCGGCACTCTTACGT
ACGAGGCCGTCAACCAGACCACCCAGACCGGTCTAGGCCAGTCTCTGGTCGTTGGCATCGGCGGTGATCCTTTTA
GTGGCACCAGCTTCATTGACTGCCTCAAGGTCTTCACCGAGGACAAGGAAACGGATGGCATCATCATGATTGGCG
AGATTGGCGGCTCAGCTGAAGAGGAGGCTGCCGAATACCTCAAGCACGCCAACACGGTCGGCAACGGCAAGCCCG
TTGTCTCCTTCATTGCAGGCATCTCGGCTCCTCCTGGTCGTCGCATGGGTCACGCTGGTGCTATTGTTTCTGGTG
GCAAGGGCGGCGCCGACTCCAAGATTAGTGCTCTGGAGAGCGCCGGCGTCATCGTGGAACGTTCTCCGGCCAGTC
TCGGCAAGGCTCTGTATGATGAATTTGTCCGACGAGACTTGCTGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail