Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|6202
Gene name
LocationContig_55:3413..5683
Strand-
Gene length (bp)2270
Transcript length (bp)1950
Coding sequence length (bp)1950
Protein length (aa) 650

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00743 FMO-like Flavin-binding monooxygenase-like 1.2E-45 13 289
PF13738 Pyr_redox_3 Pyridine nucleotide-disulphide oxidoreductase 2.9E-11 109 242
PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase 1.6E-10 14 249
PF13434 Lys_Orn_oxgnase L-lysine 6-monooxygenase/L-ornithine 5-monooxygenase 2.6E-07 116 231

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P49109|FMO5_CAVPO Dimethylaniline monooxygenase [N-oxide-forming] 5 OS=Cavia porcellus GN=FMO5 PE=2 SV=2 9 470 5.0E-43
sp|Q04799|FMO5_RABIT Dimethylaniline monooxygenase [N-oxide-forming] 5 OS=Oryctolagus cuniculus GN=FMO5 PE=1 SV=2 14 461 2.0E-42
sp|Q8K4C0|FMO5_RAT Dimethylaniline monooxygenase [N-oxide-forming] 5 OS=Rattus norvegicus GN=Fmo5 PE=1 SV=3 9 472 3.0E-41
sp|P97872|FMO5_MOUSE Dimethylaniline monooxygenase [N-oxide-forming] 5 OS=Mus musculus GN=Fmo5 PE=1 SV=4 9 472 3.0E-39
sp|P17635|FMO2_RABIT Dimethylaniline monooxygenase [N-oxide-forming] 2 OS=Oryctolagus cuniculus GN=FMO2 PE=1 SV=3 14 624 3.0E-38
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P49109|FMO5_CAVPO Dimethylaniline monooxygenase [N-oxide-forming] 5 OS=Cavia porcellus GN=FMO5 PE=2 SV=2 9 470 5.0E-43
sp|Q04799|FMO5_RABIT Dimethylaniline monooxygenase [N-oxide-forming] 5 OS=Oryctolagus cuniculus GN=FMO5 PE=1 SV=2 14 461 2.0E-42
sp|Q8K4C0|FMO5_RAT Dimethylaniline monooxygenase [N-oxide-forming] 5 OS=Rattus norvegicus GN=Fmo5 PE=1 SV=3 9 472 3.0E-41
sp|P97872|FMO5_MOUSE Dimethylaniline monooxygenase [N-oxide-forming] 5 OS=Mus musculus GN=Fmo5 PE=1 SV=4 9 472 3.0E-39
sp|P17635|FMO2_RABIT Dimethylaniline monooxygenase [N-oxide-forming] 2 OS=Oryctolagus cuniculus GN=FMO2 PE=1 SV=3 14 624 3.0E-38
sp|Q01740|FMO1_HUMAN Dimethylaniline monooxygenase [N-oxide-forming] 1 OS=Homo sapiens GN=FMO1 PE=2 SV=3 14 395 3.0E-38
sp|Q6IRI9|FMO2_RAT Dimethylaniline monooxygenase [N-oxide-forming] 2 OS=Rattus norvegicus GN=Fmo2 PE=2 SV=3 14 461 2.0E-36
sp|P49326|FMO5_HUMAN Dimethylaniline monooxygenase [N-oxide-forming] 5 OS=Homo sapiens GN=FMO5 PE=1 SV=2 9 470 2.0E-36
sp|Q5REK0|FMO2_PONAB Dimethylaniline monooxygenase [N-oxide-forming] 2 OS=Pongo abelii GN=FMO2 PE=2 SV=3 14 461 3.0E-36
sp|P36367|FMO4_RABIT Dimethylaniline monooxygenase [N-oxide-forming] 4 OS=Oryctolagus cuniculus GN=FMO4 PE=2 SV=2 14 484 4.0E-36
sp|P36366|FMO2_CAVPO Dimethylaniline monooxygenase [N-oxide-forming] 2 OS=Cavia porcellus GN=FMO2 PE=2 SV=2 14 438 4.0E-36
sp|Q99518|FMO2_HUMAN Dimethylaniline monooxygenase [N-oxide-forming] 2 OS=Homo sapiens GN=FMO2 PE=1 SV=4 14 461 4.0E-36
sp|Q8HZ69|FMO2_GORGO Dimethylaniline monooxygenase [N-oxide-forming] 2 OS=Gorilla gorilla gorilla GN=FMO2 PE=3 SV=3 14 461 1.0E-35
sp|Q8HZ70|FMO2_PANTR Dimethylaniline monooxygenase [N-oxide-forming] 2 OS=Pan troglodytes GN=FMO2 PE=3 SV=3 14 461 1.0E-35
sp|Q28505|FMO2_MACMU Dimethylaniline monooxygenase [N-oxide-forming] 2 OS=Macaca mulatta GN=FMO2 PE=2 SV=2 14 461 2.0E-35
sp|Q8K2I3|FMO2_MOUSE Dimethylaniline monooxygenase [N-oxide-forming] 2 OS=Mus musculus GN=Fmo2 PE=1 SV=3 14 461 9.0E-35
sp|Q95LA2|FMO1_CANLF Dimethylaniline monooxygenase [N-oxide-forming] 1 OS=Canis lupus familiaris GN=FMO1 PE=2 SV=3 14 395 2.0E-34
sp|Q95LA1|FMO3_CANLF Dimethylaniline monooxygenase [N-oxide-forming] 3 OS=Canis lupus familiaris GN=FMO3 PE=2 SV=3 14 407 2.0E-34
sp|Q9EQ76|FMO3_RAT Dimethylaniline monooxygenase [N-oxide-forming] 3 OS=Rattus norvegicus GN=Fmo3 PE=1 SV=1 14 407 6.0E-34
sp|Q8VHG0|FMO4_MOUSE Dimethylaniline monooxygenase [N-oxide-forming] 4 OS=Mus musculus GN=Fmo4 PE=1 SV=3 14 483 1.0E-33
sp|Q8SPQ7|FMO3_MACMU Dimethylaniline monooxygenase [N-oxide-forming] 3 OS=Macaca mulatta GN=FMO3 PE=2 SV=3 14 407 2.0E-33
sp|P17636|FMO1_RABIT Dimethylaniline monooxygenase [N-oxide-forming] 1 OS=Oryctolagus cuniculus GN=FMO1 PE=1 SV=3 14 395 4.0E-33
sp|P36365|FMO1_RAT Dimethylaniline monooxygenase [N-oxide-forming] 1 OS=Rattus norvegicus GN=Fmo1 PE=1 SV=2 14 395 1.0E-32
sp|Q8K4B7|FMO4_RAT Dimethylaniline monooxygenase [N-oxide-forming] 4 OS=Rattus norvegicus GN=Fmo4 PE=2 SV=3 14 450 1.0E-32
sp|O60774|FMO6_HUMAN Putative dimethylaniline monooxygenase [N-oxide-forming] 6 OS=Homo sapiens GN=FMO6P PE=5 SV=1 14 407 2.0E-32
sp|P97501|FMO3_MOUSE Dimethylaniline monooxygenase [N-oxide-forming] 3 OS=Mus musculus GN=Fmo3 PE=1 SV=1 11 407 4.0E-32
sp|P31512|FMO4_HUMAN Dimethylaniline monooxygenase [N-oxide-forming] 4 OS=Homo sapiens GN=FMO4 PE=1 SV=3 14 395 1.0E-31
sp|P16549|FMO1_PIG Dimethylaniline monooxygenase [N-oxide-forming] 1 OS=Sus scrofa GN=FMO1 PE=1 SV=3 14 395 3.0E-31
sp|P50285|FMO1_MOUSE Dimethylaniline monooxygenase [N-oxide-forming] 1 OS=Mus musculus GN=Fmo1 PE=1 SV=1 14 395 4.0E-31
sp|Q7YS44|FMO3_PANTR Dimethylaniline monooxygenase [N-oxide-forming] 3 OS=Pan troglodytes GN=FMO3 PE=3 SV=3 14 407 4.0E-27
sp|P31513|FMO3_HUMAN Dimethylaniline monooxygenase [N-oxide-forming] 3 OS=Homo sapiens GN=FMO3 PE=1 SV=5 14 407 5.0E-27
sp|P32417|FMO3_RABIT Dimethylaniline monooxygenase [N-oxide-forming] 3 OS=Oryctolagus cuniculus GN=FMO3 PE=1 SV=3 14 407 5.0E-26
sp|Q8HYJ9|FMO3_BOVIN Dimethylaniline monooxygenase [N-oxide-forming] 3 OS=Bos taurus GN=FMO3 PE=2 SV=1 14 407 4.0E-25
sp|Q9SS04|GSOX1_ARATH Flavin-containing monooxygenase FMO GS-OX1 OS=Arabidopsis thaliana GN=FMOGS-OX1 PE=2 SV=1 14 238 1.0E-21
sp|Q9SXD5|GSXL3_ARATH Flavin-containing monooxygenase FMO GS-OX-like 3 OS=Arabidopsis thaliana GN=At1g62620 PE=2 SV=2 4 238 1.0E-20
sp|Q9SXE1|GSOX3_ARATH Flavin-containing monooxygenase FMO GS-OX3 OS=Arabidopsis thaliana GN=FMOGS-OX3 PE=2 SV=1 14 238 2.0E-20
sp|Q9C8U0|GSXL5_ARATH Flavin-containing monooxygenase FMO GS-OX-like 5 OS=Arabidopsis thaliana GN=At1g63370 PE=2 SV=2 4 238 4.0E-20
sp|Q9FWW6|GSXL1_ARATH Flavin-containing monooxygenase FMO GS-OX-like 1 OS=Arabidopsis thaliana GN=At1g12160 PE=2 SV=1 14 233 8.0E-20
sp|O49312|YUC7_ARATH Probable indole-3-pyruvate monooxygenase YUCCA7 OS=Arabidopsis thaliana GN=YUC7 PE=2 SV=1 15 389 2.0E-18
sp|Q9SVU0|YUC8_ARATH Probable indole-3-pyruvate monooxygenase YUCCA8 OS=Arabidopsis thaliana GN=YUC8 PE=2 SV=1 15 389 1.0E-16
sp|Q9FWW3|GSXL6_ARATH Flavin-containing monooxygenase FMO GS-OX-like 6 OS=Arabidopsis thaliana GN=At1g12130 PE=2 SV=1 5 233 6.0E-16
sp|Q9FLK4|GSXL8_ARATH Flavin-containing monooxygenase FMO GS-OX-like 8 OS=Arabidopsis thaliana GN=At5g61290 PE=2 SV=1 6 233 1.0E-15
sp|Q93Y23|GSOX4_ARATH Flavin-containing monooxygenase FMO GS-OX4 OS=Arabidopsis thaliana GN=FMOGS-OX4 PE=2 SV=1 6 241 2.0E-15
sp|O64489|YUC9_ARATH Probable indole-3-pyruvate monooxygenase YUCCA9 OS=Arabidopsis thaliana GN=YUC9 PE=2 SV=1 15 389 1.0E-14
sp|Q9LFM5|YUC4_ARATH Probable indole-3-pyruvate monooxygenase YUCCA4 OS=Arabidopsis thaliana GN=YUC4 PE=1 SV=1 16 389 1.0E-14
sp|O23024|YUC3_ARATH Probable indole-3-pyruvate monooxygenase YUCCA3 OS=Arabidopsis thaliana GN=YUC3 PE=2 SV=1 15 389 3.0E-14
sp|Q94BV5|GSXL4_ARATH Flavin-containing monooxygenase FMO GS-OX-like 4 OS=Arabidopsis thaliana GN=At1g62600 PE=2 SV=1 4 238 9.0E-14
sp|Q8MP06|SNO1_TYRJA Senecionine N-oxygenase OS=Tyria jacobaeae GN=sno1 PE=1 SV=1 14 236 1.0E-13
sp|Q9SVQ1|YUC2_ARATH Indole-3-pyruvate monooxygenase YUCCA2 OS=Arabidopsis thaliana GN=YUC2 PE=1 SV=1 16 389 2.0E-13
sp|A8MRX0|GSOX5_ARATH Flavin-containing monooxygenase FMO GS-OX5 OS=Arabidopsis thaliana GN=FMOGS-OX5 PE=2 SV=2 9 238 4.0E-13
sp|Q94K43|GSOX2_ARATH Flavin-containing monooxygenase FMO GS-OX2 OS=Arabidopsis thaliana GN=FMOGS-OX2 PE=2 SV=1 14 238 5.0E-13
sp|Q9LMA1|FMO1_ARATH Probable flavin-containing monooxygenase 1 OS=Arabidopsis thaliana GN=FMO1 PE=2 SV=1 9 227 6.0E-13
sp|Q9LKC0|YUC5_ARATH Probable indole-3-pyruvate monooxygenase YUCCA5 OS=Arabidopsis thaliana GN=YUC5 PE=2 SV=1 15 389 7.0E-13
sp|Q9SZY8|YUC1_ARATH Probable indole-3-pyruvate monooxygenase YUCCA1 OS=Arabidopsis thaliana GN=YUC1 PE=1 SV=1 16 389 2.0E-12
sp|Q8VZ59|YUC6_ARATH Indole-3-pyruvate monooxygenase YUCCA6 OS=Arabidopsis thaliana GN=YUC6 PE=1 SV=1 15 389 8.0E-12
sp|Q9FWW9|GSXL2_ARATH Flavin-containing monooxygenase FMO GS-OX-like 2 OS=Arabidopsis thaliana GN=At1g12200 PE=2 SV=1 1 233 9.0E-12
sp|Q9FF12|GSXL9_ARATH Flavin-containing monooxygenase FMO GS-OX-like 9 OS=Arabidopsis thaliana GN=At5g07800 PE=2 SV=1 14 233 2.0E-11
sp|P55487|Y4ID_RHISN Uncharacterized monooxygenase y4iD OS=Rhizobium sp. (strain NGR234) GN=NGR_a03290 PE=3 SV=1 6 247 1.0E-10
sp|Q9FVQ0|YUC10_ARATH Probable indole-3-pyruvate monooxygenase YUCCA10 OS=Arabidopsis thaliana GN=YUC10 PE=2 SV=1 101 387 2.0E-10
sp|Q9HFE4|FMO1_SCHPO Thiol-specific monooxygenase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fmo1 PE=1 SV=1 14 222 2.0E-10
sp|Q9RKB5|BVMO2_STRCO Baeyer-Villiger monooxygenase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=SCO3172 PE=1 SV=1 14 386 5.0E-09
sp|Q9LPL3|YUC11_ARATH Probable indole-3-pyruvate monooxygenase YUCCA11 OS=Arabidopsis thaliana GN=YUC11 PE=2 SV=1 11 387 6.0E-09
sp|Q9SXD9|GSXL7_ARATH Flavin-containing monooxygenase FMO GS-OX-like 7 OS=Arabidopsis thaliana GN=At1g62580 PE=3 SV=2 4 233 8.0E-09
sp|Q93TJ5|HAPMO_PSEFL 4-hydroxyacetophenone monooxygenase OS=Pseudomonas fluorescens GN=hapE PE=1 SV=1 14 394 9.0E-09
sp|Q9C8T8|GSXLX_ARATH Putative flavin-containing monooxygenase FMO GS-OX-like 10 OS=Arabidopsis thaliana GN=At1g63340 PE=5 SV=3 14 225 3.0E-08
sp|Q9FKE7|FMO2_ARATH Putative flavin-containing monooxygenase 2 OS=Arabidopsis thaliana GN=FMO2 PE=3 SV=2 14 227 5.0E-08
sp|P38866|FMO1_YEAST Thiol-specific monooxygenase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FMO1 PE=1 SV=2 34 239 7.0E-07
sp|P64746|Y916_MYCBO Uncharacterized monooxygenase Mb0916 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=Mb0916 PE=3 SV=1 13 386 1.0E-06
sp|P9WNG1|Y892_MYCTU Uncharacterized monooxygenase Rv0892 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv0892 PE=1 SV=1 13 386 1.0E-06
sp|P9WNG0|Y892_MYCTO Uncharacterized monooxygenase MT0916 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT0916 PE=3 SV=1 13 386 1.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0050661 NADP binding Yes
GO:0016491 oxidoreductase activity Yes
GO:0050660 flavin adenine dinucleotide binding Yes
GO:0004499 N,N-dimethylaniline monooxygenase activity Yes
GO:1901265 nucleoside phosphate binding No
GO:0036094 small molecule binding No
GO:0043168 anion binding No
GO:0004497 monooxygenase activity No
GO:0005488 binding No
GO:0003674 molecular_function No
GO:1901363 heterocyclic compound binding No
GO:0003824 catalytic activity No
GO:0016705 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen No
GO:0097159 organic cyclic compound binding No
GO:0043167 ion binding No
GO:0016709 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, NAD(P)H as one donor, and incorporation of one atom of oxygen No
GO:0000166 nucleotide binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup410
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6712
Ophiocordyceps australis map64 (Brazil) OphauB2|6202 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|03398
Ophiocordyceps camponoti-rufipedis Ophun1|1265
Ophiocordyceps kimflemingae Ophio5|1984
Ophiocordyceps kimflemingae Ophio5|1985
Ophiocordyceps subramaniannii Hirsu2|2331

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|6202
MSSGPPLSLNRATIAVIGTGPAGLAALKSLLEQGFAATGFDRRPNVGGLWAYASEPSWTSVTRDTVCNISKFVVS
KSPGPSKAHLGTRRSRQGQSGFSDFPLPKDCPCYLSGAQVAEYFQTYASHFGLDKHICFGTTVTKITSSKAGPGW
HVQVSGPEGYQVHHFDKVVICTGCENVAAWPQMPGKQLYTGDILHGQQYRSPERFCNQRVMVVGMGNTACEVSLS
LAERAARVLQAYRRGRITVSRFLDNGIPTDCTVSWPLLRLKYLLDHGVGWLSMPLVDRLMVRKMVSDAARSQPAC
DAAGKRLSRRERLRRAEHKVKGEWRLTPCPSMAHEHPAVQEHFTAALASGDIVPVRGFKAFVGGKRVLLDDGSVV
EVDAIVFCTGYRHDFGIMPELEMDGATNTTPLRTMSQLQNLAPDDAGAEPHLPRLYQMMFPPRHASSVAFISWMA
PQENVWCVSELASLALAQIWSAETARLQAATPPPATPTSTRSLWRSKQQAKHHQPRTHRAPSLLPPLAEMNAAVD
AYHAWWRREWRREPSVRPGLVRAHTFYRFLHGAAGTGLYERLDHGLSGRGLRLRWEDPELYRWLAKGPINSHAWR
LFETNPGGVPGCGRATWAGAREAIREAYEDYQEFTRHAQEQSLSAKAAS*
Coding >OphauB2|6202
ATGTCGTCTGGGCCGCCACTGTCTTTGAACAGGGCCACAATTGCCGTAATTGGCACGGGTCCCGCCGGCCTGGCG
GCTTTGAAGAGCCTTTTGGAGCAAGGGTTTGCCGCAACTGGCTTTGACCGCAGGCCCAACGTCGGAGGACTGTGG
GCATATGCTTCAGAGCCGAGCTGGACGTCGGTCACGAGAGATACAGTCTGCAATATTAGCAAGTTTGTCGTAAGC
AAATCCCCGGGGCCCAGCAAAGCACACTTGGGGACTAGACGCTCACGACAAGGCCAGTCGGGCTTTAGCGATTTT
CCTCTGCCCAAAGATTGCCCTTGCTATCTCTCTGGAGCACAAGTGGCAGAGTATTTTCAAACATATGCCAGCCAC
TTTGGCCTGGACAAGCACATTTGCTTTGGCACAACAGTCACCAAGATTACCAGCTCCAAGGCCGGGCCCGGGTGG
CATGTGCAAGTCTCGGGGCCAGAGGGCTACCAGGTGCACCATTTTGACAAGGTGGTTATTTGCACGGGCTGCGAG
AATGTTGCGGCGTGGCCCCAGATGCCGGGCAAGCAGCTATACACGGGAGACATTCTGCACGGGCAGCAGTACAGG
AGCCCAGAGCGCTTCTGCAACCAGCGCGTCATGGTGGTGGGCATGGGCAACACGGCCTGCGAGGTGTCGCTAAGC
CTGGCTGAGCGCGCAGCAAGAGTGCTCCAGGCCTATCGTCGGGGCCGCATCACCGTGTCGCGCTTCCTGGACAAT
GGCATCCCCACCGACTGCACCGTTTCCTGGCCCTTGCTGCGCCTCAAGTATCTGCTAGACCATGGCGTTGGGTGG
CTCTCCATGCCGCTGGTGGACCGCCTCATGGTGCGCAAAATGGTTAGCGACGCGGCGCGCAGCCAGCCCGCCTGC
GACGCCGCCGGCAAGCGTCTGTCTCGCCGAGAGCGGCTGCGGCGCGCCGAGCACAAGGTCAAGGGCGAGTGGCGC
CTGACGCCCTGTCCCAGCATGGCACACGAGCATCCAGCAGTGCAGGAGCACTTTACCGCCGCCCTGGCCAGCGGA
GACATTGTTCCTGTGAGAGGCTTCAAGGCGTTTGTGGGGGGGAAGCGAGTACTGCTGGATGACGGCTCCGTCGTC
GAGGTGGATGCCATTGTGTTTTGCACGGGCTATAGACACGACTTTGGCATCATGCCTGAGCTTGAAATGGACGGC
GCCACCAACACCACGCCGCTCAGGACCATGAGCCAGCTGCAGAACCTGGCACCAGACGACGCAGGCGCAGAGCCT
CACTTGCCGCGGCTCTACCAAATGATGTTTCCTCCCCGGCACGCCTCGTCAGTGGCCTTTATCAGCTGGATGGCG
CCGCAGGAAAACGTGTGGTGCGTGAGCGAGCTGGCGTCGCTGGCGCTGGCGCAGATTTGGTCGGCCGAGACTGCT
CGACTGCAAGCTGCAACGCCGCCTCCTGCAACGCCCACTTCAACAAGAAGCCTCTGGCGCTCCAAGCAGCAGGCC
AAGCACCACCAGCCACGCACCCACCGGGCCCCGAGCCTGCTCCCGCCGCTGGCAGAGATGAATGCCGCCGTGGAC
GCCTACCACGCCTGGTGGCGCCGCGAGTGGCGGCGAGAACCCTCTGTGCGGCCTGGCCTGGTGCGCGCGCACACG
TTTTACCGCTTCTTGCACGGCGCAGCAGGGACGGGGCTGTATGAGCGGCTGGACCATGGGCTTAGCGGGCGGGGC
CTGCGTCTGCGCTGGGAGGACCCGGAACTGTACCGCTGGCTGGCAAAGGGGCCCATTAACAGCCATGCCTGGAGG
CTGTTTGAGACGAATCCCGGGGGGGTGCCGGGCTGTGGACGGGCGACGTGGGCGGGAGCGCGAGAGGCTATTCGA
GAGGCGTATGAGGACTACCAAGAGTTTACAAGGCATGCGCAGGAGCAGAGTCTGAGTGCCAAGGCGGCTTCATGA
Transcript >OphauB2|6202
ATGTCGTCTGGGCCGCCACTGTCTTTGAACAGGGCCACAATTGCCGTAATTGGCACGGGTCCCGCCGGCCTGGCG
GCTTTGAAGAGCCTTTTGGAGCAAGGGTTTGCCGCAACTGGCTTTGACCGCAGGCCCAACGTCGGAGGACTGTGG
GCATATGCTTCAGAGCCGAGCTGGACGTCGGTCACGAGAGATACAGTCTGCAATATTAGCAAGTTTGTCGTAAGC
AAATCCCCGGGGCCCAGCAAAGCACACTTGGGGACTAGACGCTCACGACAAGGCCAGTCGGGCTTTAGCGATTTT
CCTCTGCCCAAAGATTGCCCTTGCTATCTCTCTGGAGCACAAGTGGCAGAGTATTTTCAAACATATGCCAGCCAC
TTTGGCCTGGACAAGCACATTTGCTTTGGCACAACAGTCACCAAGATTACCAGCTCCAAGGCCGGGCCCGGGTGG
CATGTGCAAGTCTCGGGGCCAGAGGGCTACCAGGTGCACCATTTTGACAAGGTGGTTATTTGCACGGGCTGCGAG
AATGTTGCGGCGTGGCCCCAGATGCCGGGCAAGCAGCTATACACGGGAGACATTCTGCACGGGCAGCAGTACAGG
AGCCCAGAGCGCTTCTGCAACCAGCGCGTCATGGTGGTGGGCATGGGCAACACGGCCTGCGAGGTGTCGCTAAGC
CTGGCTGAGCGCGCAGCAAGAGTGCTCCAGGCCTATCGTCGGGGCCGCATCACCGTGTCGCGCTTCCTGGACAAT
GGCATCCCCACCGACTGCACCGTTTCCTGGCCCTTGCTGCGCCTCAAGTATCTGCTAGACCATGGCGTTGGGTGG
CTCTCCATGCCGCTGGTGGACCGCCTCATGGTGCGCAAAATGGTTAGCGACGCGGCGCGCAGCCAGCCCGCCTGC
GACGCCGCCGGCAAGCGTCTGTCTCGCCGAGAGCGGCTGCGGCGCGCCGAGCACAAGGTCAAGGGCGAGTGGCGC
CTGACGCCCTGTCCCAGCATGGCACACGAGCATCCAGCAGTGCAGGAGCACTTTACCGCCGCCCTGGCCAGCGGA
GACATTGTTCCTGTGAGAGGCTTCAAGGCGTTTGTGGGGGGGAAGCGAGTACTGCTGGATGACGGCTCCGTCGTC
GAGGTGGATGCCATTGTGTTTTGCACGGGCTATAGACACGACTTTGGCATCATGCCTGAGCTTGAAATGGACGGC
GCCACCAACACCACGCCGCTCAGGACCATGAGCCAGCTGCAGAACCTGGCACCAGACGACGCAGGCGCAGAGCCT
CACTTGCCGCGGCTCTACCAAATGATGTTTCCTCCCCGGCACGCCTCGTCAGTGGCCTTTATCAGCTGGATGGCG
CCGCAGGAAAACGTGTGGTGCGTGAGCGAGCTGGCGTCGCTGGCGCTGGCGCAGATTTGGTCGGCCGAGACTGCT
CGACTGCAAGCTGCAACGCCGCCTCCTGCAACGCCCACTTCAACAAGAAGCCTCTGGCGCTCCAAGCAGCAGGCC
AAGCACCACCAGCCACGCACCCACCGGGCCCCGAGCCTGCTCCCGCCGCTGGCAGAGATGAATGCCGCCGTGGAC
GCCTACCACGCCTGGTGGCGCCGCGAGTGGCGGCGAGAACCCTCTGTGCGGCCTGGCCTGGTGCGCGCGCACACG
TTTTACCGCTTCTTGCACGGCGCAGCAGGGACGGGGCTGTATGAGCGGCTGGACCATGGGCTTAGCGGGCGGGGC
CTGCGTCTGCGCTGGGAGGACCCGGAACTGTACCGCTGGCTGGCAAAGGGGCCCATTAACAGCCATGCCTGGAGG
CTGTTTGAGACGAATCCCGGGGGGGTGCCGGGCTGTGGACGGGCGACGTGGGCGGGAGCGCGAGAGGCTATTCGA
GAGGCGTATGAGGACTACCAAGAGTTTACAAGGCATGCGCAGGAGCAGAGTCTGAGTGCCAAGGCGGCTTCATGA
Gene >OphauB2|6202
ATGTCGTCTGGGCCGCCACTGTCTTTGAACAGGGCCACAATTGCCGTAATTGGCACGGGTAAGCCGCTTTTCTTT
TGTGTCTCAAGTCGGCGCTGGTAGCACACGGACTGGCCTTGCTGATTTTTGGCAAATTAAAAAAAAAAAAAGGTC
CCGCCGGCCTGGCGGCTTTGAAGAGCCTTTTGGAGCAAGGGTTTGCCGCAACTGGCTTTGACCGCAGGCCCAACG
TCGGAGGACTGTGGGCATATGCTTCAGAGCCGAGCTGGACGTCGGTCACGAGAGATACAGTCTGCAATATTAGCA
AGTTTGTCGTAAGCAAATCCCCGGGGCCCAGCAAAGCACACTTGGGGACTAGACGCTCACGACAAGGCCAGTCGG
GCTTTAGCGATTTTCCTCTGCCCAAAGGTAAATTATAAAAAATTTAAAAAAAAAAAAAAAAAAAAGAGAAAAGGG
CAACTTGATTCCACCTTGCCACTCTGCCAATGCCACTGGTCTGGGCAATTCTTTGCTGACGAGGTGTAATTATAG
ATTGCCCTTGCTATCTCTCTGGAGCACAAGTGGCAGAGTATTTTCAAACATATGCCAGCCACTTTGGCCTGGACA
AGCACATTTGCTTTGGCACAACAGTCACCAAGATTACCAGCTCCAAGGCCGGGCCCGGGTGGCATGTGCAAGTCT
CGGGGCCAGAGGGCTACCAGGTGCACCATTTTGACAAGGTGGTTATTTGCACGGGCTGCGAGAATGTTGCGGCGT
GGCCCCAGATGCCGGGCAAGCAGCTATACACGGGAGACATTCTGCACGGGCAGCAGTACAGGAGCCCAGAGCGCT
TCTGCAACCAGCGCGTCATGGTGGTGGGCATGGGCAACACGGCCTGCGAGGTGTCGCTAAGCCTGGCTGAGCGCG
CAGCAAGAGTGCTCCAGGCCTATCGTCGGGGCCGCATCACCGTGTCGCGCTTCCTGGACAATGGCATCCCCACCG
ACTGCACCGTTTCCTGGCCCTTGCTGCGCCTCAAGTATCTGCTAGACCATGGCGTTGGGTGGCTCTCCATGCCGC
TGGTGGACCGCCTCATGGTGCGCAAAATGGTTAGCGACGCGGCGCGCAGCCAGCCCGCCTGCGACGCCGCCGGCA
AGCGTCTGTCTCGCCGAGAGCGGCTGCGGCGCGCCGAGCACAAGGTCAAGGGCGAGTGGCGCCTGACGCCCTGTC
CCAGCATGGCACACGAGCATCCAGCAGTGCAGGAGCACTTTACCGCCGCCCTGGCCAGCGGAGACATTGTTCCTG
TGAGAGGCTTCAAGGCGTTTGTGGGGGGGAAGCGAGTACTGCTGGATGACGGCTCCGTCGTCGAGGTGGATGCCA
TTGTGTTTTGCACGGGCTATAGACACGACTTTGGCATCATGCCTGAGCTTGAAATGGACGGCGCCACCAACACCA
CGCCGCTCAGGACCATGAGCCAGCTGCAGAACCTGGCACCAGACGACGCAGGCGCAGAGCCTCACTTGCCGCGGC
TCTACCAAATGATGTTTCCTCCCCGGCACGCCTCGTCAGTGGCCTTTATCAGCTGGATGGCGCCGCAGGAAAACG
TGTGGTGCGTGAGCGAGCTGGCGTCGCTGGCGCTGGCGCAGATTTGGTCGGCCGAGACTGCTCGACTGCAAGCTG
CAACGCCGCCTCCTGCAACGCCCACTTCAACAAGAAGCCTCTGGCGCTCCAAGCAGCAGGCCAAGCACCACCAGC
CACGCACCCACCGGGCCCCGAGCCTGCTCCCGCCGCTGGCAGAGATGAATGCCGCCGTGGACGCCTACCACGCCT
GGTGGCGCCGCGAGTGGCGGCGAGAACCCTCTGTGCGGCCTGGCCTGGTGCGCGCGCACACGTTTTACCGCTTCT
TGCACGGCGCAGCAGGGACGGGGCTGTATGAGCGGCTGGACCATGGGCTTAGCGGGCGGGGCCTGCGTCTGCGCT
GGGAGGACCCGGAACTGTACCGCTGGCTGGCAAAGGGGCCCATTAACAGCCATGCCTGGAGGCTGTTTGAGACGA
ATCCCGGGGGGGTGCCGGGCTGTGGACGGGCGACGTGGGCGGGAGCGCGAGAGGCTATTCGAGAGGCGGTGAGTT
TTTACTCTTCTTTTTTTTTTTTTCTTTTTTTTTTTGGGTCGTGTGTTGTGTGTGTCATGTGCGGCTTGGGAGTAA
AGAGGTGCTGATGAGGGGTGTGATAGTATGAGGACTACCAAGAGTTTACAAGGCATGCGCAGGAGCAGAGTCTGA
GTGCCAAGGCGGCTTCATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail