Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|6187
Gene name
LocationContig_54:81749..84832
Strand+
Gene length (bp)3083
Transcript length (bp)2904
Coding sequence length (bp)2904
Protein length (aa) 968

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 21 0.45

Transmembrane Domains

Domain # Start End Length
1 759 781 22
2 805 827 22
3 837 856 19
4 881 900 19
5 915 937 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|6187
MRLASLGSVVLLAVASGCHGQEGDSQVQRGLEPWWWEVGDLIGEETLEAILGDRRLRRTYISFVGIYVKASRRLL
EEWELSDMLDKLEDHMETVKALDEEHVGEDSALELRRRGQEQGLQMAKRGFVGNLFGQKKDKDKESSGESSGEGA
GGDEAGDEAGDNGDDAGPIKGLVSKVANKLIERVAGMAAPALAGAGFFGGVGAGEGVAQGLQLVTAKTSMTAGAS
VASDNEMSSSGFNSAIERTTMGLTATALRALRDGNVFDKSAVDVGQLVESLGSGLGTGAASGLKLTDKALEAPRS
SGNSSSTLSNVAGSFGFGASKALTENINTTMGSLLPPIDVGATALQLGSGIGQGAASGLRLSNKQELVPSSADAS
NVAGNFGFGASKALTENINTTMGSLLPPIDVGATALQLGSGLGQGAASGLRLSNKQELPPSPADAQDIPGIAGSF
AFGLSKALADGSRAQLDASGLGAALFKFAGPAASGIGKGLGSGAAIGLGLQPDKEAAVHEAAGDMGAAQVSSIAQ
TLAEGLASSFLANGTTSKALSSLSSASSLDLGRIANGFARGLVTGAGDGVEALGGIDALVQGAATAPEAIVDTQV
SFNDTLGGAATGLGQGLGSSAVLTAHKLLRGGIKLKTAYRRDEALNLNASRLVSAQALSTLLQKAVELLNCQGLG
GLFLLGQGLAQSGALSPGGFDANTTNLIKSLIPTDRVNFTSNGNTYSIDGQQLLKVLDDDASSQAMNGLSINGVV
LDRFVSLLIVHAVFAIVAFAMLLPLAITLLSQQNLALRMHMPGLVSAWTSMAAKAIWILGLPLSLILVLVFGILP
AAKGAHFKTAHGILGLLTVMASLLAVVLNLLSARRSSPSKARADWRYIAAQTCNQALLFLGLATLATGFVDLSAI
SLCLTRIVALEQAIMLGFALACILVVGQVLGALDLLLTGLAAKSKEQRPAPDKPMVLVHRYYGNKSP*
Coding >OphauB2|6187
ATGAGGCTTGCAAGCTTGGGCTCTGTTGTCTTGCTCGCCGTGGCCTCGGGTTGCCATGGACAAGAAGGAGACAGC
CAGGTGCAGAGAGGACTGGAGCCTTGGTGGTGGGAAGTGGGTGACTTGATAGGCGAGGAGACGCTCGAGGCCATC
TTGGGGGACAGACGGCTGCGTAGGACATATATAAGTTTTGTGGGCATATATGTCAAGGCCTCAAGGAGGCTGTTG
GAGGAATGGGAGTTGTCGGACATGCTGGACAAGTTGGAAGACCACATGGAGACGGTCAAGGCACTAGACGAGGAG
CATGTTGGCGAGGACTCGGCATTGGAGCTCAGAAGAAGGGGACAAGAGCAAGGCTTGCAAATGGCCAAGCGAGGC
TTTGTGGGCAATTTGTTTGGGCAAAAGAAGGACAAGGACAAGGAGAGCAGCGGGGAGAGCAGCGGGGAGGGGGCT
GGGGGAGACGAGGCGGGCGACGAGGCGGGCGACAATGGCGACGACGCAGGCCCCATCAAGGGCCTCGTGTCCAAG
GTGGCCAACAAGCTGATTGAGCGGGTGGCGGGCATGGCAGCACCAGCATTGGCCGGAGCAGGCTTCTTTGGCGGC
GTGGGAGCAGGCGAGGGCGTGGCGCAGGGACTGCAGCTGGTGACGGCCAAGACGAGCATGACGGCCGGCGCGTCG
GTTGCCTCGGACAACGAAATGTCCAGCTCGGGCTTCAACTCGGCCATTGAGCGCACCACCATGGGACTGACGGCC
ACGGCCTTGCGCGCCCTGCGAGACGGCAACGTCTTTGACAAGTCGGCCGTCGACGTGGGCCAGCTAGTCGAGTCG
CTGGGCAGCGGGCTGGGCACTGGCGCTGCCTCGGGCCTCAAGCTGACGGACAAGGCGCTCGAGGCGCCGCGGAGC
TCAGGCAACTCGTCGAGCACGCTGAGCAACGTGGCTGGCAGCTTTGGCTTTGGGGCGAGCAAGGCCCTGACGGAA
AACATTAATACTACCATGGGCTCCCTCTTGCCGCCCATTGACGTGGGCGCCACGGCTCTCCAGCTCGGCTCGGGC
ATTGGCCAAGGAGCAGCTTCTGGGCTTCGTCTGAGCAACAAACAGGAGCTGGTGCCGTCGTCAGCAGACGCCAGC
AACGTGGCTGGCAACTTTGGCTTTGGGGCGAGCAAGGCCCTGACGGAAAACATTAATACTACCATGGGCTCCCTC
TTGCCACCCATTGACGTGGGCGCCACGGCCCTCCAGCTCGGCTCCGGCCTGGGCCAAGGAGCAGCCTCGGGGCTT
CGTCTCAGCAACAAGCAGGAGCTGCCGCCGTCTCCAGCAGACGCCCAGGACATACCCGGCATTGCCGGCAGCTTT
GCCTTTGGGCTGAGCAAGGCCTTGGCCGACGGCTCCAGGGCGCAGCTCGACGCCAGTGGCCTCGGGGCTGCCCTG
TTCAAGTTTGCCGGTCCTGCCGCCTCGGGCATCGGCAAGGGGCTCGGCTCCGGGGCCGCCATTGGACTGGGACTG
CAGCCGGACAAGGAGGCGGCCGTGCACGAGGCGGCTGGTGACATGGGGGCGGCCCAAGTCAGCTCCATTGCGCAG
ACGCTGGCCGAGGGCCTTGCGTCGAGCTTCCTGGCCAACGGCACCACGAGCAAGGCGCTGAGCTCGCTCTCGTCT
GCGTCGAGCTTGGACCTGGGCCGCATCGCCAATGGCTTTGCGCGCGGCCTCGTCACGGGCGCAGGAGACGGCGTC
GAGGCGCTGGGCGGCATCGACGCGCTTGTCCAGGGCGCCGCAACGGCCCCCGAGGCCATTGTCGACACCCAAGTC
TCCTTCAACGACACCCTGGGCGGCGCCGCCACGGGCCTGGGCCAGGGCCTGGGGAGCTCGGCCGTGCTGACGGCG
CACAAGCTGCTGCGCGGCGGCATCAAGCTCAAGACGGCCTACAGGCGCGACGAGGCGCTGAACCTCAATGCCTCG
CGCCTCGTCTCGGCCCAAGCCCTGTCCACCCTGCTGCAAAAGGCAGTCGAGCTGCTCAACTGCCAGGGCCTTGGC
GGCCTCTTCCTCCTTGGCCAAGGCTTGGCCCAGAGCGGCGCTCTGTCGCCCGGCGGCTTCGACGCCAACACGACC
AACTTGATCAAGTCGCTCATTCCCACCGACAGAGTCAACTTTACGAGCAACGGCAACACGTATAGCATTGACGGC
CAGCAGCTCCTCAAGGTCCTTGACGACGACGCCAGCTCCCAAGCCATGAATGGCCTGTCTATTAATGGCGTCGTC
CTCGACCGCTTCGTCAGCCTGCTCATTGTCCATGCCGTCTTTGCCATTGTCGCCTTTGCCATGCTGCTGCCCCTT
GCCATTACTCTGCTGAGCCAGCAGAACCTGGCCTTGCGCATGCACATGCCCGGCCTCGTGTCCGCCTGGACGTCA
ATGGCTGCCAAGGCCATTTGGATCCTCGGCCTGCCGCTCTCGCTGATTCTTGTCCTCGTCTTTGGCATTTTGCCG
GCTGCCAAGGGCGCCCATTTCAAAACGGCCCATGGCATTCTCGGCCTCTTGACCGTCATGGCCTCCCTCTTGGCC
GTCGTGCTCAACTTGCTCTCGGCCCGCCGCAGCAGCCCCTCCAAGGCCAGAGCCGACTGGCGCTACATTGCTGCC
CAGACATGCAACCAGGCGCTCCTGTTTCTCGGCCTCGCAACCCTGGCCACCGGCTTCGTTGATCTCAGCGCCATC
AGTCTCTGCCTCACCCGCATCGTGGCGCTCGAGCAAGCCATTATGCTGGGCTTCGCCCTAGCCTGTATTCTCGTC
GTCGGCCAAGTGCTCGGTGCCCTCGACTTGCTGCTTACCGGCCTGGCCGCAAAGTCCAAAGAGCAGCGGCCCGCG
CCCGACAAGCCCATGGTGCTCGTGCACCGCTACTATGGCAACAAGTCACCATGA
Transcript >OphauB2|6187
ATGAGGCTTGCAAGCTTGGGCTCTGTTGTCTTGCTCGCCGTGGCCTCGGGTTGCCATGGACAAGAAGGAGACAGC
CAGGTGCAGAGAGGACTGGAGCCTTGGTGGTGGGAAGTGGGTGACTTGATAGGCGAGGAGACGCTCGAGGCCATC
TTGGGGGACAGACGGCTGCGTAGGACATATATAAGTTTTGTGGGCATATATGTCAAGGCCTCAAGGAGGCTGTTG
GAGGAATGGGAGTTGTCGGACATGCTGGACAAGTTGGAAGACCACATGGAGACGGTCAAGGCACTAGACGAGGAG
CATGTTGGCGAGGACTCGGCATTGGAGCTCAGAAGAAGGGGACAAGAGCAAGGCTTGCAAATGGCCAAGCGAGGC
TTTGTGGGCAATTTGTTTGGGCAAAAGAAGGACAAGGACAAGGAGAGCAGCGGGGAGAGCAGCGGGGAGGGGGCT
GGGGGAGACGAGGCGGGCGACGAGGCGGGCGACAATGGCGACGACGCAGGCCCCATCAAGGGCCTCGTGTCCAAG
GTGGCCAACAAGCTGATTGAGCGGGTGGCGGGCATGGCAGCACCAGCATTGGCCGGAGCAGGCTTCTTTGGCGGC
GTGGGAGCAGGCGAGGGCGTGGCGCAGGGACTGCAGCTGGTGACGGCCAAGACGAGCATGACGGCCGGCGCGTCG
GTTGCCTCGGACAACGAAATGTCCAGCTCGGGCTTCAACTCGGCCATTGAGCGCACCACCATGGGACTGACGGCC
ACGGCCTTGCGCGCCCTGCGAGACGGCAACGTCTTTGACAAGTCGGCCGTCGACGTGGGCCAGCTAGTCGAGTCG
CTGGGCAGCGGGCTGGGCACTGGCGCTGCCTCGGGCCTCAAGCTGACGGACAAGGCGCTCGAGGCGCCGCGGAGC
TCAGGCAACTCGTCGAGCACGCTGAGCAACGTGGCTGGCAGCTTTGGCTTTGGGGCGAGCAAGGCCCTGACGGAA
AACATTAATACTACCATGGGCTCCCTCTTGCCGCCCATTGACGTGGGCGCCACGGCTCTCCAGCTCGGCTCGGGC
ATTGGCCAAGGAGCAGCTTCTGGGCTTCGTCTGAGCAACAAACAGGAGCTGGTGCCGTCGTCAGCAGACGCCAGC
AACGTGGCTGGCAACTTTGGCTTTGGGGCGAGCAAGGCCCTGACGGAAAACATTAATACTACCATGGGCTCCCTC
TTGCCACCCATTGACGTGGGCGCCACGGCCCTCCAGCTCGGCTCCGGCCTGGGCCAAGGAGCAGCCTCGGGGCTT
CGTCTCAGCAACAAGCAGGAGCTGCCGCCGTCTCCAGCAGACGCCCAGGACATACCCGGCATTGCCGGCAGCTTT
GCCTTTGGGCTGAGCAAGGCCTTGGCCGACGGCTCCAGGGCGCAGCTCGACGCCAGTGGCCTCGGGGCTGCCCTG
TTCAAGTTTGCCGGTCCTGCCGCCTCGGGCATCGGCAAGGGGCTCGGCTCCGGGGCCGCCATTGGACTGGGACTG
CAGCCGGACAAGGAGGCGGCCGTGCACGAGGCGGCTGGTGACATGGGGGCGGCCCAAGTCAGCTCCATTGCGCAG
ACGCTGGCCGAGGGCCTTGCGTCGAGCTTCCTGGCCAACGGCACCACGAGCAAGGCGCTGAGCTCGCTCTCGTCT
GCGTCGAGCTTGGACCTGGGCCGCATCGCCAATGGCTTTGCGCGCGGCCTCGTCACGGGCGCAGGAGACGGCGTC
GAGGCGCTGGGCGGCATCGACGCGCTTGTCCAGGGCGCCGCAACGGCCCCCGAGGCCATTGTCGACACCCAAGTC
TCCTTCAACGACACCCTGGGCGGCGCCGCCACGGGCCTGGGCCAGGGCCTGGGGAGCTCGGCCGTGCTGACGGCG
CACAAGCTGCTGCGCGGCGGCATCAAGCTCAAGACGGCCTACAGGCGCGACGAGGCGCTGAACCTCAATGCCTCG
CGCCTCGTCTCGGCCCAAGCCCTGTCCACCCTGCTGCAAAAGGCAGTCGAGCTGCTCAACTGCCAGGGCCTTGGC
GGCCTCTTCCTCCTTGGCCAAGGCTTGGCCCAGAGCGGCGCTCTGTCGCCCGGCGGCTTCGACGCCAACACGACC
AACTTGATCAAGTCGCTCATTCCCACCGACAGAGTCAACTTTACGAGCAACGGCAACACGTATAGCATTGACGGC
CAGCAGCTCCTCAAGGTCCTTGACGACGACGCCAGCTCCCAAGCCATGAATGGCCTGTCTATTAATGGCGTCGTC
CTCGACCGCTTCGTCAGCCTGCTCATTGTCCATGCCGTCTTTGCCATTGTCGCCTTTGCCATGCTGCTGCCCCTT
GCCATTACTCTGCTGAGCCAGCAGAACCTGGCCTTGCGCATGCACATGCCCGGCCTCGTGTCCGCCTGGACGTCA
ATGGCTGCCAAGGCCATTTGGATCCTCGGCCTGCCGCTCTCGCTGATTCTTGTCCTCGTCTTTGGCATTTTGCCG
GCTGCCAAGGGCGCCCATTTCAAAACGGCCCATGGCATTCTCGGCCTCTTGACCGTCATGGCCTCCCTCTTGGCC
GTCGTGCTCAACTTGCTCTCGGCCCGCCGCAGCAGCCCCTCCAAGGCCAGAGCCGACTGGCGCTACATTGCTGCC
CAGACATGCAACCAGGCGCTCCTGTTTCTCGGCCTCGCAACCCTGGCCACCGGCTTCGTTGATCTCAGCGCCATC
AGTCTCTGCCTCACCCGCATCGTGGCGCTCGAGCAAGCCATTATGCTGGGCTTCGCCCTAGCCTGTATTCTCGTC
GTCGGCCAAGTGCTCGGTGCCCTCGACTTGCTGCTTACCGGCCTGGCCGCAAAGTCCAAAGAGCAGCGGCCCGCG
CCCGACAAGCCCATGGTGCTCGTGCACCGCTACTATGGCAACAAGTCACCATGA
Gene >OphauB2|6187
ATGAGGCTTGCAAGCTTGGGCTCTGTTGTCTTGCTCGCCGTGGCCTCGGGTTGCCATGGACAAGAAGGAGACAGC
CAGGTGCAGAGAGGACTGGAGCCTTGGTGGTGGGAAGTGGGTGACTTGATAGGCGAGGAGACGCTCGAGGCCATC
TTGGGGGACAGACGGCTGCGTAGGACATATATAAGTTTTGTGGGCATATATGTCAAGGCCTCAAGGAGGCTGTTG
GAGGAATGGGAGTTGTCGGACATGCTGGACAAGTTGGAAGACCACATGGAGACGGTCAAGGCACTAGACGAGGAG
CATGTTGGCGAGGACTCGGCATTGGAGCTCAGAAGAAGGGGACAAGAGCAAGGCTTGCAAATGGCCAAGCGAGGC
TTTGTGGGCAATTTGTTTGGGCAAAAGAAGGACAAGGACAAGGAGAGCAGCGGGGAGAGCAGCGGGGAGGGGGCT
GGGGGAGACGAGGCGGGCGACGAGGCGGGCGACAATGGCGACGACGCAGGCCCCATCAAGGGCCTCGTGTCCAAG
GTGGCCAACAAGCTGATTGAGCGGGTGGCGGGCATGGCAGCACCAGCATTGGCCGGAGCAGGCTTCTTTGGCGGC
GTGGGAGCAGGCGAGGGCGTGGCGCAGGGACTGCAGCTGGTGACGGCCAAGACGAGCATGACGGCCGGCGCGTCG
GTTGCCTCGGACAACGAAATGTCCAGCTCGGGCTTCAACTCGGCCATTGAGCGCACCACCATGGGACTGACGGCC
ACGGCCTTGCGCGCCCTGCGAGACGGCAACGTCTTTGACAAGTCGGCCGTCGACGTGGGCCAGCTAGTCGAGTCG
CTGGGCAGCGGGCTGGGCACTGGCGCTGCCTCGGGCCTCAAGCTGACGGACAAGGCGCTCGAGGCGCCGCGGAGC
TCAGGCAACTCGTCGAGCACGCTGAGCAACGTGGCTGGCAGCTTTGGCTTTGGGGCGAGCAAGGCCCTGACGGAA
AACATTAATACTACCATGGGCTCCCTCTTGCCGCCCATTGACGTGGGCGCCACGGCTCTCCAGCTCGGCTCGGGC
ATTGGCCAAGGAGCAGCTTCTGGGCTTCGTCTGAGCAACAAACAGGAGCTGGTGCCGTCGTCAGCAGACGCCAGC
AACGTGGCTGGCAACTTTGGCTTTGGGGCGAGCAAGGCCCTGACGGAAAACATTAATACTACCATGGGCTCCCTC
TTGCCACCCATTGACGTGGGCGCCACGGCCCTCCAGCTCGGCTCCGGCCTGGGCCAAGGAGCAGCCTCGGGGCTT
CGTCTCAGCAACAAGCAGGAGCTGCCGCCGTCTCCAGCAGACGCCCAGGACATACCCGGCATTGCCGGCAGCTTT
GCCTTTGGGCTGAGCAAGGCCTTGGCCGACGGCTCCAGGGCGCAGCTCGACGCCAGTGGCCTCGGGGCTGCCCTG
TTCAAGTTTGCCGGTCCTGCCGCCTCGGGCATCGGCAAGGGGCTCGGCTCCGGGGCCGCCATTGGACTGGGACTG
CAGCCGGACAAGGAGGCGGCCGTGCACGAGGCGGCTGGTGACATGGGGGCGGCCCAAGTCAGCTCCATTGCGCAG
ACGCTGGCCGAGGGCCTTGCGTCGAGCTTCCTGGCCAACGGCACCACGAGCAAGGCGCTGAGCTCGCTCTCGTCT
GCGTCGAGCTTGGACCTGGGCCGCATCGCCAATGGCTTTGCGCGCGGCCTCGTCACGGGCGCAGGAGACGGCGTC
GAGGCGCTGGGCGGCATCGACGCGCTTGTCCAGGGCGCCGCAACGGCCCCCGAGGCCATTGTCGACACCCAAGTC
TCCTTCAACGACACCCTGGGCGGCGCCGCCACGGGCCTGGGCCAGGGCCTGGGGAGCTCGGCCGTGCTGACGGCG
CACAAGCTGCTGCGCGGCGGCATCAAGCTCAAGACGGCCTACAGGCGCGACGAGGCGCTGAACCTCAATGCCTCG
CGCCTCGTCTCGGCCCAAGCCCTGTCCACCCTGCTGCAAAAGGCAGTCGAGCTGCTCAACTGCCAGGGCCTTGGC
GGCCTCTTCCTCCTTGGCCAAGGCTTGGCCCAGAGCGGCGCTCTGTCGCCCGGCGGCTTCGACGCCAACACGACC
AACTTGATCAAGTCGCTCATTCCCACCGACAGAGTCAACTTTACGAGCAACGGCAACACGTATAGCATTGACGGC
CAGCAGCTCCTCAAGGTCCTTGACGACGACGCCAGCTCCCAAGCCATGAATGGCCTGTCTATTAATGGCGTCGTC
CTCGACCGCTTCGTCAGCCTGCTCATTGTCCATGGTGCGTCTTGACTTTTTATTTTTTATTTTTTATTTTTTTTT
CATTTTTTTTTTACTTGCATGCCCTGGTGTGCTGACTTGGGGGGCCAAAATTCTAGCCGTCTTTGCCATTGTCGC
CTTTGCCATGCTGCTGCCCCTTGCCATTACTCTGCTGAGCCAGCAGAACCTGGCCTTGCGCATGCACATGCCCGG
CCTCGTGTCCGCCTGGACGTCAATGGCTGCCAAGGCCATTTGGATCCTCGGCCTGCCGCTCTCGCTGATTCTTGT
CCTCGTCTTTGGCATTTTGCCGGCTGCCAAGGGCGCCCATTTCAAAACGGCCCATGGCGTGAGTCTTGCAGCCCA
ATATACATATATATACACACATACACACCTAATCCCAAGCTGACGCGCTCTGGCTCCCTCTCTAGATTCTCGGCC
TCTTGACCGTCATGGCCTCCCTCTTGGCCGTCGTGCTCAACTTGCTCTCGGCCCGCCGCAGCAGCCCCTCCAAGG
CCAGAGCCGACTGGCGCTACATTGCTGCCCAGACATGCAACCAGGCGCTCCTGTTTCTCGGCCTCGCAACCCTGG
CCACCGGCTTCGTTGATCTCAGCGCCATCAGTCTCTGCCTCACCCGCATCGTGGCGCTCGAGCAAGCCATTATGC
TGGGCTTCGCCCTAGCCTGTATTCTCGTCGTCGGCCAAGTGCTCGGTGCCCTCGACTTGCTGCTTACCGGCCTGG
CCGCAAAGTCCAAAGAGCAGCGGCCCGCGCCCGACAAGCCCATGGTGCTCGTGCACCGCTACTATGGCAACAAGT
CACCATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail