Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|6185
Gene name
LocationContig_54:74341..75979
Strand+
Gene length (bp)1638
Transcript length (bp)1308
Coding sequence length (bp)1308
Protein length (aa) 436

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03464 eRF1_2 eRF1 domain 2 1.7E-47 146 276
PF03465 eRF1_3 eRF1 domain 3 5.2E-40 281 418
PF03463 eRF1_1 eRF1 domain 1 1.5E-13 19 140
PF18854 baeRF_family10 Bacterial archaeo-eukaryotic release factor family 10 7.8E-08 134 255
PF18859 acVLRF1 Actinobacteria/chloroflexi VLRF1 release factor 2.8E-06 157 239

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q39097|ERF1X_ARATH Eukaryotic peptide chain release factor subunit 1-1 OS=Arabidopsis thaliana GN=ERF1-1 PE=1 SV=2 7 435 0.0E+00
sp|O59948|ERF1_PODAS Eukaryotic peptide chain release factor subunit 1 OS=Podospora anserina GN=SU2 PE=3 SV=1 1 426 0.0E+00
sp|Q9BMX3|ERF1_OXYTR Eukaryotic peptide chain release factor subunit 1 OS=Oxytricha trifallax GN=ERF1 PE=3 SV=1 11 421 0.0E+00
sp|Q9BMM3|ERF1_BLEAM Eukaryotic peptide chain release factor subunit 1 OS=Blepharisma americanum GN=eRF1 PE=2 SV=1 5 423 0.0E+00
sp|Q5CD95|ERF1_BLEMU Eukaryotic peptide chain release factor subunit 1 OS=Blepharisma musculus GN=eRF1 PE=2 SV=1 5 423 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q39097|ERF1X_ARATH Eukaryotic peptide chain release factor subunit 1-1 OS=Arabidopsis thaliana GN=ERF1-1 PE=1 SV=2 7 435 0.0E+00
sp|O59948|ERF1_PODAS Eukaryotic peptide chain release factor subunit 1 OS=Podospora anserina GN=SU2 PE=3 SV=1 1 426 0.0E+00
sp|Q9BMX3|ERF1_OXYTR Eukaryotic peptide chain release factor subunit 1 OS=Oxytricha trifallax GN=ERF1 PE=3 SV=1 11 421 0.0E+00
sp|Q9BMM3|ERF1_BLEAM Eukaryotic peptide chain release factor subunit 1 OS=Blepharisma americanum GN=eRF1 PE=2 SV=1 5 423 0.0E+00
sp|Q5CD95|ERF1_BLEMU Eukaryotic peptide chain release factor subunit 1 OS=Blepharisma musculus GN=eRF1 PE=2 SV=1 5 423 0.0E+00
sp|Q5CG95|ERF1_CRYHO Eukaryotic peptide chain release factor subunit 1 OS=Cryptosporidium hominis GN=erf1 PE=3 SV=1 12 432 0.0E+00
sp|Q9BMX0|ERF1_DICDI Eukaryotic peptide chain release factor subunit 1 OS=Dictyostelium discoideum GN=erf1 PE=2 SV=2 3 435 0.0E+00
sp|P79063|ERF1_SCHPO Eukaryotic peptide chain release factor subunit 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sup45 PE=1 SV=1 9 435 0.0E+00
sp|Q9LPV8|ERF1Y_ARATH Eukaryotic peptide chain release factor subunit 1-2 OS=Arabidopsis thaliana GN=ERF1-2 PE=1 SV=1 6 435 0.0E+00
sp|P35614|ERF1Z_ARATH Eukaryotic peptide chain release factor subunit 1-3 OS=Arabidopsis thaliana GN=ERF1-3 PE=1 SV=1 8 435 0.0E+00
sp|O16520|ERF1_CAEEL Eukaryotic peptide chain release factor subunit 1 OS=Caenorhabditis elegans GN=erfa-1 PE=3 SV=2 11 423 0.0E+00
sp|P12385|ERF1_YEAST Eukaryotic peptide chain release factor subunit 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SUP45 PE=1 SV=2 7 435 0.0E+00
sp|P35615|ERF1_XENLA Eukaryotic peptide chain release factor subunit 1 OS=Xenopus laevis GN=etf1 PE=2 SV=1 1 434 0.0E+00
sp|P62498|ERF1_XENTR Eukaryotic peptide chain release factor subunit 1 OS=Xenopus tropicalis GN=etf1 PE=2 SV=1 1 434 0.0E+00
sp|Q9GR88|ERF1_POLMI Eukaryotic peptide chain release factor subunit 1 OS=Polyandrocarpa misakiensis GN=ERF1 PE=2 SV=1 9 423 0.0E+00
sp|Q9VPH7|ERF1_DROME Eukaryotic peptide chain release factor subunit 1 OS=Drosophila melanogaster GN=eRF1 PE=1 SV=2 9 435 0.0E+00
sp|Q5U2Q7|ERF1_RAT Eukaryotic peptide chain release factor subunit 1 OS=Rattus norvegicus GN=Etf1 PE=2 SV=3 1 434 0.0E+00
sp|P62497|ERF1_RABIT Eukaryotic peptide chain release factor subunit 1 OS=Oryctolagus cuniculus GN=ETF1 PE=1 SV=3 1 434 0.0E+00
sp|Q8BWY3|ERF1_MOUSE Eukaryotic peptide chain release factor subunit 1 OS=Mus musculus GN=Etf1 PE=1 SV=4 1 434 0.0E+00
sp|P62496|ERF1_MESAU Eukaryotic peptide chain release factor subunit 1 OS=Mesocricetus auratus GN=ETF1 PE=1 SV=3 1 434 0.0E+00
sp|P62495|ERF1_HUMAN Eukaryotic peptide chain release factor subunit 1 OS=Homo sapiens GN=ETF1 PE=1 SV=3 1 434 0.0E+00
sp|Q0VCX5|ERF1_BOVIN Eukaryotic peptide chain release factor subunit 1 OS=Bos taurus GN=ETF1 PE=2 SV=3 1 434 0.0E+00
sp|Q5R4C7|ERF1_PONAB Eukaryotic peptide chain release factor subunit 1 OS=Pongo abelii GN=ETF1 PE=2 SV=3 1 434 0.0E+00
sp|Q5CD97|ERF1_DIDNA Eukaryotic peptide chain release factor subunit 1 OS=Didinium nasutum GN=eRF1 PE=2 SV=1 8 435 2.0E-180
sp|Q9BMM1|ERF1_STYMT Eukaryotic peptide chain release factor subunit 1 OS=Stylonychia mytilus GN=ERF1 PE=3 SV=1 11 422 7.0E-179
sp|Q9BMM0|ERF1_STYLE Eukaryotic peptide chain release factor subunit 1 OS=Stylonychia lemnae GN=ERF1 PE=3 SV=1 11 421 5.0E-178
sp|Q5CD96|ERF1_DILMA Eukaryotic peptide chain release factor subunit 1 OS=Dileptus margaritifer GN=eRF1 PE=2 SV=1 8 435 1.0E-176
sp|Q9U8U5|ERF1_TETTH Eukaryotic peptide chain release factor subunit 1 OS=Tetrahymena thermophila GN=ERF1 PE=2 SV=1 5 425 1.0E-173
sp|Q9NAX8|ERF1_TRYBB Eukaryotic peptide chain release factor subunit 1 OS=Trypanosoma brucei brucei GN=ERF1 PE=3 SV=1 1 431 4.0E-169
sp|Q5CD84|ERF1_LOXST Eukaryotic peptide chain release factor subunit 1 OS=Loxodes striatus GN=eRF1 PE=2 SV=1 8 434 3.0E-167
sp|Q9NCP1|ERF1_GIAIN Eukaryotic peptide chain release factor subunit 1 OS=Giardia intestinalis GN=ERF1 PE=3 SV=1 4 435 7.0E-159
sp|B6YU52|RF1_THEON Peptide chain release factor subunit 1 OS=Thermococcus onnurineus (strain NA1) GN=prf1 PE=3 SV=1 9 419 2.0E-77
sp|Q5JGK6|RF1_THEKO Peptide chain release factor subunit 1 OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=prf1 PE=3 SV=1 9 419 1.0E-75
sp|Q8U0J4|RF1_PYRFU Peptide chain release factor subunit 1 OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=prf1 PE=3 SV=1 11 419 2.0E-72
sp|O26964|RF1_METTH Peptide chain release factor subunit 1 OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=prf1 PE=3 SV=1 14 417 4.0E-72
sp|Q9V151|RF1_PYRAB Peptide chain release factor subunit 1 OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=prf1 PE=3 SV=2 29 418 1.0E-71
sp|Q2NEL3|RF1_METST Peptide chain release factor subunit 1 OS=Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3) GN=prf1 PE=3 SV=1 1 419 1.0E-71
sp|Q9HKR2|RF1_THEAC Peptide chain release factor subunit 1 OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=prf1 PE=3 SV=1 8 416 3.0E-71
sp|Q8TXB5|RF1_METKA Peptide chain release factor subunit 1 OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=prf1 PE=3 SV=1 12 417 9.0E-71
sp|O59264|RF1_PYRHO Peptide chain release factor subunit 1 OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=prf1 PE=3 SV=1 29 418 1.0E-69
sp|P58227|RF1_THEVO Peptide chain release factor subunit 1 OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=prf1 PE=3 SV=1 12 416 9.0E-69
sp|A5ULL8|RF1_METS3 Peptide chain release factor subunit 1 OS=Methanobrevibacter smithii (strain PS / ATCC 35061 / DSM 861) GN=prf1 PE=3 SV=1 14 418 1.0E-68
sp|C5ZZZ5|RF1_THESM Peptide chain release factor subunit 1 OS=Thermococcus sibiricus (strain MM 739 / DSM 12597) GN=prf1 PE=3 SV=1 29 419 2.0E-68
sp|O29048|RF1_ARCFU Peptide chain release factor subunit 1 OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=prf1 PE=3 SV=1 15 419 7.0E-68
sp|Q6KZ24|RF1_PICTO Peptide chain release factor subunit 1 OS=Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828) GN=prf1 PE=3 SV=1 16 416 7.0E-67
sp|Q12V98|RF1_METBU Peptide chain release factor subunit 1 OS=Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M) GN=prf1 PE=3 SV=1 16 416 7.0E-67
sp|A6UPD8|RF1_METVS Peptide chain release factor subunit 1 OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=prf1 PE=3 SV=1 14 418 4.0E-63
sp|B9LRF2|RF1_HALLT Peptide chain release factor subunit 1 OS=Halorubrum lacusprofundi (strain ATCC 49239 / DSM 5036 / JCM 8891 / ACAM 34) GN=prf1 PE=3 SV=1 2 416 2.0E-62
sp|Q58239|RF1_METJA Peptide chain release factor subunit 1 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=prf1 PE=3 SV=2 14 419 5.0E-62
sp|Q8TS00|RF12_METAC Peptide chain release factor subunit 1-2 OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=prf12 PE=3 SV=1 14 416 3.0E-59
sp|Q9HNF0|RF1_HALSA Peptide chain release factor subunit 1 OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=prf1 PE=3 SV=2 16 416 1.0E-57
sp|B0R748|RF1_HALS3 Peptide chain release factor subunit 1 OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=prf1 PE=1 SV=1 16 416 1.0E-57
sp|Q5UXY3|RF1_HALMA Peptide chain release factor subunit 1 OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=prf1 PE=3 SV=1 1 416 1.0E-57
sp|Q18FC0|RF1_HALWD Peptide chain release factor subunit 1 OS=Haloquadratum walsbyi (strain DSM 16790 / HBSQ001) GN=prf1 PE=3 SV=1 16 416 1.0E-56
sp|Q8PX75|RF1_METMA Peptide chain release factor subunit 1 OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=prf1 PE=1 SV=1 14 416 2.0E-55
sp|Q8TUM4|RF11_METAC Peptide chain release factor subunit 1-1 OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=prf11 PE=3 SV=1 14 416 1.0E-54
sp|A6VG76|RF1_METM7 Peptide chain release factor subunit 1 OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=prf1 PE=3 SV=1 14 418 1.0E-54
sp|P61731|RF1_METMP Peptide chain release factor subunit 1 OS=Methanococcus maripaludis (strain S2 / LL) GN=prf1 PE=3 SV=1 36 418 6.0E-51
sp|A4FX39|RF1_METM5 Peptide chain release factor subunit 1 OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=prf1 PE=3 SV=1 36 418 2.0E-49
sp|A9AAH5|RF1_METM6 Peptide chain release factor subunit 1 OS=Methanococcus maripaludis (strain C6 / ATCC BAA-1332) GN=prf1 PE=3 SV=1 36 418 3.0E-49
sp|Q97W96|RF1_SULSO Peptide chain release factor subunit 1 OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=prf1 PE=3 SV=1 17 418 1.0E-45
sp|Q9YAF1|RF1_AERPE Peptide chain release factor subunit 1 OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=prf1 PE=1 SV=2 17 419 7.0E-44
sp|Q8ZU81|RF1_PYRAE Peptide chain release factor subunit 1 OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=prf1 PE=3 SV=1 17 361 3.0E-39
sp|B8D691|PELO_DESK1 Protein pelota homolog OS=Desulfurococcus kamchatkensis (strain 1221n / DSM 18924) GN=pelA PE=3 SV=1 196 418 4.0E-08
sp|Q4JCI0|PELO_SULAC Protein pelota homolog OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=pelA PE=3 SV=1 206 336 2.0E-06
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1225
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5147
Ophiocordyceps australis map64 (Brazil) OphauB2|6185 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|05007
Ophiocordyceps camponoti-rufipedis Ophun1|4081
Ophiocordyceps kimflemingae Ophio5|3421
Ophiocordyceps subramaniannii Hirsu2|10396

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|6185
MSDAQANEAERNIEIWKVKKLIKRLEAARGNGTSMISLIIPPKDQVSRAAKMLAEEYGTASNIKSRVNRQSVLSA
ITSTQQRLKLYNKVPPNGLVIYCGEILTQEGKERKVNIDFEPFKPINTSLYLCDNKFHTEALAELLESDQKFGFI
VMDGNGALFGTLSGNTRDVVHKFSVDLPKKHGRGGQSALRFARLREEKRHNYVRKVAELAVQNFITNDKVNVAGI
ILAGSADFKNDLNASDMFDNRLQTKVIKVVDVSYGGENGFNQAIELSSETLGNVKFIQEKKLIGKYFEEISQDTG
KVCYGIDDTLKALELGAVETLIVFENLEITRWCLRDSSGSDIILHTTKQQEQGSREQFIDKQTGQEMEIVSQESF
LEWIAEHYKDFGTALEFVSDRSTEGNQFVKGFGGIGGILRYKVNFEQLADLDEDDEYYDD*
Coding >OphauB2|6185
ATGAGCGACGCCCAAGCAAACGAGGCCGAACGCAACATTGAGATATGGAAGGTCAAGAAGCTCATCAAACGCCTT
GAAGCTGCTCGCGGCAATGGGACATCCATGATATCCCTCATCATTCCTCCAAAGGATCAGGTTTCGAGGGCAGCC
AAAATGCTGGCTGAAGAATATGGCACCGCTTCCAATATCAAATCGCGTGTCAATAGGCAGTCAGTTCTTTCTGCC
ATTACGTCTACGCAGCAGCGTCTCAAACTTTACAACAAAGTTCCTCCTAATGGTCTTGTGATTTATTGCGGCGAA
ATTCTGACGCAGGAGGGCAAAGAGCGCAAAGTCAATATCGACTTTGAGCCCTTCAAGCCAATCAATACGTCTCTT
TATCTTTGTGATAATAAATTCCACACCGAGGCCTTGGCCGAGCTGCTCGAGTCGGATCAGAAGTTTGGCTTCATC
GTCATGGACGGCAATGGCGCTCTCTTTGGTACGCTGAGCGGAAATACCCGCGATGTTGTCCATAAATTTTCGGTT
GATCTTCCCAAGAAGCACGGCCGTGGTGGTCAGTCGGCCTTGCGTTTTGCCCGCCTTCGTGAAGAGAAGCGTCAC
AACTACGTCCGCAAGGTGGCCGAATTGGCTGTGCAAAATTTCATCACCAATGACAAGGTTAATGTTGCTGGCATC
ATTCTTGCCGGCTCTGCCGATTTCAAAAACGACCTCAACGCATCTGACATGTTTGATAACCGCCTTCAAACCAAG
GTCATCAAGGTGGTCGACGTGTCTTATGGCGGCGAGAATGGATTTAATCAGGCTATTGAGCTGTCCTCGGAGACT
TTGGGCAACGTCAAATTTATCCAGGAGAAGAAGCTCATTGGCAAATATTTTGAGGAAATTAGCCAAGACACCGGA
AAGGTCTGTTACGGCATCGATGATACGCTCAAAGCTCTCGAACTCGGTGCGGTTGAGACGCTTATTGTATTTGAG
AACCTGGAAATTACTCGTTGGTGCCTCAGAGATAGCAGTGGAAGCGACATCATCCTTCACACCACCAAGCAACAG
GAGCAGGGCAGCCGCGAACAGTTTATTGACAAACAAACAGGGCAAGAAATGGAAATTGTGTCGCAGGAATCTTTT
CTTGAATGGATTGCCGAGCACTACAAGGACTTTGGCACGGCTCTAGAGTTTGTGTCTGATAGGTCCACAGAAGGC
AACCAGTTCGTCAAGGGCTTTGGAGGAATTGGGGGCATTCTACGCTACAAGGTCAACTTTGAGCAGTTGGCTGAT
TTGGATGAAGATGACGAGTACTACGACGATTGA
Transcript >OphauB2|6185
ATGAGCGACGCCCAAGCAAACGAGGCCGAACGCAACATTGAGATATGGAAGGTCAAGAAGCTCATCAAACGCCTT
GAAGCTGCTCGCGGCAATGGGACATCCATGATATCCCTCATCATTCCTCCAAAGGATCAGGTTTCGAGGGCAGCC
AAAATGCTGGCTGAAGAATATGGCACCGCTTCCAATATCAAATCGCGTGTCAATAGGCAGTCAGTTCTTTCTGCC
ATTACGTCTACGCAGCAGCGTCTCAAACTTTACAACAAAGTTCCTCCTAATGGTCTTGTGATTTATTGCGGCGAA
ATTCTGACGCAGGAGGGCAAAGAGCGCAAAGTCAATATCGACTTTGAGCCCTTCAAGCCAATCAATACGTCTCTT
TATCTTTGTGATAATAAATTCCACACCGAGGCCTTGGCCGAGCTGCTCGAGTCGGATCAGAAGTTTGGCTTCATC
GTCATGGACGGCAATGGCGCTCTCTTTGGTACGCTGAGCGGAAATACCCGCGATGTTGTCCATAAATTTTCGGTT
GATCTTCCCAAGAAGCACGGCCGTGGTGGTCAGTCGGCCTTGCGTTTTGCCCGCCTTCGTGAAGAGAAGCGTCAC
AACTACGTCCGCAAGGTGGCCGAATTGGCTGTGCAAAATTTCATCACCAATGACAAGGTTAATGTTGCTGGCATC
ATTCTTGCCGGCTCTGCCGATTTCAAAAACGACCTCAACGCATCTGACATGTTTGATAACCGCCTTCAAACCAAG
GTCATCAAGGTGGTCGACGTGTCTTATGGCGGCGAGAATGGATTTAATCAGGCTATTGAGCTGTCCTCGGAGACT
TTGGGCAACGTCAAATTTATCCAGGAGAAGAAGCTCATTGGCAAATATTTTGAGGAAATTAGCCAAGACACCGGA
AAGGTCTGTTACGGCATCGATGATACGCTCAAAGCTCTCGAACTCGGTGCGGTTGAGACGCTTATTGTATTTGAG
AACCTGGAAATTACTCGTTGGTGCCTCAGAGATAGCAGTGGAAGCGACATCATCCTTCACACCACCAAGCAACAG
GAGCAGGGCAGCCGCGAACAGTTTATTGACAAACAAACAGGGCAAGAAATGGAAATTGTGTCGCAGGAATCTTTT
CTTGAATGGATTGCCGAGCACTACAAGGACTTTGGCACGGCTCTAGAGTTTGTGTCTGATAGGTCCACAGAAGGC
AACCAGTTCGTCAAGGGCTTTGGAGGAATTGGGGGCATTCTACGCTACAAGGTCAACTTTGAGCAGTTGGCTGAT
TTGGATGAAGATGACGAGTACTACGACGATTGA
Gene >OphauB2|6185
ATGAGCGACGCCCAAGCAAACGAGGCCGAACGCAACGTGAGTGCTTGTCGTGATGCATGTCGCTACAGGCCACAC
ATTTTTCACCCCCGCTACCCCGCGATAGGGGGTTATGACGCGACAAGTCGACCATTTGTCAATATCAGCGTCGCG
CTGAACATGCGGTGCTAATACGGCTTGCTCCCGCAGATTGAGATATGGAAGGTCAAGAAGCTCATCAAACGCCTT
GAAGCTGCTCGCGGCAATGGGACATCCATGATATCCCTCATCATTCGTGCGTCGTTGTCATTCAACTTGGCCCAC
CGACGAACATGCCGCTGACCGGGTGTCCAGCTCCAAAGGATCAGGTTTCGAGGGCAGCCAAAATGCTGGCTGAAG
AATATGTTGGTTCACTCTGGTCCTGTGGTGCCGTGCCGTATGTGCCACTAATTGTCTCCAATGCTAGGGCACCGC
TTCCAATATCAAATCGCGTGTCAATAGGCAGTCAGTTCTTTCTGCCATTACGTCTACGCAGCAGCGTCTCAAACT
TTACAACAAAGTTCCTCCTAATGGTCTTGTGATTTATTGCGGCGAAATTCTGACGCAGGAGGGCAAAGAGCGCAA
AGTCAATATCGACTTTGAGCCCTTCAAGCCAATCAATACGTCTCTTTATCTTTGTGATAATAAATTCCACACCGA
GGCCTTGGCCGAGCTGCTCGAGTCGGATCAGAAGTTTGGCTTCATCGTCATGGACGGCAATGGCGCTCTCTTTGG
TACGCTGAGCGGAAATACCCGCGATGTTGTCCATAAATTTTCGGTTGATCTTCCCAAGAAGCACGGCCGTGGTGG
TCAGTCGGCCTTGCGTTTTGCCCGCCTTCGTGAAGAGAAGCGTCACAACTACGTCCGCAAGGTGGCCGAATTGGC
TGTGCAAAATTTCATCACCAATGACAAGGTTAATGTTGCTGGCATCATTCTTGCCGGCTCTGCCGATTTCAAAAA
CGACCTCAACGCATCTGACATGTTTGATAACCGCCTTCAAACCAAGGTCATCAAGGTGGTCGACGTGTCTTATGG
CGGCGAGAATGGATTTAATCAGGCTATTGAGCTGTCCTCGGAGACTTTGGGCAACGTCAAATTTATCCAGGAGAA
GAAGCTCATTGGCAAATATTTTGAGGAAATTAGCCAAGACACCGGAAAGGTCTGTTACGGCATCGATGATACGCT
CAAAGCTCTCGAACTCGGTGCGGTTGAGACGCTTATTGTATTTGAGAACCTGGAAATTACTCGTTGGTGCCTCAG
AGATAGCAGTGGAAGCGACATCATCCTTCACACCACCAAGCAACAGGAGCAGGGCAGCCGCGAACAGTTTATTGA
CAAACAAACAGGGCAAGAAATGGAAATTGTGTCGCAGGAATCTTTTCTTGAATGGATTGCCGAGCACTACAAGGA
CTTTGGCACGGCTCTAGAGTTTGTGTCTGATAGGTCCACAGAAGGCAACCAGTTCGTCAAGGGCTTTGGAGGAAT
TGGGGGCATTCTACGCTACAAGGTCAACTTTGAGCAGTTGGCTGATTTGGATGAAGATGACGAGTACTACGACGG
TGAGCAAGGGTTGGCATCAAGGTTCTCTGCACATGGACGGCTAACTCTGTGGACACAGATTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail