Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|6185
Gene name
LocationContig_54:74341..75979
Strand+
Gene length (bp)1638
Transcript length (bp)1308
Coding sequence length (bp)1308
Protein length (aa) 436

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03464 eRF1_2 eRF1 domain 2 1.7E-47 146 276
PF03465 eRF1_3 eRF1 domain 3 5.2E-40 281 418
PF03463 eRF1_1 eRF1 domain 1 1.5E-13 19 140
PF18854 baeRF_family10 Bacterial archaeo-eukaryotic release factor family 10 7.8E-08 134 255
PF18859 acVLRF1 Actinobacteria/chloroflexi VLRF1 release factor 2.8E-06 157 239

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q39097|ERF1X_ARATH Eukaryotic peptide chain release factor subunit 1-1 OS=Arabidopsis thaliana GN=ERF1-1 PE=1 SV=2 7 435 0.0E+00
sp|O59948|ERF1_PODAS Eukaryotic peptide chain release factor subunit 1 OS=Podospora anserina GN=SU2 PE=3 SV=1 1 426 0.0E+00
sp|Q9BMX3|ERF1_OXYTR Eukaryotic peptide chain release factor subunit 1 OS=Oxytricha trifallax GN=ERF1 PE=3 SV=1 11 421 0.0E+00
sp|Q9BMM3|ERF1_BLEAM Eukaryotic peptide chain release factor subunit 1 OS=Blepharisma americanum GN=eRF1 PE=2 SV=1 5 423 0.0E+00
sp|Q5CD95|ERF1_BLEMU Eukaryotic peptide chain release factor subunit 1 OS=Blepharisma musculus GN=eRF1 PE=2 SV=1 5 423 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q39097|ERF1X_ARATH Eukaryotic peptide chain release factor subunit 1-1 OS=Arabidopsis thaliana GN=ERF1-1 PE=1 SV=2 7 435 0.0E+00
sp|O59948|ERF1_PODAS Eukaryotic peptide chain release factor subunit 1 OS=Podospora anserina GN=SU2 PE=3 SV=1 1 426 0.0E+00
sp|Q9BMX3|ERF1_OXYTR Eukaryotic peptide chain release factor subunit 1 OS=Oxytricha trifallax GN=ERF1 PE=3 SV=1 11 421 0.0E+00
sp|Q9BMM3|ERF1_BLEAM Eukaryotic peptide chain release factor subunit 1 OS=Blepharisma americanum GN=eRF1 PE=2 SV=1 5 423 0.0E+00
sp|Q5CD95|ERF1_BLEMU Eukaryotic peptide chain release factor subunit 1 OS=Blepharisma musculus GN=eRF1 PE=2 SV=1 5 423 0.0E+00
sp|Q5CG95|ERF1_CRYHO Eukaryotic peptide chain release factor subunit 1 OS=Cryptosporidium hominis GN=erf1 PE=3 SV=1 12 432 0.0E+00
sp|Q9BMX0|ERF1_DICDI Eukaryotic peptide chain release factor subunit 1 OS=Dictyostelium discoideum GN=erf1 PE=2 SV=2 3 435 0.0E+00
sp|P79063|ERF1_SCHPO Eukaryotic peptide chain release factor subunit 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sup45 PE=1 SV=1 9 435 0.0E+00
sp|Q9LPV8|ERF1Y_ARATH Eukaryotic peptide chain release factor subunit 1-2 OS=Arabidopsis thaliana GN=ERF1-2 PE=1 SV=1 6 435 0.0E+00
sp|P35614|ERF1Z_ARATH Eukaryotic peptide chain release factor subunit 1-3 OS=Arabidopsis thaliana GN=ERF1-3 PE=1 SV=1 8 435 0.0E+00
sp|O16520|ERF1_CAEEL Eukaryotic peptide chain release factor subunit 1 OS=Caenorhabditis elegans GN=erfa-1 PE=3 SV=2 11 423 0.0E+00
sp|P12385|ERF1_YEAST Eukaryotic peptide chain release factor subunit 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SUP45 PE=1 SV=2 7 435 0.0E+00
sp|P35615|ERF1_XENLA Eukaryotic peptide chain release factor subunit 1 OS=Xenopus laevis GN=etf1 PE=2 SV=1 1 434 0.0E+00
sp|P62498|ERF1_XENTR Eukaryotic peptide chain release factor subunit 1 OS=Xenopus tropicalis GN=etf1 PE=2 SV=1 1 434 0.0E+00
sp|Q9GR88|ERF1_POLMI Eukaryotic peptide chain release factor subunit 1 OS=Polyandrocarpa misakiensis GN=ERF1 PE=2 SV=1 9 423 0.0E+00
sp|Q9VPH7|ERF1_DROME Eukaryotic peptide chain release factor subunit 1 OS=Drosophila melanogaster GN=eRF1 PE=1 SV=2 9 435 0.0E+00
sp|Q5U2Q7|ERF1_RAT Eukaryotic peptide chain release factor subunit 1 OS=Rattus norvegicus GN=Etf1 PE=2 SV=3 1 434 0.0E+00
sp|P62497|ERF1_RABIT Eukaryotic peptide chain release factor subunit 1 OS=Oryctolagus cuniculus GN=ETF1 PE=1 SV=3 1 434 0.0E+00
sp|Q8BWY3|ERF1_MOUSE Eukaryotic peptide chain release factor subunit 1 OS=Mus musculus GN=Etf1 PE=1 SV=4 1 434 0.0E+00
sp|P62496|ERF1_MESAU Eukaryotic peptide chain release factor subunit 1 OS=Mesocricetus auratus GN=ETF1 PE=1 SV=3 1 434 0.0E+00
sp|P62495|ERF1_HUMAN Eukaryotic peptide chain release factor subunit 1 OS=Homo sapiens GN=ETF1 PE=1 SV=3 1 434 0.0E+00
sp|Q0VCX5|ERF1_BOVIN Eukaryotic peptide chain release factor subunit 1 OS=Bos taurus GN=ETF1 PE=2 SV=3 1 434 0.0E+00
sp|Q5R4C7|ERF1_PONAB Eukaryotic peptide chain release factor subunit 1 OS=Pongo abelii GN=ETF1 PE=2 SV=3 1 434 0.0E+00
sp|Q5CD97|ERF1_DIDNA Eukaryotic peptide chain release factor subunit 1 OS=Didinium nasutum GN=eRF1 PE=2 SV=1 8 435 2.0E-180
sp|Q9BMM1|ERF1_STYMT Eukaryotic peptide chain release factor subunit 1 OS=Stylonychia mytilus GN=ERF1 PE=3 SV=1 11 422 7.0E-179
sp|Q9BMM0|ERF1_STYLE Eukaryotic peptide chain release factor subunit 1 OS=Stylonychia lemnae GN=ERF1 PE=3 SV=1 11 421 5.0E-178
sp|Q5CD96|ERF1_DILMA Eukaryotic peptide chain release factor subunit 1 OS=Dileptus margaritifer GN=eRF1 PE=2 SV=1 8 435 1.0E-176
sp|Q9U8U5|ERF1_TETTH Eukaryotic peptide chain release factor subunit 1 OS=Tetrahymena thermophila GN=ERF1 PE=2 SV=1 5 425 1.0E-173
sp|Q9NAX8|ERF1_TRYBB Eukaryotic peptide chain release factor subunit 1 OS=Trypanosoma brucei brucei GN=ERF1 PE=3 SV=1 1 431 4.0E-169
sp|Q5CD84|ERF1_LOXST Eukaryotic peptide chain release factor subunit 1 OS=Loxodes striatus GN=eRF1 PE=2 SV=1 8 434 3.0E-167
sp|Q9NCP1|ERF1_GIAIN Eukaryotic peptide chain release factor subunit 1 OS=Giardia intestinalis GN=ERF1 PE=3 SV=1 4 435 7.0E-159
sp|B6YU52|RF1_THEON Peptide chain release factor subunit 1 OS=Thermococcus onnurineus (strain NA1) GN=prf1 PE=3 SV=1 9 419 2.0E-77
sp|Q5JGK6|RF1_THEKO Peptide chain release factor subunit 1 OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=prf1 PE=3 SV=1 9 419 1.0E-75
sp|Q8U0J4|RF1_PYRFU Peptide chain release factor subunit 1 OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=prf1 PE=3 SV=1 11 419 2.0E-72
sp|O26964|RF1_METTH Peptide chain release factor subunit 1 OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=prf1 PE=3 SV=1 14 417 4.0E-72
sp|Q9V151|RF1_PYRAB Peptide chain release factor subunit 1 OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=prf1 PE=3 SV=2 29 418 1.0E-71
sp|Q2NEL3|RF1_METST Peptide chain release factor subunit 1 OS=Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3) GN=prf1 PE=3 SV=1 1 419 1.0E-71
sp|Q9HKR2|RF1_THEAC Peptide chain release factor subunit 1 OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=prf1 PE=3 SV=1 8 416 3.0E-71
sp|Q8TXB5|RF1_METKA Peptide chain release factor subunit 1 OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=prf1 PE=3 SV=1 12 417 9.0E-71
sp|O59264|RF1_PYRHO Peptide chain release factor subunit 1 OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=prf1 PE=3 SV=1 29 418 1.0E-69
sp|P58227|RF1_THEVO Peptide chain release factor subunit 1 OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=prf1 PE=3 SV=1 12 416 9.0E-69
sp|A5ULL8|RF1_METS3 Peptide chain release factor subunit 1 OS=Methanobrevibacter smithii (strain PS / ATCC 35061 / DSM 861) GN=prf1 PE=3 SV=1 14 418 1.0E-68
sp|C5ZZZ5|RF1_THESM Peptide chain release factor subunit 1 OS=Thermococcus sibiricus (strain MM 739 / DSM 12597) GN=prf1 PE=3 SV=1 29 419 2.0E-68
sp|O29048|RF1_ARCFU Peptide chain release factor subunit 1 OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=prf1 PE=3 SV=1 15 419 7.0E-68
sp|Q6KZ24|RF1_PICTO Peptide chain release factor subunit 1 OS=Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828) GN=prf1 PE=3 SV=1 16 416 7.0E-67
sp|Q12V98|RF1_METBU Peptide chain release factor subunit 1 OS=Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M) GN=prf1 PE=3 SV=1 16 416 7.0E-67
sp|A6UPD8|RF1_METVS Peptide chain release factor subunit 1 OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=prf1 PE=3 SV=1 14 418 4.0E-63
sp|B9LRF2|RF1_HALLT Peptide chain release factor subunit 1 OS=Halorubrum lacusprofundi (strain ATCC 49239 / DSM 5036 / JCM 8891 / ACAM 34) GN=prf1 PE=3 SV=1 2 416 2.0E-62
sp|Q58239|RF1_METJA Peptide chain release factor subunit 1 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=prf1 PE=3 SV=2 14 419 5.0E-62
sp|Q8TS00|RF12_METAC Peptide chain release factor subunit 1-2 OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=prf12 PE=3 SV=1 14 416 3.0E-59
sp|Q9HNF0|RF1_HALSA Peptide chain release factor subunit 1 OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=prf1 PE=3 SV=2 16 416 1.0E-57
sp|B0R748|RF1_HALS3 Peptide chain release factor subunit 1 OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=prf1 PE=1 SV=1 16 416 1.0E-57
sp|Q5UXY3|RF1_HALMA Peptide chain release factor subunit 1 OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=prf1 PE=3 SV=1 1 416 1.0E-57
sp|Q18FC0|RF1_HALWD Peptide chain release factor subunit 1 OS=Haloquadratum walsbyi (strain DSM 16790 / HBSQ001) GN=prf1 PE=3 SV=1 16 416 1.0E-56
sp|Q8PX75|RF1_METMA Peptide chain release factor subunit 1 OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=prf1 PE=1 SV=1 14 416 2.0E-55
sp|Q8TUM4|RF11_METAC Peptide chain release factor subunit 1-1 OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=prf11 PE=3 SV=1 14 416 1.0E-54
sp|A6VG76|RF1_METM7 Peptide chain release factor subunit 1 OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=prf1 PE=3 SV=1 14 418 1.0E-54
sp|P61731|RF1_METMP Peptide chain release factor subunit 1 OS=Methanococcus maripaludis (strain S2 / LL) GN=prf1 PE=3 SV=1 36 418 6.0E-51
sp|A4FX39|RF1_METM5 Peptide chain release factor subunit 1 OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=prf1 PE=3 SV=1 36 418 2.0E-49
sp|A9AAH5|RF1_METM6 Peptide chain release factor subunit 1 OS=Methanococcus maripaludis (strain C6 / ATCC BAA-1332) GN=prf1 PE=3 SV=1 36 418 3.0E-49
sp|Q97W96|RF1_SULSO Peptide chain release factor subunit 1 OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=prf1 PE=3 SV=1 17 418 1.0E-45
sp|Q9YAF1|RF1_AERPE Peptide chain release factor subunit 1 OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=prf1 PE=1 SV=2 17 419 7.0E-44
sp|Q8ZU81|RF1_PYRAE Peptide chain release factor subunit 1 OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=prf1 PE=3 SV=1 17 361 3.0E-39
sp|B8D691|PELO_DESK1 Protein pelota homolog OS=Desulfurococcus kamchatkensis (strain 1221n / DSM 18924) GN=pelA PE=3 SV=1 196 418 4.0E-08
sp|Q4JCI0|PELO_SULAC Protein pelota homolog OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=pelA PE=3 SV=1 206 336 2.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 50 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|6185
MSDAQANEAERNIEIWKVKKLIKRLEAARGNGTSMISLIIPPKDQVSRAAKMLAEEYGTASNIKSRVNRQSVLSA
ITSTQQRLKLYNKVPPNGLVIYCGEILTQEGKERKVNIDFEPFKPINTSLYLCDNKFHTEALAELLESDQKFGFI
VMDGNGALFGTLSGNTRDVVHKFSVDLPKKHGRGGQSALRFARLREEKRHNYVRKVAELAVQNFITNDKVNVAGI
ILAGSADFKNDLNASDMFDNRLQTKVIKVVDVSYGGENGFNQAIELSSETLGNVKFIQEKKLIGKYFEEISQDTG
KVCYGIDDTLKALELGAVETLIVFENLEITRWCLRDSSGSDIILHTTKQQEQGSREQFIDKQTGQEMEIVSQESF
LEWIAEHYKDFGTALEFVSDRSTEGNQFVKGFGGIGGILRYKVNFEQLADLDEDDEYYDD*
Coding >OphauB2|6185
ATGAGCGACGCCCAAGCAAACGAGGCCGAACGCAACATTGAGATATGGAAGGTCAAGAAGCTCATCAAACGCCTT
GAAGCTGCTCGCGGCAATGGGACATCCATGATATCCCTCATCATTCCTCCAAAGGATCAGGTTTCGAGGGCAGCC
AAAATGCTGGCTGAAGAATATGGCACCGCTTCCAATATCAAATCGCGTGTCAATAGGCAGTCAGTTCTTTCTGCC
ATTACGTCTACGCAGCAGCGTCTCAAACTTTACAACAAAGTTCCTCCTAATGGTCTTGTGATTTATTGCGGCGAA
ATTCTGACGCAGGAGGGCAAAGAGCGCAAAGTCAATATCGACTTTGAGCCCTTCAAGCCAATCAATACGTCTCTT
TATCTTTGTGATAATAAATTCCACACCGAGGCCTTGGCCGAGCTGCTCGAGTCGGATCAGAAGTTTGGCTTCATC
GTCATGGACGGCAATGGCGCTCTCTTTGGTACGCTGAGCGGAAATACCCGCGATGTTGTCCATAAATTTTCGGTT
GATCTTCCCAAGAAGCACGGCCGTGGTGGTCAGTCGGCCTTGCGTTTTGCCCGCCTTCGTGAAGAGAAGCGTCAC
AACTACGTCCGCAAGGTGGCCGAATTGGCTGTGCAAAATTTCATCACCAATGACAAGGTTAATGTTGCTGGCATC
ATTCTTGCCGGCTCTGCCGATTTCAAAAACGACCTCAACGCATCTGACATGTTTGATAACCGCCTTCAAACCAAG
GTCATCAAGGTGGTCGACGTGTCTTATGGCGGCGAGAATGGATTTAATCAGGCTATTGAGCTGTCCTCGGAGACT
TTGGGCAACGTCAAATTTATCCAGGAGAAGAAGCTCATTGGCAAATATTTTGAGGAAATTAGCCAAGACACCGGA
AAGGTCTGTTACGGCATCGATGATACGCTCAAAGCTCTCGAACTCGGTGCGGTTGAGACGCTTATTGTATTTGAG
AACCTGGAAATTACTCGTTGGTGCCTCAGAGATAGCAGTGGAAGCGACATCATCCTTCACACCACCAAGCAACAG
GAGCAGGGCAGCCGCGAACAGTTTATTGACAAACAAACAGGGCAAGAAATGGAAATTGTGTCGCAGGAATCTTTT
CTTGAATGGATTGCCGAGCACTACAAGGACTTTGGCACGGCTCTAGAGTTTGTGTCTGATAGGTCCACAGAAGGC
AACCAGTTCGTCAAGGGCTTTGGAGGAATTGGGGGCATTCTACGCTACAAGGTCAACTTTGAGCAGTTGGCTGAT
TTGGATGAAGATGACGAGTACTACGACGATTGA
Transcript >OphauB2|6185
ATGAGCGACGCCCAAGCAAACGAGGCCGAACGCAACATTGAGATATGGAAGGTCAAGAAGCTCATCAAACGCCTT
GAAGCTGCTCGCGGCAATGGGACATCCATGATATCCCTCATCATTCCTCCAAAGGATCAGGTTTCGAGGGCAGCC
AAAATGCTGGCTGAAGAATATGGCACCGCTTCCAATATCAAATCGCGTGTCAATAGGCAGTCAGTTCTTTCTGCC
ATTACGTCTACGCAGCAGCGTCTCAAACTTTACAACAAAGTTCCTCCTAATGGTCTTGTGATTTATTGCGGCGAA
ATTCTGACGCAGGAGGGCAAAGAGCGCAAAGTCAATATCGACTTTGAGCCCTTCAAGCCAATCAATACGTCTCTT
TATCTTTGTGATAATAAATTCCACACCGAGGCCTTGGCCGAGCTGCTCGAGTCGGATCAGAAGTTTGGCTTCATC
GTCATGGACGGCAATGGCGCTCTCTTTGGTACGCTGAGCGGAAATACCCGCGATGTTGTCCATAAATTTTCGGTT
GATCTTCCCAAGAAGCACGGCCGTGGTGGTCAGTCGGCCTTGCGTTTTGCCCGCCTTCGTGAAGAGAAGCGTCAC
AACTACGTCCGCAAGGTGGCCGAATTGGCTGTGCAAAATTTCATCACCAATGACAAGGTTAATGTTGCTGGCATC
ATTCTTGCCGGCTCTGCCGATTTCAAAAACGACCTCAACGCATCTGACATGTTTGATAACCGCCTTCAAACCAAG
GTCATCAAGGTGGTCGACGTGTCTTATGGCGGCGAGAATGGATTTAATCAGGCTATTGAGCTGTCCTCGGAGACT
TTGGGCAACGTCAAATTTATCCAGGAGAAGAAGCTCATTGGCAAATATTTTGAGGAAATTAGCCAAGACACCGGA
AAGGTCTGTTACGGCATCGATGATACGCTCAAAGCTCTCGAACTCGGTGCGGTTGAGACGCTTATTGTATTTGAG
AACCTGGAAATTACTCGTTGGTGCCTCAGAGATAGCAGTGGAAGCGACATCATCCTTCACACCACCAAGCAACAG
GAGCAGGGCAGCCGCGAACAGTTTATTGACAAACAAACAGGGCAAGAAATGGAAATTGTGTCGCAGGAATCTTTT
CTTGAATGGATTGCCGAGCACTACAAGGACTTTGGCACGGCTCTAGAGTTTGTGTCTGATAGGTCCACAGAAGGC
AACCAGTTCGTCAAGGGCTTTGGAGGAATTGGGGGCATTCTACGCTACAAGGTCAACTTTGAGCAGTTGGCTGAT
TTGGATGAAGATGACGAGTACTACGACGATTGA
Gene >OphauB2|6185
ATGAGCGACGCCCAAGCAAACGAGGCCGAACGCAACGTGAGTGCTTGTCGTGATGCATGTCGCTACAGGCCACAC
ATTTTTCACCCCCGCTACCCCGCGATAGGGGGTTATGACGCGACAAGTCGACCATTTGTCAATATCAGCGTCGCG
CTGAACATGCGGTGCTAATACGGCTTGCTCCCGCAGATTGAGATATGGAAGGTCAAGAAGCTCATCAAACGCCTT
GAAGCTGCTCGCGGCAATGGGACATCCATGATATCCCTCATCATTCGTGCGTCGTTGTCATTCAACTTGGCCCAC
CGACGAACATGCCGCTGACCGGGTGTCCAGCTCCAAAGGATCAGGTTTCGAGGGCAGCCAAAATGCTGGCTGAAG
AATATGTTGGTTCACTCTGGTCCTGTGGTGCCGTGCCGTATGTGCCACTAATTGTCTCCAATGCTAGGGCACCGC
TTCCAATATCAAATCGCGTGTCAATAGGCAGTCAGTTCTTTCTGCCATTACGTCTACGCAGCAGCGTCTCAAACT
TTACAACAAAGTTCCTCCTAATGGTCTTGTGATTTATTGCGGCGAAATTCTGACGCAGGAGGGCAAAGAGCGCAA
AGTCAATATCGACTTTGAGCCCTTCAAGCCAATCAATACGTCTCTTTATCTTTGTGATAATAAATTCCACACCGA
GGCCTTGGCCGAGCTGCTCGAGTCGGATCAGAAGTTTGGCTTCATCGTCATGGACGGCAATGGCGCTCTCTTTGG
TACGCTGAGCGGAAATACCCGCGATGTTGTCCATAAATTTTCGGTTGATCTTCCCAAGAAGCACGGCCGTGGTGG
TCAGTCGGCCTTGCGTTTTGCCCGCCTTCGTGAAGAGAAGCGTCACAACTACGTCCGCAAGGTGGCCGAATTGGC
TGTGCAAAATTTCATCACCAATGACAAGGTTAATGTTGCTGGCATCATTCTTGCCGGCTCTGCCGATTTCAAAAA
CGACCTCAACGCATCTGACATGTTTGATAACCGCCTTCAAACCAAGGTCATCAAGGTGGTCGACGTGTCTTATGG
CGGCGAGAATGGATTTAATCAGGCTATTGAGCTGTCCTCGGAGACTTTGGGCAACGTCAAATTTATCCAGGAGAA
GAAGCTCATTGGCAAATATTTTGAGGAAATTAGCCAAGACACCGGAAAGGTCTGTTACGGCATCGATGATACGCT
CAAAGCTCTCGAACTCGGTGCGGTTGAGACGCTTATTGTATTTGAGAACCTGGAAATTACTCGTTGGTGCCTCAG
AGATAGCAGTGGAAGCGACATCATCCTTCACACCACCAAGCAACAGGAGCAGGGCAGCCGCGAACAGTTTATTGA
CAAACAAACAGGGCAAGAAATGGAAATTGTGTCGCAGGAATCTTTTCTTGAATGGATTGCCGAGCACTACAAGGA
CTTTGGCACGGCTCTAGAGTTTGTGTCTGATAGGTCCACAGAAGGCAACCAGTTCGTCAAGGGCTTTGGAGGAAT
TGGGGGCATTCTACGCTACAAGGTCAACTTTGAGCAGTTGGCTGATTTGGATGAAGATGACGAGTACTACGACGG
TGAGCAAGGGTTGGCATCAAGGTTCTCTGCACATGGACGGCTAACTCTGTGGACACAGATTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail