Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|6176
Gene name
LocationContig_54:59436..60021
Strand+
Gene length (bp)585
Transcript length (bp)399
Coding sequence length (bp)399
Protein length (aa) 133

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain 3.2E-30 44 115
PF01193 RNA_pol_L RNA polymerase Rpb3/Rpb11 dimerisation domain 4.7E-13 45 110

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P28000|RPAC2_YEAST DNA-directed RNA polymerases I and III subunit RPAC2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPC19 PE=1 SV=1 28 117 2.0E-34
sp|Q09177|RPAC2_SCHPO DNA-directed RNA polymerases I and III subunit RPAC2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpc19 PE=2 SV=1 6 123 2.0E-32
sp|Q5XK67|RPAC2_XENLA DNA-directed RNA polymerases I and III subunit RPAC2 OS=Xenopus laevis GN=polr1d PE=3 SV=1 21 125 9.0E-25
sp|Q9VIZ0|RPAC2_DROME Probable DNA-directed RNA polymerases I and III subunit RPAC2 OS=Drosophila melanogaster GN=l(2)37Cg PE=3 SV=1 41 126 8.0E-24
sp|Q1RMG8|RPAC2_BOVIN DNA-directed RNA polymerases I and III subunit RPAC2 OS=Bos taurus GN=POLR1D PE=2 SV=1 38 125 2.0E-23
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P28000|RPAC2_YEAST DNA-directed RNA polymerases I and III subunit RPAC2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPC19 PE=1 SV=1 28 117 2.0E-34
sp|Q09177|RPAC2_SCHPO DNA-directed RNA polymerases I and III subunit RPAC2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpc19 PE=2 SV=1 6 123 2.0E-32
sp|Q5XK67|RPAC2_XENLA DNA-directed RNA polymerases I and III subunit RPAC2 OS=Xenopus laevis GN=polr1d PE=3 SV=1 21 125 9.0E-25
sp|Q9VIZ0|RPAC2_DROME Probable DNA-directed RNA polymerases I and III subunit RPAC2 OS=Drosophila melanogaster GN=l(2)37Cg PE=3 SV=1 41 126 8.0E-24
sp|Q1RMG8|RPAC2_BOVIN DNA-directed RNA polymerases I and III subunit RPAC2 OS=Bos taurus GN=POLR1D PE=2 SV=1 38 125 2.0E-23
sp|Q9Y2S0|RPAC2_HUMAN DNA-directed RNA polymerases I and III subunit RPAC2 OS=Homo sapiens GN=POLR1D PE=1 SV=1 38 125 8.0E-23
sp|P97304|RPAC2_MOUSE DNA-directed RNA polymerases I and III subunit RPAC2 OS=Mus musculus GN=Polr1d PE=1 SV=1 38 129 2.0E-22
sp|Q54ES6|RPC19_DICDI DNA-directed RNA polymerases I and III subunit rpc19 OS=Dictyostelium discoideum GN=rpc19 PE=3 SV=1 29 122 2.0E-22
sp|Q6DRI4|RPAC2_DANRE DNA-directed RNA polymerases I and III subunit RPAC2 OS=Danio rerio GN=polr1d PE=3 SV=1 38 125 2.0E-21
sp|Q61IX2|RPAC2_CAEBR Probable DNA-directed RNA polymerases I and III subunit RPAC2 OS=Caenorhabditis briggsae GN=rpac-19 PE=3 SV=1 50 120 3.0E-12
sp|P34476|RPAC2_CAEEL Probable DNA-directed RNA polymerases I and III subunit RPAC2 OS=Caenorhabditis elegans GN=rpac-19 PE=3 SV=1 50 120 6.0E-12
sp|Q7PVQ9|RPB11_ANOGA DNA-directed RNA polymerase II subunit RPB11 OS=Anopheles gambiae GN=Rpb11 PE=3 SV=2 27 120 2.0E-11
sp|Q9VJE4|RPB11_DROME DNA-directed RNA polymerase II subunit RPB11 OS=Drosophila melanogaster GN=Rpb11 PE=3 SV=1 27 120 1.0E-10
sp|Q9XVH6|RPB11_CAEEL Probable DNA-directed RNA polymerase II subunit RPB11 OS=Caenorhabditis elegans GN=rpb-11 PE=3 SV=1 42 106 1.0E-09
sp|Q60SM4|RPB11_CAEBR Probable DNA-directed RNA polymerase II subunit RPB11 OS=Caenorhabditis briggsae GN=rpb-11 PE=3 SV=1 42 106 1.0E-09
sp|Q38859|NRPBB_ARATH DNA-directed RNA polymerases II, IV and V subunit 11 OS=Arabidopsis thaliana GN=NRPB11 PE=1 SV=1 42 118 1.0E-08
sp|P52435|RPB11_HUMAN DNA-directed RNA polymerase II subunit RPB11-a OS=Homo sapiens GN=POLR2J PE=1 SV=1 42 120 1.0E-08
sp|Q32P79|RPB11_BOVIN DNA-directed RNA polymerase II subunit RPB11 OS=Bos taurus GN=POLR2J PE=3 SV=1 42 120 1.0E-08
sp|Q9H1A7|RPB1C_HUMAN DNA-directed RNA polymerase II subunit RPB11-b2 OS=Homo sapiens GN=POLR2J3 PE=3 SV=1 42 120 2.0E-08
sp|Q9GZM3|RPB1B_HUMAN DNA-directed RNA polymerase II subunit RPB11-b1 OS=Homo sapiens GN=POLR2J2 PE=1 SV=2 42 120 2.0E-08
sp|O08740|RPB11_MOUSE DNA-directed RNA polymerase II subunit RPB11 OS=Mus musculus GN=Polr2j PE=1 SV=1 42 120 2.0E-08
sp|Q57832|RPOL_METJA DNA-directed RNA polymerase subunit L OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=rpoL PE=1 SV=1 41 121 2.0E-07
sp|P38902|RPB11_YEAST DNA-directed RNA polymerase II subunit RPB11 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPB11 PE=1 SV=1 42 127 6.0E-07
sp|Q86JJ5|RPB11_DICDI DNA-directed RNA polymerase II subunit rpb11 OS=Dictyostelium discoideum GN=polr2j PE=3 SV=1 42 103 1.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0006351 transcription, DNA-templated Yes
GO:0046983 protein dimerization activity Yes
GO:0003899 DNA-directed 5'-3' RNA polymerase activity Yes
GO:0009059 macromolecule biosynthetic process No
GO:0019438 aromatic compound biosynthetic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0018130 heterocycle biosynthetic process No
GO:0097747 RNA polymerase activity No
GO:1901576 organic substance biosynthetic process No
GO:0140640 catalytic activity, acting on a nucleic acid No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0003674 molecular_function No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:0005488 binding No
GO:0008150 biological_process No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0034654 nucleobase-containing compound biosynthetic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0140098 catalytic activity, acting on RNA No
GO:1901362 organic cyclic compound biosynthetic process No
GO:0034062 5'-3' RNA polymerase activity No
GO:0016070 RNA metabolic process No
GO:0046483 heterocycle metabolic process No
GO:0016740 transferase activity No
GO:0009058 biosynthetic process No
GO:0044238 primary metabolic process No
GO:0005515 protein binding No
GO:0097659 nucleic acid-templated transcription No
GO:0009987 cellular process No
GO:0003824 catalytic activity No
GO:0008152 metabolic process No
GO:0044237 cellular metabolic process No
GO:0032774 RNA biosynthetic process No
GO:0071704 organic substance metabolic process No
GO:0044249 cellular biosynthetic process No
GO:0016779 nucleotidyltransferase activity No
GO:0090304 nucleic acid metabolic process No
GO:0006139 nucleobase-containing compound metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 37 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|6176
MQDAPIPDPSEVAQGTAENEVASEDDEPEVQQIRLLPGSTDSAASFEFTDEGHTLGNALRYIITKNPNVEFCAYA
IPHPSEPKMNLRIQTWEGTAIDALEKGLADLQDMCDVVTDKFQTARDTFKAENGPTE*
Coding >OphauB2|6176
ATGCAAGACGCGCCAATACCTGACCCCTCAGAGGTGGCTCAGGGCACCGCAGAGAATGAGGTCGCTTCAGAAGAC
GACGAACCCGAAGTCCAGCAGATCAGACTTTTGCCAGGGTCGACAGATTCAGCAGCCTCGTTCGAATTCACTGAC
GAGGGTCATACGCTGGGAAACGCTCTGAGATATATCATCACGAAAAATCCTAACGTGGAATTCTGTGCCTACGCT
ATTCCACATCCTTCAGAGCCCAAGATGAACTTGAGAATACAGACTTGGGAGGGGACCGCCATCGACGCCTTGGAA
AAGGGGCTTGCTGATCTGCAAGACATGTGTGATGTCGTGACGGACAAATTCCAGACAGCAAGGGACACATTCAAG
GCAGAGAATGGCCCTACTGAGTAA
Transcript >OphauB2|6176
ATGCAAGACGCGCCAATACCTGACCCCTCAGAGGTGGCTCAGGGCACCGCAGAGAATGAGGTCGCTTCAGAAGAC
GACGAACCCGAAGTCCAGCAGATCAGACTTTTGCCAGGGTCGACAGATTCAGCAGCCTCGTTCGAATTCACTGAC
GAGGGTCATACGCTGGGAAACGCTCTGAGATATATCATCACGAAAAATCCTAACGTGGAATTCTGTGCCTACGCT
ATTCCACATCCTTCAGAGCCCAAGATGAACTTGAGAATACAGACTTGGGAGGGGACCGCCATCGACGCCTTGGAA
AAGGGGCTTGCTGATCTGCAAGACATGTGTGATGTCGTGACGGACAAATTCCAGACAGCAAGGGACACATTCAAG
GCAGAGAATGGCCCTACTGAGTAA
Gene >OphauB2|6176
ATGCAAGACGCGCCAATACCTGACCCCTCAGAGGTGGCTCAGGGCACCGCAGAGAATGAGGTCGCTTCAGAAGAC
GACGAACCCGAAGTCCAGCAGATCAGACTTGTACGTCTTGGCACATCATCTATTCATCAAGTCGTACATTCGACT
AACATGCATGCAGTTGCCAGGGTCGACAGATTCAGCAGCCTCGTTCGAATTCACTGACGAGGGTCATACGCTGGG
AAACGCTCTGAGATATATCATCACGAAAAAGTCAATATTTCCCAGGTTATATACGAGCTTTGCGAGCCAGCACTG
ACCGAGTTGTAGTCCTAACGTGGAATTCTGTGCCTACGCTATTCCACATCCTTCAGAGCCCAAGATGAACTTGAG
AATACAGACTTGGGGTATGTGTATCAGAGTGGCTTGAACAGAGCCCAAAACTGTCGCTTCAGAGGTAGCTGACAG
GCTTGTATAGAGGGGACCGCCATCGACGCCTTGGAAAAGGGGCTTGCTGATCTGCAAGACATGTGTGATGTCGTG
ACGGACAAATTCCAGACAGCAAGGGACACATTCAAGGCAGAGAATGGCCCTACTGAGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail