Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|6169
Gene name
LocationContig_54:37488..39723
Strand+
Gene length (bp)2235
Transcript length (bp)2235
Coding sequence length (bp)2235
Protein length (aa) 745

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00250 Forkhead Forkhead domain 3.9E-35 198 279

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O43058|SEP1_SCHPO Forkhead protein sep1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sep1 PE=1 SV=1 181 293 2.0E-33
sp|Q91904|FXI1A_XENLA Forkhead box protein I1-A OS=Xenopus laevis GN=foxi1-a PE=1 SV=1 198 348 6.0E-28
sp|Q91905|FXI1B_XENLA Forkhead box protein I1-B OS=Xenopus laevis GN=foxi1-b PE=2 SV=1 198 348 3.0E-27
sp|Q6P8A3|FXI1E_XENTR Forkhead box protein I1-ema OS=Xenopus tropicalis GN=foxi1e PE=2 SV=1 198 307 4.0E-26
sp|Q6P2Z3|FOXI1_XENTR Forkhead box protein I1 OS=Xenopus tropicalis GN=foxi1 PE=2 SV=1 198 348 5.0E-26
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O43058|SEP1_SCHPO Forkhead protein sep1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sep1 PE=1 SV=1 181 293 2.0E-33
sp|Q91904|FXI1A_XENLA Forkhead box protein I1-A OS=Xenopus laevis GN=foxi1-a PE=1 SV=1 198 348 6.0E-28
sp|Q91905|FXI1B_XENLA Forkhead box protein I1-B OS=Xenopus laevis GN=foxi1-b PE=2 SV=1 198 348 3.0E-27
sp|Q6P8A3|FXI1E_XENTR Forkhead box protein I1-ema OS=Xenopus tropicalis GN=foxi1e PE=2 SV=1 198 307 4.0E-26
sp|Q6P2Z3|FOXI1_XENTR Forkhead box protein I1 OS=Xenopus tropicalis GN=foxi1 PE=2 SV=1 198 348 5.0E-26
sp|Q28D67|FXI1C_XENTR Forkhead box protein I1c OS=Xenopus tropicalis GN=foxi1c PE=2 SV=1 198 279 6.0E-26
sp|Q28HT3|FOXI2_XENTR Forkhead box protein I2 OS=Xenopus tropicalis GN=foxi2 PE=2 SV=1 198 279 6.0E-26
sp|Q63ZH2|FXI2B_XENLA Forkhead box protein I2-B OS=Xenopus laevis GN=foxi2-b PE=2 SV=2 198 329 7.0E-26
sp|Q7ZYQ0|FXI1E_XENLA Forkhead box protein I1-ema OS=Xenopus laevis GN=foxi1e PE=2 SV=1 198 307 7.0E-26
sp|Q3I5G5|FOXI2_MOUSE Forkhead box protein I2 OS=Mus musculus GN=Foxi2 PE=2 SV=1 198 282 9.0E-26
sp|Q12951|FOXI1_HUMAN Forkhead box protein I1 OS=Homo sapiens GN=FOXI1 PE=1 SV=3 198 279 1.0E-25
sp|Q63248|FOXI2_RAT Forkhead box protein I2 (Fragment) OS=Rattus norvegicus GN=Foxi2 PE=2 SV=1 198 279 1.0E-25
sp|Q922I5|FOXI1_MOUSE Forkhead box protein I1 OS=Mus musculus GN=Foxi1 PE=2 SV=2 198 279 2.0E-25
sp|Q8JIT5|FXI1C_XENLA Forkhead box protein I1c OS=Xenopus laevis GN=foxi1c PE=2 SV=1 198 279 2.0E-25
sp|O13606|MEI4_SCHPO Meiosis-specific transcription factor mei4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mei4 PE=3 SV=1 185 309 3.0E-25
sp|Q68EZ2|FOXJ2_XENLA Forkhead box protein J2 OS=Xenopus laevis GN=foxj2 PE=2 SV=1 198 276 5.0E-25
sp|Q5NDM2|FXI2A_XENLA Forkhead box protein I2-A OS=Xenopus laevis GN=foxi2-a PE=2 SV=1 198 279 6.0E-25
sp|Q8ITI5|FOXG1_MNELE Forkhead box protein G1 OS=Mnemiopsis leidyi GN=FOXG1 PE=2 SV=1 197 354 6.0E-25
sp|Q6ZQN5|FOXI2_HUMAN Forkhead box protein I2 OS=Homo sapiens GN=FOXI2 PE=2 SV=2 198 279 7.0E-25
sp|Q9UPW0|FOXJ3_HUMAN Forkhead box protein J3 OS=Homo sapiens GN=FOXJ3 PE=1 SV=2 198 293 8.0E-25
sp|Q8BUR3|FOXJ3_MOUSE Forkhead box protein J3 OS=Mus musculus GN=Foxj3 PE=1 SV=1 198 293 1.0E-24
sp|A8MTJ6|FOXI3_HUMAN Forkhead box protein I3 OS=Homo sapiens GN=FOXI3 PE=2 SV=3 198 304 1.0E-24
sp|Q28EM1|FOXJ2_XENTR Forkhead box protein J2 OS=Xenopus tropicalis GN=foxj2 PE=2 SV=1 198 276 1.0E-24
sp|O43638|FOXS1_HUMAN Forkhead box protein S1 OS=Homo sapiens GN=FOXS1 PE=2 SV=2 181 279 2.0E-24
sp|P32031|SLP2_DROME Fork head domain transcription factor slp2 OS=Drosophila melanogaster GN=slp2 PE=2 SV=2 175 305 3.0E-24
sp|Q12952|FOXL1_HUMAN Forkhead box protein L1 OS=Homo sapiens GN=FOXL1 PE=2 SV=2 197 320 4.0E-24
sp|Q61574|FOXS1_MOUSE Forkhead box protein S1 OS=Mus musculus GN=Foxs1 PE=2 SV=2 181 378 4.0E-24
sp|Q64731|FOXL1_MOUSE Forkhead box protein L1 OS=Mus musculus GN=Foxl1 PE=2 SV=2 197 278 5.0E-24
sp|B5RHS5|FOXI3_CANLF Forkhead box protein I3 OS=Canis lupus familiaris GN=FOXI3 PE=3 SV=1 198 279 6.0E-24
sp|P41813|FKH2_YEAST Fork head protein homolog 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FKH2 PE=1 SV=1 198 304 1.0E-23
sp|P56260|QIN_AVIS3 Transforming protein Qin OS=Avian sarcoma virus (strain 31) GN=V-QIN PE=2 SV=1 198 274 1.0E-23
sp|Q9YHC5|FOXG1_XENLA Forkhead box protein G1 OS=Xenopus laevis GN=foxg1 PE=2 SV=1 198 274 2.0E-23
sp|Q90964|FOXG1_CHICK Forkhead box protein G1 OS=Gallus gallus GN=FOXG1 PE=2 SV=1 198 274 2.0E-23
sp|Q00939|FOXG1_RAT Forkhead box protein G1 OS=Rattus norvegicus GN=Foxg1 PE=2 SV=1 198 274 2.0E-23
sp|Q60987|FOXG1_MOUSE Forkhead box protein G1 OS=Mus musculus GN=Foxg1 PE=2 SV=1 198 274 2.0E-23
sp|Q92949|FOXJ1_HUMAN Forkhead box protein J1 OS=Homo sapiens GN=FOXJ1 PE=2 SV=3 165 274 2.0E-23
sp|Q3UCQ1|FOXK2_MOUSE Forkhead box protein K2 OS=Mus musculus GN=Foxk2 PE=1 SV=3 198 332 2.0E-23
sp|Q01167|FOXK2_HUMAN Forkhead box protein K2 OS=Homo sapiens GN=FOXK2 PE=1 SV=3 198 332 2.0E-23
sp|Q5A7S7|FKH2_CANAL Fork-head transcriptional regulator 2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=FKH2 PE=2 SV=1 198 300 2.0E-23
sp|Q1A1A1|FOXG1_CERSI Forkhead box protein G1 OS=Ceratotherium simum GN=FOXG1 PE=3 SV=1 198 274 2.0E-23
sp|Q63247|FOXJ1_RAT Forkhead box protein J1 OS=Rattus norvegicus GN=Foxj1 PE=2 SV=1 165 274 2.0E-23
sp|Q1A1A6|FOXG1_CEBCA Forkhead box protein G1 OS=Cebus capucinus GN=FOXG1 PE=3 SV=1 198 274 3.0E-23
sp|Q1A1A3|FOXG1_EPOGA Forkhead box protein G1 OS=Epomophorus gambianus GN=FOXG1 PE=3 SV=1 198 274 3.0E-23
sp|Q1A1A4|FOXG1_PIPRU Forkhead box protein G1 OS=Pipistrellus rusticus GN=FOXG1 PE=3 SV=1 198 274 3.0E-23
sp|Q61660|FOXJ1_MOUSE Forkhead box protein J1 OS=Mus musculus GN=Foxj1 PE=2 SV=2 165 274 3.0E-23
sp|Q1A1A2|FOXG1_EQUBU Forkhead box protein G1 OS=Equus burchelli GN=FOXG1 PE=3 SV=1 198 274 3.0E-23
sp|P55316|FOXG1_HUMAN Forkhead box protein G1 OS=Homo sapiens GN=FOXG1 PE=1 SV=2 198 274 3.0E-23
sp|Q1A1A5|FOXG1_CHLPG Forkhead box protein G1 OS=Chlorocebus pygerythrus GN=FOXG1 PE=3 SV=1 198 274 3.0E-23
sp|Q7ZX03|FOXK2_XENLA Forkhead box protein K2 OS=Xenopus laevis GN=foxk2 PE=2 SV=2 198 332 3.0E-23
sp|F1QDF8|FXJ1A_DANRE Forkhead box protein J1-A OS=Danio rerio GN=foxj1a PE=2 SV=1 198 274 5.0E-23
sp|O00358|FOXE1_HUMAN Forkhead box protein E1 OS=Homo sapiens GN=FOXE1 PE=1 SV=3 198 279 5.0E-23
sp|Q9P0K8|FOXJ2_HUMAN Forkhead box protein J2 OS=Homo sapiens GN=FOXJ2 PE=1 SV=1 198 276 6.0E-23
sp|Q9ES18|FOXJ2_MOUSE Forkhead box protein J2 OS=Mus musculus GN=Foxj2 PE=2 SV=1 198 276 7.0E-23
sp|Q708W1|FXJ1B_XENLA Forkhead box protein J1-B OS=Xenopus laevis GN=foxj1-b PE=2 SV=1 198 274 8.0E-23
sp|Q5M7N6|FOXJ1_XENTR Forkhead box protein J1 OS=Xenopus tropicalis GN=foxj1 PE=2 SV=2 198 274 9.0E-23
sp|Q8R2I0|FOXE1_MOUSE Forkhead box protein E1 OS=Mus musculus GN=Foxe1 PE=1 SV=2 198 279 2.0E-22
sp|P40466|FKH1_YEAST Fork head protein homolog 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FKH1 PE=1 SV=1 198 304 2.0E-22
sp|Q99958|FOXC2_HUMAN Forkhead box protein C2 OS=Homo sapiens GN=FOXC2 PE=1 SV=1 198 424 2.0E-22
sp|Q6VFT6|FOXL2_PIG Forkhead box protein L2 OS=Sus scrofa GN=FOXL2 PE=3 SV=1 194 284 2.0E-22
sp|P25364|HCM1_YEAST Forkhead transcription factor HCM1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HCM1 PE=1 SV=3 198 284 2.0E-22
sp|O88470|FOXL2_MOUSE Forkhead box protein L2 OS=Mus musculus GN=Foxl2 PE=1 SV=2 194 284 3.0E-22
sp|Q6VFT5|FOXL2_RABIT Forkhead box protein L2 OS=Oryctolagus cuniculus GN=FOXL2 PE=3 SV=1 194 279 3.0E-22
sp|Q9QY14|FOXE3_MOUSE Forkhead box protein E3 OS=Mus musculus GN=Foxe3 PE=1 SV=1 198 274 3.0E-22
sp|Q4VUF1|FOXL2_ELLLU Forkhead box protein L2 OS=Ellobius lutescens GN=FOXL2 PE=3 SV=1 194 284 3.0E-22
sp|Q63250|FOXE3_RAT Forkhead box protein E3 OS=Rattus norvegicus GN=Foxe3 PE=2 SV=2 198 274 3.0E-22
sp|P32030|SLP1_DROME Fork head domain transcription factor slp1 OS=Drosophila melanogaster GN=slp1 PE=2 SV=1 198 279 3.0E-22
sp|Q63246|FOXC2_RAT Forkhead box protein C2 OS=Rattus norvegicus GN=Foxc2 PE=1 SV=2 198 274 3.0E-22
sp|Q13461|FOXE3_HUMAN Forkhead box protein E3 OS=Homo sapiens GN=FOXE3 PE=1 SV=2 198 274 3.0E-22
sp|Q61850|FOXC2_MOUSE Forkhead box protein C2 OS=Mus musculus GN=Foxc2 PE=1 SV=2 198 274 3.0E-22
sp|P58012|FOXL2_HUMAN Forkhead box protein L2 OS=Homo sapiens GN=FOXL2 PE=1 SV=1 194 279 3.0E-22
sp|Q9PTK2|FOXE4_XENLA Forkhead box protein E4 OS=Xenopus laevis GN=foxe4 PE=2 SV=1 198 279 4.0E-22
sp|Q8MIP2|FOXL2_CAPHI Forkhead box protein L2 OS=Capra hircus GN=FOXL2 PE=1 SV=1 194 279 5.0E-22
sp|Q66IG8|FXJ12_XENTR Forkhead box protein J1.2 OS=Xenopus tropicalis GN=foxj1.2 PE=2 SV=1 193 274 5.0E-22
sp|Q6VFT7|FOXL2_BOVIN Forkhead box protein L2 OS=Bos taurus GN=FOXL2 PE=2 SV=1 194 279 5.0E-22
sp|Q32NH9|FXJ12_XENLA Forkhead box protein J1.2 OS=Xenopus laevis GN=foxj1.2 PE=2 SV=1 193 274 6.0E-22
sp|Q708W2|FXJ1A_XENLA Forkhead box protein J1-A OS=Xenopus laevis GN=foxj1-a PE=2 SV=1 198 274 8.0E-22
sp|Q63251|FOXD1_RAT Forkhead box protein D1 (Fragment) OS=Rattus norvegicus GN=Foxd1 PE=2 SV=1 198 274 1.0E-21
sp|Q6F2E4|FOXD1_XENTR Forkhead box protein D1 OS=Xenopus tropicalis GN=foxd1 PE=2 SV=1 198 274 1.0E-21
sp|Q90WN4|FOXD2_XENLA Forkhead box protein D2 OS=Xenopus laevis GN=foxd2 PE=2 SV=1 198 274 1.0E-21
sp|P85037|FOXK1_HUMAN Forkhead box protein K1 OS=Homo sapiens GN=FOXK1 PE=1 SV=1 198 343 2.0E-21
sp|Q9PSY4|FOXD1_XENLA Forkhead box protein D1 OS=Xenopus laevis GN=foxd1 PE=2 SV=2 198 274 2.0E-21
sp|Q6NVT7|FOXC2_XENTR Forkhead box protein C2 OS=Xenopus tropicalis GN=foxc2 PE=2 SV=2 198 274 2.0E-21
sp|Q68F77|FOXC1_XENTR Forkhead box protein C1 OS=Xenopus tropicalis GN=foxc1 PE=2 SV=1 179 274 2.0E-21
sp|P42128|FOXK1_MOUSE Forkhead box protein K1 OS=Mus musculus GN=Foxk1 PE=1 SV=2 198 293 2.0E-21
sp|O35392|FOXD2_MOUSE Forkhead box protein D2 OS=Mus musculus GN=Foxd2 PE=2 SV=1 198 274 3.0E-21
sp|Q61345|FOXD1_MOUSE Forkhead box protein D1 OS=Mus musculus GN=Foxd1 PE=2 SV=2 198 274 3.0E-21
sp|Q5J3Q5|FOXE1_XENLA Forkhead box protein E1 OS=Xenopus laevis GN=foxe1 PE=2 SV=1 198 279 3.0E-21
sp|Q61572|FOXC1_MOUSE Forkhead box protein C1 OS=Mus musculus GN=Foxc1 PE=1 SV=3 185 274 3.0E-21
sp|Q6LD29|FXA1A_XENLA Forkhead box protein A1-A OS=Xenopus laevis GN=foxa1-a PE=2 SV=2 198 296 4.0E-21
sp|Q16676|FOXD1_HUMAN Forkhead box protein D1 OS=Homo sapiens GN=FOXD1 PE=2 SV=1 198 274 4.0E-21
sp|O60548|FOXD2_HUMAN Forkhead box protein D2 OS=Homo sapiens GN=FOXD2 PE=2 SV=2 198 274 4.0E-21
sp|F1R8Z9|FXJ1B_DANRE Forkhead box protein J1-B OS=Danio rerio GN=foxj1b PE=2 SV=1 198 274 4.0E-21
sp|Q9DE25|FXC1A_DANRE Forkhead box C1-A OS=Danio rerio GN=foxc1a PE=2 SV=1 185 274 4.0E-21
sp|Q12946|FOXF1_HUMAN Forkhead box protein F1 OS=Homo sapiens GN=FOXF1 PE=1 SV=2 198 282 4.0E-21
sp|Q12948|FOXC1_HUMAN Forkhead box protein C1 OS=Homo sapiens GN=FOXC1 PE=1 SV=3 185 274 4.0E-21
sp|Q63245|FOXD3_RAT Forkhead box protein D3 (Fragment) OS=Rattus norvegicus GN=Foxd3 PE=1 SV=1 198 274 4.0E-21
sp|Q9PVY8|FXC2B_XENLA Forkhead box protein C2-B OS=Xenopus laevis GN=foxc2-b PE=2 SV=2 198 274 4.0E-21
sp|Q98937|FOXD1_CHICK Forkhead box protein D1 OS=Gallus gallus GN=FOXD1 PE=2 SV=1 198 274 5.0E-21
sp|Q28BS5|FOXF1_XENTR Forkhead box protein F1 OS=Xenopus tropicalis GN=foxf1 PE=2 SV=1 153 282 5.0E-21
sp|Q9PVY9|FXC2A_XENLA Forkhead box protein C2-A OS=Xenopus laevis GN=foxc2-a PE=2 SV=1 198 274 5.0E-21
sp|Q9DEN4|FXD3A_XENLA Forkhead box protein D3-A OS=Xenopus laevis GN=foxd3-a PE=1 SV=1 198 274 6.0E-21
sp|P32315|FXA1B_XENLA Forkhead box protein A1-B OS=Xenopus laevis GN=foxa1-b PE=2 SV=1 198 296 6.0E-21
sp|P35582|FOXA1_MOUSE Hepatocyte nuclear factor 3-alpha OS=Mus musculus GN=Foxa1 PE=1 SV=2 198 311 6.0E-21
sp|Q32NP8|FXC1B_XENLA Forkhead box protein C1-B OS=Xenopus laevis GN=foxc1-b PE=2 SV=1 179 274 6.0E-21
sp|Q99853|FOXB1_HUMAN Forkhead box protein B1 OS=Homo sapiens GN=FOXB1 PE=1 SV=3 193 278 6.0E-21
sp|P79772|FOXD3_CHICK Forkhead box protein D3 OS=Gallus gallus GN=FOXD3 PE=2 SV=1 198 274 6.0E-21
sp|Q64732|FOXB1_MOUSE Forkhead box protein B1 OS=Mus musculus GN=Foxb1 PE=2 SV=2 193 278 6.0E-21
sp|Q9PVZ3|FXC1A_XENLA Forkhead box protein C1-A OS=Xenopus laevis GN=foxc1-a PE=2 SV=1 179 274 7.0E-21
sp|A1L1S5|FOXF1_DANRE Forkhead box protein F1 OS=Danio rerio GN=foxf1 PE=2 SV=1 198 282 7.0E-21
sp|Q61080|FOXF1_MOUSE Forkhead box protein F1 OS=Mus musculus GN=Foxf1 PE=2 SV=2 198 282 9.0E-21
sp|Q9W707|FXF1B_XENLA Forkhead box protein F1-B OS=Xenopus laevis GN=foxf1-b PE=2 SV=1 198 282 9.0E-21
sp|Q5M7L9|FOXD3_XENTR Forkhead box protein D3 OS=Xenopus tropicalis GN=foxd3 PE=2 SV=1 198 274 1.0E-20
sp|Q9W706|FXF1A_XENLA Forkhead box protein F1-A OS=Xenopus laevis GN=foxf1-a PE=2 SV=1 198 282 1.0E-20
sp|P55317|FOXA1_HUMAN Hepatocyte nuclear factor 3-alpha OS=Homo sapiens GN=FOXA1 PE=1 SV=2 198 284 1.0E-20
sp|O54743|FOXF2_MOUSE Forkhead box protein F2 OS=Mus musculus GN=Foxf2 PE=2 SV=2 198 282 1.0E-20
sp|Q12947|FOXF2_HUMAN Forkhead box protein F2 OS=Homo sapiens GN=FOXF2 PE=1 SV=2 198 282 1.0E-20
sp|Q9DEN3|FXD3B_XENLA Forkhead box protein D3-B OS=Xenopus laevis GN=foxd3-b PE=2 SV=1 198 274 1.0E-20
sp|Q02360|FD2_DROME Fork head domain-containing protein FD2 OS=Drosophila melanogaster GN=fd64A PE=2 SV=2 198 276 1.0E-20
sp|P32183|FOXA3_RAT Hepatocyte nuclear factor 3-gamma OS=Rattus norvegicus GN=Foxa3 PE=1 SV=1 191 303 1.0E-20
sp|P35584|FOXA3_MOUSE Hepatocyte nuclear factor 3-gamma OS=Mus musculus GN=Foxa3 PE=1 SV=1 198 303 2.0E-20
sp|Q8AWH1|FOXA1_XENTR Forkhead box protein A1 OS=Xenopus tropicalis GN=foxa1 PE=2 SV=1 198 284 2.0E-20
sp|Q9DE24|FXC1B_DANRE Forkhead box C1-B OS=Danio rerio GN=foxc1b PE=2 SV=1 198 274 2.0E-20
sp|P23512|FOXA1_RAT Hepatocyte nuclear factor 3-alpha OS=Rattus norvegicus GN=Foxa1 PE=1 SV=1 198 284 2.0E-20
sp|Q61060|FOXD3_MOUSE Forkhead box protein D3 OS=Mus musculus GN=Foxd3 PE=2 SV=3 198 274 2.0E-20
sp|Q12950|FOXD4_HUMAN Forkhead box protein D4 OS=Homo sapiens GN=FOXD4 PE=2 SV=4 198 274 3.0E-20
sp|Q9UJU5|FOXD3_HUMAN Forkhead box protein D3 OS=Homo sapiens GN=FOXD3 PE=1 SV=1 198 274 3.0E-20
sp|P35583|FOXA2_MOUSE Hepatocyte nuclear factor 3-beta OS=Mus musculus GN=Foxa2 PE=1 SV=2 198 284 3.0E-20
sp|Q63249|FOXD4_RAT Forkhead box protein D4 (Fragment) OS=Rattus norvegicus GN=Foxd4 PE=2 SV=1 198 274 4.0E-20
sp|Q9Y261|FOXA2_HUMAN Hepatocyte nuclear factor 3-beta OS=Homo sapiens GN=FOXA2 PE=1 SV=1 198 284 5.0E-20
sp|Q91765|FXA2A_XENLA Forkhead box protein A2-A OS=Xenopus laevis GN=foxa2-a PE=1 SV=1 198 284 5.0E-20
sp|Q7T1R4|FOXA2_XENTR Forkhead box protein A2 OS=Xenopus tropicalis GN=foxa2 PE=2 SV=1 198 284 5.0E-20
sp|P32027|CROC_DROME Fork head domain-containing protein crocodile OS=Drosophila melanogaster GN=croc PE=2 SV=2 198 274 5.0E-20
sp|Q07342|FOXA2_DANRE Forkhead box protein A2 OS=Danio rerio GN=foxa2 PE=2 SV=1 198 284 6.0E-20
sp|Q3Y598|FOXA3_BOVIN Hepatocyte nuclear factor 3-gamma OS=Bos taurus GN=FOXA3 PE=2 SV=1 198 281 6.0E-20
sp|O42097|FOXA2_ORYLA Hepatocyte nuclear factor 3-beta OS=Oryzias latipes GN=foxa2 PE=2 SV=1 198 320 6.0E-20
sp|P55318|FOXA3_HUMAN Hepatocyte nuclear factor 3-gamma OS=Homo sapiens GN=FOXA3 PE=1 SV=2 198 281 7.0E-20
sp|P84961|FXA2B_XENLA Forkhead box protein A2-B OS=Xenopus laevis GN=foxa2-b PE=2 SV=1 198 284 8.0E-20
sp|Q60688|FOXD4_MOUSE Forkhead box protein D4 OS=Mus musculus GN=Foxd4 PE=2 SV=1 198 274 1.0E-19
sp|Q17381|PHA4_CAEEL Defective pharyngeal development protein 4 OS=Caenorhabditis elegans GN=pha-4 PE=1 SV=1 198 278 1.0E-19
sp|Q5VV16|FX4L5_HUMAN Forkhead box protein D4-like 5 OS=Homo sapiens GN=FOXD4L5 PE=3 SV=1 198 274 1.0E-19
sp|Q6P839|FOXA4_XENTR Forkhead box protein A4 OS=Xenopus tropicalis GN=foxa4 PE=2 SV=1 198 329 2.0E-19
sp|Q8WXT5|FX4L4_HUMAN Forkhead box protein D4-like 4 OS=Homo sapiens GN=FOXD4L4 PE=2 SV=2 198 274 2.0E-19
sp|Q3SYB3|FX4L6_HUMAN Forkhead box protein D4-like 6 OS=Homo sapiens GN=FOXD4L6 PE=1 SV=2 198 274 2.0E-19
sp|Q6VB84|FX4L3_HUMAN Forkhead box protein D4-like 3 OS=Homo sapiens GN=FOXD4L3 PE=2 SV=2 198 274 2.0E-19
sp|P33205|FXA4A_XENLA Forkhead box protein A4-A OS=Xenopus laevis GN=foxa4-a PE=1 SV=3 198 284 3.0E-19
sp|P32029|FD5_DROME Fork head domain-containing protein FD5 OS=Drosophila melanogaster GN=fd96Cb PE=2 SV=2 197 274 3.0E-19
sp|O93529|FOXB1_XENLA Forkhead box protein B1 OS=Xenopus laevis GN=foxb1 PE=2 SV=1 193 278 3.0E-19
sp|P33206|FXA4B_XENLA Forkhead box protein A4-B OS=Xenopus laevis GN=foxa4-b PE=2 SV=1 198 284 3.0E-19
sp|P32028|FD4_DROME Fork head domain-containing protein FD4 OS=Drosophila melanogaster GN=fd96Ca PE=2 SV=2 198 274 3.0E-19
sp|O60129|FKH2_SCHPO Fork head protein homolog 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fkh2 PE=1 SV=1 198 327 4.0E-19
sp|Q5WM45|FOXD5_XENTR Forkhead box protein D5 OS=Xenopus tropicalis GN=foxd5 PE=2 SV=1 198 279 5.0E-19
sp|Q9NU39|FX4L1_HUMAN Forkhead box protein D4-like 1 OS=Homo sapiens GN=FOXD4L1 PE=2 SV=1 143 274 5.0E-19
sp|Q9PT68|FXD5B_XENLA Forkhead box protein D5-B OS=Xenopus laevis GN=foxd5-b PE=2 SV=1 198 279 6.0E-19
sp|Q9PRJ8|FXD5A_XENLA Forkhead box protein D5-A OS=Xenopus laevis GN=foxd5-a PE=2 SV=1 198 279 6.0E-19
sp|Q17241|SGF1_BOMMO Silk gland factor 1 OS=Bombyx mori GN=SGF1 PE=2 SV=1 198 281 7.0E-19
sp|P32182|FOXA2_RAT Hepatocyte nuclear factor 3-beta OS=Rattus norvegicus GN=Foxa2 PE=1 SV=1 198 284 1.0E-18
sp|P14734|FKH_DROME Protein fork head OS=Drosophila melanogaster GN=fkh PE=1 SV=1 198 284 1.0E-18
sp|O14270|FHL1_SCHPO Fork head transcription factor 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fhl1 PE=3 SV=2 194 274 2.0E-18
sp|Q8JIT6|FOXB2_XENLA Forkhead box protein B2 OS=Xenopus laevis GN=foxb2 PE=2 SV=1 195 278 2.0E-18
sp|Q9PT67|FXD5C_XENLA Forkhead box protein D5-C OS=Xenopus laevis GN=foxd5-c PE=2 SV=1 198 274 4.0E-18
sp|Q02361|FD3_DROME Fork head domain-containing protein FD3 OS=Drosophila melanogaster GN=fd59A PE=2 SV=2 198 274 5.0E-18
sp|Q63244|FOXQ1_RAT Forkhead box protein Q1 OS=Rattus norvegicus GN=Foxq1 PE=1 SV=3 198 282 8.0E-18
sp|O70220|FOXQ1_MOUSE Forkhead box protein Q1 OS=Mus musculus GN=Foxq1 PE=2 SV=3 198 282 1.0E-17
sp|P34683|LIN31_CAEEL Protein lin-31 OS=Caenorhabditis elegans GN=lin-31 PE=3 SV=1 198 274 2.0E-17
sp|Q64733|FOXB2_MOUSE Forkhead box protein B2 OS=Mus musculus GN=Foxb2 PE=2 SV=1 195 321 2.0E-17
sp|Q9C009|FOXQ1_HUMAN Forkhead box protein Q1 OS=Homo sapiens GN=FOXQ1 PE=2 SV=2 198 282 2.0E-17
sp|Q5VYV0|FOXB2_HUMAN Forkhead box protein B2 OS=Homo sapiens GN=FOXB2 PE=3 SV=1 195 278 3.0E-17
sp|Q2LE08|FXP1B_DANRE Forkhead box protein P1-B OS=Danio rerio GN=foxp1b PE=2 SV=1 198 300 4.0E-17
sp|Q5W1J5|FOXP1_XENLA Forkhead box protein P1 OS=Xenopus laevis GN=foxp1 PE=1 SV=1 198 293 7.0E-17
sp|P58462|FOXP1_MOUSE Forkhead box protein P1 OS=Mus musculus GN=Foxp1 PE=1 SV=1 198 289 8.0E-17
sp|Q498D1|FOXP1_RAT Forkhead box protein P1 OS=Rattus norvegicus GN=Foxp1 PE=1 SV=1 198 289 8.0E-17
sp|Q9H334|FOXP1_HUMAN Forkhead box protein P1 OS=Homo sapiens GN=FOXP1 PE=1 SV=1 198 289 8.0E-17
sp|A4IFD2|FOXP1_BOVIN Forkhead box protein P1 OS=Bos taurus GN=FOXP1 PE=2 SV=1 198 289 9.0E-17
sp|Q4VYR7|FOXP4_XENLA Forkhead box protein P4 OS=Xenopus laevis GN=foxp4 PE=2 SV=1 198 302 1.0E-16
sp|Q9VS05|FOXF_DROME Forkhead box protein biniou OS=Drosophila melanogaster GN=bin PE=1 SV=2 198 290 1.0E-16
sp|Q8IVH2|FOXP4_HUMAN Forkhead box protein P4 OS=Homo sapiens GN=FOXP4 PE=1 SV=1 198 302 1.0E-16
sp|Q9DBY0|FOXP4_MOUSE Forkhead box protein P4 OS=Mus musculus GN=Foxp4 PE=1 SV=1 198 302 2.0E-16
sp|Q58NQ4|FOXP1_CHICK Forkhead box protein P1 OS=Gallus gallus GN=FOXP1 PE=2 SV=1 198 281 2.0E-16
sp|Q99JB6|FOXP3_MOUSE Forkhead box protein P3 OS=Mus musculus GN=Foxp3 PE=1 SV=1 198 289 2.0E-15
sp|Q6U8D7|FOXP3_MACFA Forkhead box protein P3 OS=Macaca fascicularis GN=FOXP3 PE=2 SV=1 198 289 2.0E-15
sp|Q9BZS1|FOXP3_HUMAN Forkhead box protein P3 OS=Homo sapiens GN=FOXP3 PE=1 SV=1 198 289 2.0E-15
sp|Q9I9E1|FOXH1_DANRE Forkhead box protein H1 OS=Danio rerio GN=foxh1 PE=1 SV=1 198 275 3.0E-15
sp|Q4VYS1|FOXP2_XENLA Forkhead box protein P2 OS=Xenopus laevis GN=foxp2 PE=2 SV=1 198 293 7.0E-15
sp|Q5QL03|FOXP2_HYLLA Forkhead box protein P2 OS=Hylobates lar GN=FOXP2 PE=3 SV=1 198 289 7.0E-15
sp|Q8MJ99|FOXP2_GORGO Forkhead box protein P2 OS=Gorilla gorilla gorilla GN=FOXP2 PE=2 SV=1 198 289 7.0E-15
sp|Q8MJ97|FOXP2_MACMU Forkhead box protein P2 OS=Macaca mulatta GN=FOXP2 PE=2 SV=1 198 289 7.0E-15
sp|O15409|FOXP2_HUMAN Forkhead box protein P2 OS=Homo sapiens GN=FOXP2 PE=1 SV=2 198 289 7.0E-15
sp|Q8MJA0|FOXP2_PANTR Forkhead box protein P2 OS=Pan troglodytes GN=FOXP2 PE=2 SV=1 198 289 7.0E-15
sp|Q8HZ00|FOXP2_PANPA Forkhead box protein P2 OS=Pan paniscus GN=FOXP2 PE=2 SV=1 198 289 7.0E-15
sp|P0CF24|FOXP2_RAT Forkhead box protein P2 OS=Rattus norvegicus GN=Foxp2 PE=3 SV=1 198 289 7.0E-15
sp|P58463|FOXP2_MOUSE Forkhead box protein P2 OS=Mus musculus GN=Foxp2 PE=1 SV=2 198 289 7.0E-15
sp|Q8MJ98|FOXP2_PONPY Forkhead box protein P2 OS=Pongo pygmaeus GN=FOXP2 PE=2 SV=3 198 289 7.0E-15
sp|P32314|FOXN2_HUMAN Forkhead box protein N2 OS=Homo sapiens GN=FOXN2 PE=1 SV=3 198 274 3.0E-14
sp|P98177|FOXO4_HUMAN Forkhead box protein O4 OS=Homo sapiens GN=FOXO4 PE=1 SV=5 201 329 3.0E-14
sp|Q28GC4|FOXH1_XENTR Forkhead box protein H1 OS=Xenopus tropicalis GN=foxh1 PE=2 SV=1 198 274 5.0E-14
sp|Q33BP8|FOXN3_PIG Forkhead box protein N3 OS=Sus scrofa GN=FOXN3 PE=2 SV=1 198 274 6.0E-14
sp|O00409|FOXN3_HUMAN Forkhead box protein N3 OS=Homo sapiens GN=FOXN3 PE=1 SV=1 198 274 8.0E-14
sp|Q28F43|FOXN2_XENTR Forkhead box protein N2 OS=Xenopus tropicalis GN=foxn2 PE=2 SV=1 198 274 8.0E-14
sp|Q499D0|FOXN3_MOUSE Forkhead box protein N3 OS=Mus musculus GN=Foxn3 PE=1 SV=1 198 274 9.0E-14
sp|Q3BJS1|FOXN4_XENLA Forkhead box protein N4 OS=Xenopus laevis GN=foxn4 PE=2 SV=1 198 310 1.0E-13
sp|Q8JIT7|FAST3_XENLA Forkhead activin signal transducer 3 OS=Xenopus laevis GN=fast3 PE=1 SV=1 198 274 1.0E-13
sp|Q28G71|FOXN3_XENTR Forkhead box protein N3 OS=Xenopus tropicalis GN=foxn3 PE=2 SV=1 198 274 1.0E-13
sp|P70056|FOXH1_XENLA Forkhead box protein H1 OS=Xenopus laevis GN=foxh1 PE=1 SV=3 197 274 2.0E-13
sp|Q66J77|FOXN2_XENLA Forkhead box protein N2 OS=Xenopus laevis GN=foxn2 PE=2 SV=1 198 274 2.0E-13
sp|Q9WVH3|FOXO4_MOUSE Forkhead box protein O4 OS=Mus musculus GN=Foxo4 PE=1 SV=1 201 321 2.0E-13
sp|Q3BJS3|FOXN3_XENLA Forkhead box protein N3 OS=Xenopus laevis GN=foxn3 PE=2 SV=1 198 274 2.0E-13
sp|O16850|FOXO_CAEEL Forkhead box protein O OS=Caenorhabditis elegans GN=daf-16 PE=1 SV=3 202 274 3.0E-13
sp|Q5W1J6|FOXM1_XENLA Forkhead box protein M1 OS=Xenopus laevis GN=foxm1 PE=2 SV=1 156 274 4.0E-13
sp|A2BGM5|FOXN4_DANRE Forkhead box protein N4 OS=Danio rerio GN=foxn4 PE=1 SV=1 198 310 6.0E-13
sp|O43524|FOXO3_HUMAN Forkhead box protein O3 OS=Homo sapiens GN=FOXO3 PE=1 SV=1 202 330 1.0E-12
sp|A3RK75|FX1AB_DANRE Forkhead box protein O1-B OS=Danio rerio GN=foxo1b PE=2 SV=1 202 310 4.0E-12
sp|Q96NZ1|FOXN4_HUMAN Forkhead box protein N4 OS=Homo sapiens GN=FOXN4 PE=2 SV=2 198 310 4.0E-12
sp|Q8K3Q3|FOXN4_MOUSE Forkhead box protein N4 OS=Mus musculus GN=Foxn4 PE=1 SV=1 198 310 5.0E-12
sp|Q66JJ0|FOXO1_XENTR Forkhead box protein O1 OS=Xenopus tropicalis GN=foxo1 PE=2 SV=1 202 310 6.0E-12
sp|A3RK74|FX1AA_DANRE Forkhead box protein O1-A OS=Danio rerio GN=foxo1a PE=2 SV=1 202 326 7.0E-12
sp|Q6EUW2|FOXO1_XENLA Forkhead box protein O1 OS=Xenopus laevis GN=foxo1 PE=2 SV=1 202 310 7.0E-12
sp|E1BPQ1|FOXO1_BOVIN Forkhead box protein O1 OS=Bos taurus GN=FOXO1 PE=3 SV=2 202 310 2.0E-11
sp|A4L7N3|FOXO1_PIG Forkhead box protein O1 OS=Sus scrofa GN=FOXO1 PE=2 SV=1 202 310 2.0E-11
sp|O08696|FOXM1_MOUSE Forkhead box protein M1 OS=Mus musculus GN=Foxm1 PE=1 SV=2 197 274 2.0E-11
sp|P97691|FOXM1_RAT Forkhead box protein M1 OS=Rattus norvegicus GN=Foxm1 PE=2 SV=2 197 274 2.0E-11
sp|Q12778|FOXO1_HUMAN Forkhead box protein O1 OS=Homo sapiens GN=FOXO1 PE=1 SV=2 202 310 2.0E-11
sp|Q9WVH4|FOXO3_MOUSE Forkhead box protein O3 OS=Mus musculus GN=Foxo3 PE=1 SV=1 202 307 3.0E-11
sp|O75593|FOXH1_HUMAN Forkhead box protein H1 OS=Homo sapiens GN=FOXH1 PE=1 SV=1 198 274 3.0E-11
sp|G3V7R4|FOXO1_RAT Forkhead box protein O1 OS=Rattus norvegicus GN=Foxo1 PE=1 SV=1 202 310 3.0E-11
sp|Q08050|FOXM1_HUMAN Forkhead box protein M1 OS=Homo sapiens GN=FOXM1 PE=1 SV=3 197 274 3.0E-11
sp|Q9R1E0|FOXO1_MOUSE Forkhead box protein O1 OS=Mus musculus GN=Foxo1 PE=1 SV=2 202 310 3.0E-11
sp|Q810W5|FOXO1_ICTTR Forkhead box protein O1 OS=Ictidomys tridecemlineatus GN=FOXO1 PE=1 SV=1 202 310 4.0E-11
sp|B4KBF6|FOXO_DROMO Forkhead box protein O OS=Drosophila mojavensis GN=foxo PE=3 SV=1 202 275 6.0E-11
sp|B4MB78|FOXO_DROVI Forkhead box protein O OS=Drosophila virilis GN=foxo PE=3 SV=1 202 275 7.0E-11
sp|O15353|FOXN1_HUMAN Forkhead box protein N1 OS=Homo sapiens GN=FOXN1 PE=2 SV=1 198 305 7.0E-11
sp|Q61575|FOXN1_MOUSE Forkhead box protein N1 OS=Mus musculus GN=Foxn1 PE=1 SV=1 198 307 7.0E-11
sp|Q70KY4|FOXO6_MOUSE Forkhead box protein O6 OS=Mus musculus GN=Foxo6 PE=1 SV=1 202 314 8.0E-11
sp|O88621|FOXH1_MOUSE Forkhead box protein H1 OS=Mus musculus GN=Foxh1 PE=1 SV=1 198 274 1.0E-10
sp|B4JSC2|FOXO_DROGR Forkhead box protein O OS=Drosophila grimshawi GN=foxo PE=3 SV=1 202 275 2.0E-10
sp|A8MYZ6|FOXO6_HUMAN Forkhead box protein O6 OS=Homo sapiens GN=FOXO6 PE=1 SV=1 202 310 2.0E-10
sp|Q6EUW1|FOXO3_XENLA Forkhead box protein O3 OS=Xenopus laevis GN=foxo3 PE=2 SV=1 202 310 3.0E-10
sp|B4G4S8|FOXO_DROPE Forkhead box protein O OS=Drosophila persimilis GN=foxo PE=3 SV=2 137 275 3.0E-10
sp|B4HF64|FOXO_DROSE Forkhead box protein O OS=Drosophila sechellia GN=foxo PE=3 SV=2 202 275 3.0E-10
sp|B3P0K6|FOXO_DROER Forkhead box protein O OS=Drosophila erecta GN=foxo PE=3 SV=2 202 275 3.0E-10
sp|Q95V55|FOXO_DROME Forkhead box protein O OS=Drosophila melanogaster GN=foxo PE=1 SV=1 202 275 4.0E-10
sp|B4PTD3|FOXO_DROYA Forkhead box protein O OS=Drosophila yakuba GN=foxo PE=3 SV=2 202 275 4.0E-10
sp|Q298W7|FOXO_DROPS Forkhead box protein O OS=Drosophila pseudoobscura pseudoobscura GN=foxo PE=3 SV=2 202 275 4.0E-10
sp|B4NFR1|FOXO_DROWI Forkhead box protein O OS=Drosophila willistoni GN=foxo PE=3 SV=1 202 275 4.0E-10
sp|B3LYS5|FOXO_DROAN Forkhead box protein O OS=Drosophila ananassae GN=foxo PE=3 SV=2 202 275 4.0E-10
sp|Q3BJS0|FOXN5_XENLA Forkhead box protein N5 OS=Xenopus laevis GN=foxn5 PE=2 SV=1 194 258 3.0E-08
sp|Q3UTB7|FOXR1_MOUSE Forkhead box protein R1 OS=Mus musculus GN=Foxr1 PE=2 SV=2 185 259 3.0E-08
sp|Q28H65|FOXN5_XENTR Forkhead box protein N5 OS=Xenopus tropicalis GN=foxn5 PE=2 SV=1 165 258 2.0E-07
sp|Q6PIV2|FOXR1_HUMAN Forkhead box protein R1 OS=Homo sapiens GN=FOXR1 PE=1 SV=2 198 259 1.0E-06
sp|Q3UM89|FOXR2_MOUSE Forkhead box protein R2 OS=Mus musculus GN=Foxr2 PE=2 SV=1 198 259 3.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0043565 sequence-specific DNA binding Yes
GO:0003700 DNA-binding transcription factor activity Yes
GO:0006355 regulation of transcription, DNA-templated Yes
GO:0065007 biological regulation No
GO:0010468 regulation of gene expression No
GO:0140110 transcription regulator activity No
GO:0008150 biological_process No
GO:0005488 binding No
GO:0003674 molecular_function No
GO:0009889 regulation of biosynthetic process No
GO:0010556 regulation of macromolecule biosynthetic process No
GO:0060255 regulation of macromolecule metabolic process No
GO:0050789 regulation of biological process No
GO:0031323 regulation of cellular metabolic process No
GO:0003677 DNA binding No
GO:0051171 regulation of nitrogen compound metabolic process No
GO:0097159 organic cyclic compound binding No
GO:2001141 regulation of RNA biosynthetic process No
GO:1901363 heterocyclic compound binding No
GO:0050794 regulation of cellular process No
GO:0051252 regulation of RNA metabolic process No
GO:0031326 regulation of cellular biosynthetic process No
GO:0019222 regulation of metabolic process No
GO:0003676 nucleic acid binding No
GO:0080090 regulation of primary metabolic process No
GO:0019219 regulation of nucleobase-containing compound metabolic process No
GO:1903506 regulation of nucleic acid-templated transcription No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
Forkhead

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup856
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4169
Ophiocordyceps australis map64 (Brazil) OphauB2|6169 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|00574
Ophiocordyceps camponoti-rufipedis Ophun1|332
Ophiocordyceps kimflemingae Ophio5|7632
Ophiocordyceps subramaniannii Hirsu2|4712
Ophiocordyceps subramaniannii Hirsu2|5281

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|6169
MAQPAQYFGVCGSRPILPGGCLPGSDSPMISHAPMPDFIKPVRRPLANASNNVVLAPPPPTNAILSPHKARSPLQ
RMPLQPHDIKLNTIPMAPPMTQDMTTDSLHKKPQLSRFKTGSRLAPEGFDYAGKENMPPVIYPTSQPQNFAPDYY
VQKPNGKRSLMEAAPIKPSRCSKKAKTTQQQAQPLADAFAPITDSGHKPPHSYAQLIAMSILRSPEGRLTLSQIY
KWITDNYSFYRSNDMGWQNSIRHNLSLQKTFVKMERPKNDPGKGNYWTIKSGCEFQYLKMKPTRRGASNADKLNI
VSSKRPRSRKDSPHSRPATAPTSSNTSPVEPNFTLKMPLSGGLPPLSASQVMLQMPAERSSDATIVNSDSIAPEV
PMGHFADAYRRPASSHDSSTTVNLQSSPPFIQGTGADNRGRKSAPPQGKGHKRRLTANDDSGYISSIDSSALRSI
PRGLALNSEADRVHIKSGRAEEEIARLRGSSPFSPTKARSFSLHGPVSSSPLRQAHDKQMMPPVTPLVKIKPPVQ
PPPSVSPNTNLRIHREKMNTLLGSPAAWPHEQLMPWSPAFNLEHATLKPEMDFYNETFTSQWSIFPDPSALENGS
PFKPSSVKRPQMDRPSSTPGRLINTGSPAKKQLLGSLNATIADSPSRSLQTPSKVFGSPSKWLGDTNLFGSSAYA
VPSPEQFSFNGLSQDIEWPGKFTDMTDLIPDDDATGTEYSGLDILQGFEKIGTGASSSAQQSCPNPLSN*
Coding >OphauB2|6169
ATGGCTCAGCCTGCGCAGTACTTTGGCGTCTGTGGATCCAGGCCAATTCTTCCTGGAGGCTGCCTGCCTGGTAGC
GATTCTCCCATGATCAGCCACGCTCCCATGCCCGACTTCATCAAGCCCGTGCGCCGTCCTCTTGCCAATGCTTCC
AACAATGTTGTCCTCGCCCCTCCGCCTCCCACCAACGCCATCCTTTCGCCACACAAGGCCAGATCGCCTTTGCAG
CGCATGCCTCTGCAACCCCATGACATTAAACTCAACACAATACCCATGGCTCCTCCAATGACCCAAGATATGACT
ACCGACTCCCTGCACAAGAAGCCGCAGCTTTCGCGCTTCAAGACTGGCTCTCGTCTGGCGCCCGAGGGCTTCGAC
TACGCTGGCAAAGAAAATATGCCGCCCGTCATCTATCCCACTAGCCAACCCCAAAACTTTGCACCCGACTATTAT
GTCCAAAAACCAAATGGCAAGCGAAGCCTCATGGAAGCCGCGCCCATCAAACCGTCCAGGTGCTCCAAAAAGGCA
AAGACTACACAACAGCAGGCACAGCCTCTAGCAGATGCCTTTGCTCCCATCACTGACAGCGGCCACAAACCACCT
CACAGCTACGCCCAGCTCATCGCCATGTCTATTCTGCGATCTCCCGAAGGTCGCTTGACCCTGTCTCAAATTTAC
AAGTGGATTACTGATAACTATTCCTTTTATCGTTCAAATGACATGGGCTGGCAAAACAGCATTCGCCACAATCTT
AGTCTTCAAAAGACCTTTGTCAAGATGGAGCGGCCCAAGAACGATCCTGGAAAGGGTAACTACTGGACCATCAAG
TCTGGTTGCGAGTTTCAGTACCTCAAGATGAAGCCGACGAGGAGGGGTGCATCCAATGCCGATAAACTCAACATT
GTTTCCTCCAAGCGACCGCGCTCTAGAAAGGATTCTCCGCACTCGCGACCCGCAACAGCGCCGACTTCTTCCAAC
ACGTCACCTGTGGAGCCCAATTTTACTTTGAAAATGCCCCTGTCAGGAGGACTTCCTCCACTTTCGGCCTCGCAA
GTAATGTTGCAAATGCCCGCGGAACGGTCATCGGACGCAACCATTGTGAATTCGGATAGCATTGCTCCCGAGGTG
CCAATGGGCCATTTTGCAGATGCCTATCGACGTCCTGCTTCGTCTCACGATTCCAGCACCACTGTGAACCTGCAA
TCATCTCCGCCATTTATCCAAGGCACGGGCGCCGACAATCGAGGTCGCAAATCCGCGCCGCCTCAGGGTAAGGGT
CACAAACGCAGACTTACTGCCAATGACGACAGCGGCTACATATCCTCGATAGATTCGTCAGCCCTGAGATCTATT
CCCAGAGGTCTTGCATTGAACTCCGAGGCTGATCGAGTCCACATCAAGTCTGGCCGGGCCGAGGAAGAGATTGCG
CGTCTGCGCGGATCCTCACCCTTTAGCCCAACCAAGGCGCGCTCATTTTCTCTTCACGGTCCAGTTTCCTCTTCG
CCTCTCCGACAGGCACATGACAAGCAAATGATGCCGCCAGTGACCCCTCTGGTCAAAATCAAGCCTCCTGTGCAG
CCACCACCCTCGGTTTCGCCCAATACGAATTTGCGCATCCATCGTGAGAAGATGAACACCCTTCTTGGCTCTCCG
GCAGCCTGGCCTCACGAGCAATTGATGCCTTGGAGTCCCGCGTTCAATTTGGAACATGCTACTCTCAAGCCGGAA
ATGGACTTTTACAACGAGACTTTTACCTCGCAATGGAGCATTTTCCCCGATCCAAGCGCACTGGAAAACGGCTCT
CCCTTTAAGCCCTCTTCTGTCAAGCGTCCTCAAATGGACCGACCCAGCTCGACACCCGGTCGCTTGATCAATACG
GGCTCACCCGCGAAGAAGCAGCTTCTTGGTTCTCTAAACGCTACCATTGCTGATTCTCCATCGCGCTCTCTGCAG
ACTCCCAGTAAAGTGTTTGGCTCGCCCTCCAAATGGCTTGGAGATACCAATCTTTTTGGGAGCTCGGCATATGCG
GTTCCTTCTCCCGAACAATTTTCCTTCAACGGCCTGTCGCAAGACATTGAATGGCCAGGAAAGTTTACCGACATG
ACGGATCTCATACCCGATGATGACGCGACTGGCACAGAATATTCTGGACTGGATATTCTCCAGGGATTCGAAAAG
ATTGGCACTGGTGCTTCGTCGTCGGCGCAACAATCTTGCCCCAATCCTCTCTCGAATTAA
Transcript >OphauB2|6169
ATGGCTCAGCCTGCGCAGTACTTTGGCGTCTGTGGATCCAGGCCAATTCTTCCTGGAGGCTGCCTGCCTGGTAGC
GATTCTCCCATGATCAGCCACGCTCCCATGCCCGACTTCATCAAGCCCGTGCGCCGTCCTCTTGCCAATGCTTCC
AACAATGTTGTCCTCGCCCCTCCGCCTCCCACCAACGCCATCCTTTCGCCACACAAGGCCAGATCGCCTTTGCAG
CGCATGCCTCTGCAACCCCATGACATTAAACTCAACACAATACCCATGGCTCCTCCAATGACCCAAGATATGACT
ACCGACTCCCTGCACAAGAAGCCGCAGCTTTCGCGCTTCAAGACTGGCTCTCGTCTGGCGCCCGAGGGCTTCGAC
TACGCTGGCAAAGAAAATATGCCGCCCGTCATCTATCCCACTAGCCAACCCCAAAACTTTGCACCCGACTATTAT
GTCCAAAAACCAAATGGCAAGCGAAGCCTCATGGAAGCCGCGCCCATCAAACCGTCCAGGTGCTCCAAAAAGGCA
AAGACTACACAACAGCAGGCACAGCCTCTAGCAGATGCCTTTGCTCCCATCACTGACAGCGGCCACAAACCACCT
CACAGCTACGCCCAGCTCATCGCCATGTCTATTCTGCGATCTCCCGAAGGTCGCTTGACCCTGTCTCAAATTTAC
AAGTGGATTACTGATAACTATTCCTTTTATCGTTCAAATGACATGGGCTGGCAAAACAGCATTCGCCACAATCTT
AGTCTTCAAAAGACCTTTGTCAAGATGGAGCGGCCCAAGAACGATCCTGGAAAGGGTAACTACTGGACCATCAAG
TCTGGTTGCGAGTTTCAGTACCTCAAGATGAAGCCGACGAGGAGGGGTGCATCCAATGCCGATAAACTCAACATT
GTTTCCTCCAAGCGACCGCGCTCTAGAAAGGATTCTCCGCACTCGCGACCCGCAACAGCGCCGACTTCTTCCAAC
ACGTCACCTGTGGAGCCCAATTTTACTTTGAAAATGCCCCTGTCAGGAGGACTTCCTCCACTTTCGGCCTCGCAA
GTAATGTTGCAAATGCCCGCGGAACGGTCATCGGACGCAACCATTGTGAATTCGGATAGCATTGCTCCCGAGGTG
CCAATGGGCCATTTTGCAGATGCCTATCGACGTCCTGCTTCGTCTCACGATTCCAGCACCACTGTGAACCTGCAA
TCATCTCCGCCATTTATCCAAGGCACGGGCGCCGACAATCGAGGTCGCAAATCCGCGCCGCCTCAGGGTAAGGGT
CACAAACGCAGACTTACTGCCAATGACGACAGCGGCTACATATCCTCGATAGATTCGTCAGCCCTGAGATCTATT
CCCAGAGGTCTTGCATTGAACTCCGAGGCTGATCGAGTCCACATCAAGTCTGGCCGGGCCGAGGAAGAGATTGCG
CGTCTGCGCGGATCCTCACCCTTTAGCCCAACCAAGGCGCGCTCATTTTCTCTTCACGGTCCAGTTTCCTCTTCG
CCTCTCCGACAGGCACATGACAAGCAAATGATGCCGCCAGTGACCCCTCTGGTCAAAATCAAGCCTCCTGTGCAG
CCACCACCCTCGGTTTCGCCCAATACGAATTTGCGCATCCATCGTGAGAAGATGAACACCCTTCTTGGCTCTCCG
GCAGCCTGGCCTCACGAGCAATTGATGCCTTGGAGTCCCGCGTTCAATTTGGAACATGCTACTCTCAAGCCGGAA
ATGGACTTTTACAACGAGACTTTTACCTCGCAATGGAGCATTTTCCCCGATCCAAGCGCACTGGAAAACGGCTCT
CCCTTTAAGCCCTCTTCTGTCAAGCGTCCTCAAATGGACCGACCCAGCTCGACACCCGGTCGCTTGATCAATACG
GGCTCACCCGCGAAGAAGCAGCTTCTTGGTTCTCTAAACGCTACCATTGCTGATTCTCCATCGCGCTCTCTGCAG
ACTCCCAGTAAAGTGTTTGGCTCGCCCTCCAAATGGCTTGGAGATACCAATCTTTTTGGGAGCTCGGCATATGCG
GTTCCTTCTCCCGAACAATTTTCCTTCAACGGCCTGTCGCAAGACATTGAATGGCCAGGAAAGTTTACCGACATG
ACGGATCTCATACCCGATGATGACGCGACTGGCACAGAATATTCTGGACTGGATATTCTCCAGGGATTCGAAAAG
ATTGGCACTGGTGCTTCGTCGTCGGCGCAACAATCTTGCCCCAATCCTCTCTCGAATTAA
Gene >OphauB2|6169
ATGGCTCAGCCTGCGCAGTACTTTGGCGTCTGTGGATCCAGGCCAATTCTTCCTGGAGGCTGCCTGCCTGGTAGC
GATTCTCCCATGATCAGCCACGCTCCCATGCCCGACTTCATCAAGCCCGTGCGCCGTCCTCTTGCCAATGCTTCC
AACAATGTTGTCCTCGCCCCTCCGCCTCCCACCAACGCCATCCTTTCGCCACACAAGGCCAGATCGCCTTTGCAG
CGCATGCCTCTGCAACCCCATGACATTAAACTCAACACAATACCCATGGCTCCTCCAATGACCCAAGATATGACT
ACCGACTCCCTGCACAAGAAGCCGCAGCTTTCGCGCTTCAAGACTGGCTCTCGTCTGGCGCCCGAGGGCTTCGAC
TACGCTGGCAAAGAAAATATGCCGCCCGTCATCTATCCCACTAGCCAACCCCAAAACTTTGCACCCGACTATTAT
GTCCAAAAACCAAATGGCAAGCGAAGCCTCATGGAAGCCGCGCCCATCAAACCGTCCAGGTGCTCCAAAAAGGCA
AAGACTACACAACAGCAGGCACAGCCTCTAGCAGATGCCTTTGCTCCCATCACTGACAGCGGCCACAAACCACCT
CACAGCTACGCCCAGCTCATCGCCATGTCTATTCTGCGATCTCCCGAAGGTCGCTTGACCCTGTCTCAAATTTAC
AAGTGGATTACTGATAACTATTCCTTTTATCGTTCAAATGACATGGGCTGGCAAAACAGCATTCGCCACAATCTT
AGTCTTCAAAAGACCTTTGTCAAGATGGAGCGGCCCAAGAACGATCCTGGAAAGGGTAACTACTGGACCATCAAG
TCTGGTTGCGAGTTTCAGTACCTCAAGATGAAGCCGACGAGGAGGGGTGCATCCAATGCCGATAAACTCAACATT
GTTTCCTCCAAGCGACCGCGCTCTAGAAAGGATTCTCCGCACTCGCGACCCGCAACAGCGCCGACTTCTTCCAAC
ACGTCACCTGTGGAGCCCAATTTTACTTTGAAAATGCCCCTGTCAGGAGGACTTCCTCCACTTTCGGCCTCGCAA
GTAATGTTGCAAATGCCCGCGGAACGGTCATCGGACGCAACCATTGTGAATTCGGATAGCATTGCTCCCGAGGTG
CCAATGGGCCATTTTGCAGATGCCTATCGACGTCCTGCTTCGTCTCACGATTCCAGCACCACTGTGAACCTGCAA
TCATCTCCGCCATTTATCCAAGGCACGGGCGCCGACAATCGAGGTCGCAAATCCGCGCCGCCTCAGGGTAAGGGT
CACAAACGCAGACTTACTGCCAATGACGACAGCGGCTACATATCCTCGATAGATTCGTCAGCCCTGAGATCTATT
CCCAGAGGTCTTGCATTGAACTCCGAGGCTGATCGAGTCCACATCAAGTCTGGCCGGGCCGAGGAAGAGATTGCG
CGTCTGCGCGGATCCTCACCCTTTAGCCCAACCAAGGCGCGCTCATTTTCTCTTCACGGTCCAGTTTCCTCTTCG
CCTCTCCGACAGGCACATGACAAGCAAATGATGCCGCCAGTGACCCCTCTGGTCAAAATCAAGCCTCCTGTGCAG
CCACCACCCTCGGTTTCGCCCAATACGAATTTGCGCATCCATCGTGAGAAGATGAACACCCTTCTTGGCTCTCCG
GCAGCCTGGCCTCACGAGCAATTGATGCCTTGGAGTCCCGCGTTCAATTTGGAACATGCTACTCTCAAGCCGGAA
ATGGACTTTTACAACGAGACTTTTACCTCGCAATGGAGCATTTTCCCCGATCCAAGCGCACTGGAAAACGGCTCT
CCCTTTAAGCCCTCTTCTGTCAAGCGTCCTCAAATGGACCGACCCAGCTCGACACCCGGTCGCTTGATCAATACG
GGCTCACCCGCGAAGAAGCAGCTTCTTGGTTCTCTAAACGCTACCATTGCTGATTCTCCATCGCGCTCTCTGCAG
ACTCCCAGTAAAGTGTTTGGCTCGCCCTCCAAATGGCTTGGAGATACCAATCTTTTTGGGAGCTCGGCATATGCG
GTTCCTTCTCCCGAACAATTTTCCTTCAACGGCCTGTCGCAAGACATTGAATGGCCAGGAAAGTTTACCGACATG
ACGGATCTCATACCCGATGATGACGCGACTGGCACAGAATATTCTGGACTGGATATTCTCCAGGGATTCGAAAAG
ATTGGCACTGGTGCTTCGTCGTCGGCGCAACAATCTTGCCCCAATCCTCTCTCGAATTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail