Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|6164
Gene name
LocationContig_54:17231..20965
Strand+
Gene length (bp)3734
Transcript length (bp)3576
Coding sequence length (bp)3576
Protein length (aa) 1192

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13181 TPR_8 Tetratricopeptide repeat 5.0E-03 761 786
PF13181 TPR_8 Tetratricopeptide repeat 1.7E-02 803 834
PF13176 TPR_7 Tetratricopeptide repeat 5.7E-03 568 596
PF13176 TPR_7 Tetratricopeptide repeat 2.6E-04 763 789
PF13432 TPR_16 Tetratricopeptide repeat 1.0E-02 764 827
PF13174 TPR_6 Tetratricopeptide repeat 1.4E-01 568 596

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O42668|TPR1_SCHPO Tetratricopeptide repeat protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tpr1 PE=1 SV=1 26 998 3.0E-158
sp|P89105|CTR9_YEAST RNA polymerase-associated protein CTR9 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CTR9 PE=1 SV=3 23 1023 1.0E-102
sp|Q62018|CTR9_MOUSE RNA polymerase-associated protein CTR9 homolog OS=Mus musculus GN=Ctr9 PE=1 SV=2 25 943 4.0E-60
sp|Q6PD62|CTR9_HUMAN RNA polymerase-associated protein CTR9 homolog OS=Homo sapiens GN=CTR9 PE=1 SV=1 25 943 2.0E-59
sp|Q6DEU9|CTR9_XENTR RNA polymerase-associated protein CTR9 homolog OS=Xenopus tropicalis GN=ctr9 PE=2 SV=1 25 973 3.0E-58
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O42668|TPR1_SCHPO Tetratricopeptide repeat protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tpr1 PE=1 SV=1 26 998 3.0E-158
sp|P89105|CTR9_YEAST RNA polymerase-associated protein CTR9 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CTR9 PE=1 SV=3 23 1023 1.0E-102
sp|Q62018|CTR9_MOUSE RNA polymerase-associated protein CTR9 homolog OS=Mus musculus GN=Ctr9 PE=1 SV=2 25 943 4.0E-60
sp|Q6PD62|CTR9_HUMAN RNA polymerase-associated protein CTR9 homolog OS=Homo sapiens GN=CTR9 PE=1 SV=1 25 943 2.0E-59
sp|Q6DEU9|CTR9_XENTR RNA polymerase-associated protein CTR9 homolog OS=Xenopus tropicalis GN=ctr9 PE=2 SV=1 25 973 3.0E-58
sp|Q4QR29|CTR9_XENLA RNA polymerase-associated protein CTR9 homolog OS=Xenopus laevis GN=ctr9 PE=2 SV=1 25 973 2.0E-57
sp|Q03560|CTR9_CAEEL RNA polymerase-associated protein CTR9 OS=Caenorhabditis elegans GN=ctr-9 PE=3 SV=3 26 950 1.0E-45
sp|B5X0I6|VIP6_ARATH Protein CTR9 homolog OS=Arabidopsis thaliana GN=VIP6 PE=1 SV=1 24 968 2.0E-43
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 33 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|6164
MSNGTANGNTEPGPASIRFSDIPSAIDIPVQGDQEDEAVEIDLDDLLDDPTELCTLFENEHAAKTYWMTVALAYA
KQHKIDHAIEMLLRGISCISNSANPRDKVSMICCLCWMYLWKSREAPRVAPEHVPVSEAKTKEYYLQLATSSLND
AARLNPSFPPIFLARGVLVLLKASLQAPAKTAGSIGTEKQELLKTAIKSFDDALRVSQGKNMLALLGKARAFYSM
HKFADSLAAYQDVLQKMPDLVDPDPRIGIGCCFWQLGYRQDAKIAWERALEINPESKVANILLGLFYLDSCGRMP
INSENFIKLYKIAMTEYTQKAFKIDKDMPLTCATFANYFLSRKAWSNIDKLAHKAIQHTDVNAIASDGWYLLARM
AHYNGETEKASDYYRRADDARGGTDTGYLPAKFGVAQLSVLKDDLGEAKLRLEKIIQQSKSLEAMVLLGTFAWKD
AKKGLSPDPSVLLNLARLYESENPEKALQCLLQVEQLEMEQIPESERPADITDEAELQAAIRKLLPPQLLNNIGC
FHYQAERYELASDLFEAALGACMKIGEKDAEMDTDALVSTISFNLGRTYEARGLTDKAIEVYQGLLSRHDDYTDA
RTRLAYIKLRRHPNKEGPDAVAKLYQENTSDLEVRALFGWYLGKVHSRKRPANVAEDQEFRHYKHTLQNYDKHDR
YALVGMGNLYLMQAREMRRESDQDRQKRSAVYCKAVEFFEKALSLDPKNAYAAQGIAIALVEDRKDYKTALPIFN
KVRETVKDSHLFVNLGHMYSELRQYTKAIENYETALTKDGKASDPVILSCLGRTWLNKGRAERDIDAYNKALECA
QKALSIAPDQVHYKFNVAFVQIQLVTTIQGLPEMRRTLEQLEKAAEGLEAAIESLDTIATLPTTPYPKHDVEQRA
NMARNTLRKQLERAIGKQREWEDKNREKIQAAREQREAEVRRREAEREMILEKERERQEKIKKEREEIAARDRER
AEQRAKEERERIEAEMTEDETGQKVKRKKRKPATRATSETKTKKPSRKKRNGREDGNESSSQDETRTKKRRRLTK
KESTKYKSAEVIVNSDDDDDDDAHALKQAEQESGRKETPPTEADEDDGDRMDIDEDSHGDGARHAEANDDDDDED
EAAVPRQQHQRSRRGQVLESEDEDDDNGDDGGSVDAHGKPRAQSGVEDGSSPAAAAESAASRGNND*
Coding >OphauB2|6164
ATGTCCAACGGGACTGCCAACGGCAATACCGAGCCTGGTCCTGCCAGCATCCGCTTCTCTGATATCCCGTCGGCC
ATCGACATCCCCGTCCAAGGCGACCAGGAGGACGAGGCTGTCGAAATTGACCTCGACGACCTGCTCGACGATCCC
ACTGAGCTCTGTACTCTTTTTGAGAATGAGCATGCGGCCAAAACATACTGGATGACGGTTGCGCTGGCCTATGCA
AAGCAGCACAAGATTGACCATGCCATCGAGATGCTCCTCCGCGGCATCAGCTGCATTAGCAATAGCGCCAACCCC
CGCGACAAAGTGAGCATGATCTGCTGCCTGTGTTGGATGTATCTGTGGAAAAGCCGAGAAGCGCCGCGAGTGGCA
CCCGAGCATGTGCCCGTTTCCGAGGCCAAGACCAAGGAGTACTATCTTCAGCTAGCCACGTCGTCGCTCAACGAT
GCTGCACGTCTCAACCCTTCGTTTCCACCCATATTTCTGGCCAGAGGTGTTCTCGTCCTCCTCAAAGCGTCTCTG
CAGGCACCTGCAAAAACGGCAGGGAGCATTGGTACAGAAAAGCAAGAACTTCTCAAGACGGCTATCAAGTCATTC
GACGACGCTCTGCGTGTCTCACAGGGAAAGAACATGCTGGCTTTGTTGGGAAAAGCCCGTGCATTCTACTCGATG
CATAAATTCGCCGACTCACTGGCTGCCTATCAAGATGTCCTCCAGAAGATGCCAGACCTTGTCGACCCGGATCCG
CGAATTGGCATCGGCTGCTGTTTTTGGCAGCTGGGATACAGGCAAGACGCAAAAATAGCCTGGGAACGCGCTCTA
GAAATCAACCCCGAGTCAAAGGTGGCTAATATTCTGCTCGGCCTCTTCTACCTCGACTCATGTGGCCGCATGCCA
ATCAACAGCGAAAATTTCATCAAGCTATACAAAATCGCCATGACTGAATATACACAAAAGGCATTTAAGATTGAC
AAGGATATGCCTCTCACTTGTGCCACGTTTGCCAATTACTTCTTGTCCCGCAAGGCCTGGAGCAATATCGACAAG
CTGGCACACAAAGCCATTCAACATACCGACGTCAATGCTATTGCCAGCGATGGTTGGTATCTGCTGGCGAGAATG
GCCCACTACAACGGCGAGACAGAGAAAGCTAGTGACTACTACCGGCGTGCGGATGACGCGCGGGGCGGCACAGAC
ACTGGATATCTCCCTGCGAAATTCGGCGTTGCTCAATTGTCTGTCCTCAAAGACGACTTGGGTGAAGCCAAGCTT
CGACTAGAGAAAATCATTCAACAATCCAAAAGCCTCGAGGCCATGGTTCTACTCGGGACTTTTGCTTGGAAAGAC
GCCAAGAAGGGTCTTTCTCCCGATCCTTCTGTTCTGCTGAACCTGGCTCGGTTGTACGAATCGGAGAATCCAGAA
AAGGCGCTACAGTGCCTGCTGCAAGTGGAACAGCTGGAAATGGAGCAGATACCAGAATCAGAGCGTCCAGCAGAT
ATCACGGACGAGGCCGAGTTACAAGCTGCCATAAGAAAGCTTTTACCACCGCAGCTGCTAAATAACATTGGATGC
TTCCACTACCAAGCCGAGAGGTACGAGCTTGCCAGCGATCTATTTGAGGCGGCCCTAGGTGCATGCATGAAAATA
GGAGAAAAGGACGCCGAGATGGATACAGACGCGCTGGTCTCGACCATCAGCTTTAATCTGGGAAGGACATATGAG
GCTAGAGGCTTGACAGACAAGGCGATCGAGGTCTATCAGGGCCTGCTGTCTCGTCATGACGACTACACTGACGCA
CGGACAAGACTGGCCTACATCAAGCTGAGAAGACACCCCAACAAAGAAGGACCCGACGCTGTTGCCAAGTTGTAC
CAAGAGAATACGAGCGACTTGGAAGTGCGCGCCTTGTTTGGCTGGTACTTGGGCAAAGTCCATTCACGAAAGCGA
CCAGCCAATGTCGCAGAGGATCAAGAGTTTCGCCATTACAAGCATACTTTGCAAAATTACGACAAGCACGACAGA
TATGCTCTCGTTGGTATGGGCAACCTCTACCTCATGCAGGCAAGAGAAATGCGACGAGAATCAGACCAGGACAGA
CAAAAGCGAAGTGCAGTGTACTGCAAGGCTGTCGAATTCTTCGAAAAAGCCTTGTCTCTGGACCCAAAGAATGCC
TACGCAGCACAAGGCATCGCCATTGCCTTGGTCGAGGACAGAAAAGATTACAAGACAGCACTGCCCATCTTCAAT
AAAGTCCGGGAAACGGTCAAAGACTCGCATCTATTTGTCAATCTGGGTCACATGTACTCGGAGCTGAGGCAATAC
ACGAAAGCAATTGAAAACTACGAGACTGCTCTGACCAAGGATGGCAAAGCAAGTGACCCTGTCATTCTCTCTTGC
CTTGGTCGGACCTGGCTCAACAAGGGTCGCGCTGAGAGAGATATTGATGCTTACAACAAGGCCTTGGAATGCGCA
CAAAAGGCTTTATCTATAGCCCCAGATCAAGTGCACTACAAATTCAATGTCGCCTTTGTGCAAATTCAGCTCGTG
ACTACTATTCAGGGGCTTCCAGAAATGAGGCGAACATTGGAGCAACTAGAAAAAGCGGCAGAGGGTCTCGAGGCT
GCAATTGAATCCCTGGACACCATTGCCACCCTTCCGACGACTCCATATCCTAAACATGATGTGGAGCAGCGGGCA
AACATGGCGCGCAACACGCTACGTAAGCAACTAGAGAGAGCTATTGGGAAGCAACGAGAATGGGAGGATAAGAAC
AGAGAGAAGATACAGGCGGCACGAGAGCAACGAGAGGCCGAGGTAAGACGGCGTGAGGCGGAGCGTGAAATGATC
TTGGAGAAGGAGCGCGAACGGCAGGAAAAGATCAAGAAGGAACGCGAGGAAATCGCTGCTCGGGACAGGGAGCGA
GCAGAGCAACGAGCCAAGGAGGAGCGTGAGCGCATCGAGGCTGAAATGACCGAGGATGAAACTGGCCAGAAGGTG
AAGCGCAAGAAGCGCAAGCCGGCAACACGGGCAACAAGCGAGACCAAGACCAAGAAGCCATCTCGCAAGAAGAGG
AACGGACGTGAAGACGGCAACGAGTCTTCGTCGCAAGACGAGACGCGGACTAAGAAGCGCAGACGCCTCACAAAG
AAGGAGTCGACCAAGTACAAGTCTGCCGAAGTCATTGTCAACAGCGACGATGACGACGATGACGACGCCCATGCT
TTGAAGCAGGCTGAACAAGAGAGCGGTCGGAAGGAGACACCGCCAACAGAAGCGGATGAGGACGACGGCGATAGG
ATGGACATTGACGAGGACAGTCATGGCGATGGTGCCCGACATGCCGAGGCCAACGATGATGACGATGATGAAGAC
GAGGCAGCTGTGCCGCGTCAACAGCACCAGCGGTCTCGTCGGGGCCAGGTCCTGGAGAGCGAGGACGAGGATGAC
GACAACGGCGACGACGGTGGCAGCGTCGATGCTCATGGCAAGCCTCGCGCTCAGTCGGGCGTAGAAGACGGAAGC
AGCCCTGCAGCAGCGGCAGAGAGTGCTGCGTCTCGAGGCAACAACGACTGA
Transcript >OphauB2|6164
ATGTCCAACGGGACTGCCAACGGCAATACCGAGCCTGGTCCTGCCAGCATCCGCTTCTCTGATATCCCGTCGGCC
ATCGACATCCCCGTCCAAGGCGACCAGGAGGACGAGGCTGTCGAAATTGACCTCGACGACCTGCTCGACGATCCC
ACTGAGCTCTGTACTCTTTTTGAGAATGAGCATGCGGCCAAAACATACTGGATGACGGTTGCGCTGGCCTATGCA
AAGCAGCACAAGATTGACCATGCCATCGAGATGCTCCTCCGCGGCATCAGCTGCATTAGCAATAGCGCCAACCCC
CGCGACAAAGTGAGCATGATCTGCTGCCTGTGTTGGATGTATCTGTGGAAAAGCCGAGAAGCGCCGCGAGTGGCA
CCCGAGCATGTGCCCGTTTCCGAGGCCAAGACCAAGGAGTACTATCTTCAGCTAGCCACGTCGTCGCTCAACGAT
GCTGCACGTCTCAACCCTTCGTTTCCACCCATATTTCTGGCCAGAGGTGTTCTCGTCCTCCTCAAAGCGTCTCTG
CAGGCACCTGCAAAAACGGCAGGGAGCATTGGTACAGAAAAGCAAGAACTTCTCAAGACGGCTATCAAGTCATTC
GACGACGCTCTGCGTGTCTCACAGGGAAAGAACATGCTGGCTTTGTTGGGAAAAGCCCGTGCATTCTACTCGATG
CATAAATTCGCCGACTCACTGGCTGCCTATCAAGATGTCCTCCAGAAGATGCCAGACCTTGTCGACCCGGATCCG
CGAATTGGCATCGGCTGCTGTTTTTGGCAGCTGGGATACAGGCAAGACGCAAAAATAGCCTGGGAACGCGCTCTA
GAAATCAACCCCGAGTCAAAGGTGGCTAATATTCTGCTCGGCCTCTTCTACCTCGACTCATGTGGCCGCATGCCA
ATCAACAGCGAAAATTTCATCAAGCTATACAAAATCGCCATGACTGAATATACACAAAAGGCATTTAAGATTGAC
AAGGATATGCCTCTCACTTGTGCCACGTTTGCCAATTACTTCTTGTCCCGCAAGGCCTGGAGCAATATCGACAAG
CTGGCACACAAAGCCATTCAACATACCGACGTCAATGCTATTGCCAGCGATGGTTGGTATCTGCTGGCGAGAATG
GCCCACTACAACGGCGAGACAGAGAAAGCTAGTGACTACTACCGGCGTGCGGATGACGCGCGGGGCGGCACAGAC
ACTGGATATCTCCCTGCGAAATTCGGCGTTGCTCAATTGTCTGTCCTCAAAGACGACTTGGGTGAAGCCAAGCTT
CGACTAGAGAAAATCATTCAACAATCCAAAAGCCTCGAGGCCATGGTTCTACTCGGGACTTTTGCTTGGAAAGAC
GCCAAGAAGGGTCTTTCTCCCGATCCTTCTGTTCTGCTGAACCTGGCTCGGTTGTACGAATCGGAGAATCCAGAA
AAGGCGCTACAGTGCCTGCTGCAAGTGGAACAGCTGGAAATGGAGCAGATACCAGAATCAGAGCGTCCAGCAGAT
ATCACGGACGAGGCCGAGTTACAAGCTGCCATAAGAAAGCTTTTACCACCGCAGCTGCTAAATAACATTGGATGC
TTCCACTACCAAGCCGAGAGGTACGAGCTTGCCAGCGATCTATTTGAGGCGGCCCTAGGTGCATGCATGAAAATA
GGAGAAAAGGACGCCGAGATGGATACAGACGCGCTGGTCTCGACCATCAGCTTTAATCTGGGAAGGACATATGAG
GCTAGAGGCTTGACAGACAAGGCGATCGAGGTCTATCAGGGCCTGCTGTCTCGTCATGACGACTACACTGACGCA
CGGACAAGACTGGCCTACATCAAGCTGAGAAGACACCCCAACAAAGAAGGACCCGACGCTGTTGCCAAGTTGTAC
CAAGAGAATACGAGCGACTTGGAAGTGCGCGCCTTGTTTGGCTGGTACTTGGGCAAAGTCCATTCACGAAAGCGA
CCAGCCAATGTCGCAGAGGATCAAGAGTTTCGCCATTACAAGCATACTTTGCAAAATTACGACAAGCACGACAGA
TATGCTCTCGTTGGTATGGGCAACCTCTACCTCATGCAGGCAAGAGAAATGCGACGAGAATCAGACCAGGACAGA
CAAAAGCGAAGTGCAGTGTACTGCAAGGCTGTCGAATTCTTCGAAAAAGCCTTGTCTCTGGACCCAAAGAATGCC
TACGCAGCACAAGGCATCGCCATTGCCTTGGTCGAGGACAGAAAAGATTACAAGACAGCACTGCCCATCTTCAAT
AAAGTCCGGGAAACGGTCAAAGACTCGCATCTATTTGTCAATCTGGGTCACATGTACTCGGAGCTGAGGCAATAC
ACGAAAGCAATTGAAAACTACGAGACTGCTCTGACCAAGGATGGCAAAGCAAGTGACCCTGTCATTCTCTCTTGC
CTTGGTCGGACCTGGCTCAACAAGGGTCGCGCTGAGAGAGATATTGATGCTTACAACAAGGCCTTGGAATGCGCA
CAAAAGGCTTTATCTATAGCCCCAGATCAAGTGCACTACAAATTCAATGTCGCCTTTGTGCAAATTCAGCTCGTG
ACTACTATTCAGGGGCTTCCAGAAATGAGGCGAACATTGGAGCAACTAGAAAAAGCGGCAGAGGGTCTCGAGGCT
GCAATTGAATCCCTGGACACCATTGCCACCCTTCCGACGACTCCATATCCTAAACATGATGTGGAGCAGCGGGCA
AACATGGCGCGCAACACGCTACGTAAGCAACTAGAGAGAGCTATTGGGAAGCAACGAGAATGGGAGGATAAGAAC
AGAGAGAAGATACAGGCGGCACGAGAGCAACGAGAGGCCGAGGTAAGACGGCGTGAGGCGGAGCGTGAAATGATC
TTGGAGAAGGAGCGCGAACGGCAGGAAAAGATCAAGAAGGAACGCGAGGAAATCGCTGCTCGGGACAGGGAGCGA
GCAGAGCAACGAGCCAAGGAGGAGCGTGAGCGCATCGAGGCTGAAATGACCGAGGATGAAACTGGCCAGAAGGTG
AAGCGCAAGAAGCGCAAGCCGGCAACACGGGCAACAAGCGAGACCAAGACCAAGAAGCCATCTCGCAAGAAGAGG
AACGGACGTGAAGACGGCAACGAGTCTTCGTCGCAAGACGAGACGCGGACTAAGAAGCGCAGACGCCTCACAAAG
AAGGAGTCGACCAAGTACAAGTCTGCCGAAGTCATTGTCAACAGCGACGATGACGACGATGACGACGCCCATGCT
TTGAAGCAGGCTGAACAAGAGAGCGGTCGGAAGGAGACACCGCCAACAGAAGCGGATGAGGACGACGGCGATAGG
ATGGACATTGACGAGGACAGTCATGGCGATGGTGCCCGACATGCCGAGGCCAACGATGATGACGATGATGAAGAC
GAGGCAGCTGTGCCGCGTCAACAGCACCAGCGGTCTCGTCGGGGCCAGGTCCTGGAGAGCGAGGACGAGGATGAC
GACAACGGCGACGACGGTGGCAGCGTCGATGCTCATGGCAAGCCTCGCGCTCAGTCGGGCGTAGAAGACGGAAGC
AGCCCTGCAGCAGCGGCAGAGAGTGCTGCGTCTCGAGGCAACAACGACTGA
Gene >OphauB2|6164
ATGTCCAACGGGACTGCCAACGGCAATACCGAGCCTGGTCCTGCCAGCATCCGCTTCTCTGATATCCCGTCGGCC
ATCGACATCCCCGTCCAAGGCGACCAGGAGGACGAGGCTGTCGAAATTGACCTCGACGACCTGCTCGACGATCCC
ACTGAGCTCTGTACTCTTTTTGAGAATGAGCATGCGGCCAAAACATACTGGATGACGGTTGCGCTGGCCTATGCA
AAGCAGCACAAGATTGACCATGCCATCGAGATGCTCCTCCGCGGCATCAGCTGCATTAGCAATAGCGCCAACCCC
CGCGACAAAGTGAGCATGATCTGCTGCCTGTGTTGGATGTATCTGTGGAAAAGCCGAGAAGCGCCGCGAGTGGCA
CCCGAGCATGTGCCCGTTTCCGAGGCCAAGACCAAGGAGTACTATCTTCAGCTAGCCACGTCGTCGCTCAACGAT
GCTGCACGTCTCAACCCTTCGTTTCCACCCATATTTCTGGCCAGAGGTGTTCTCGTCCTCCTCAAAGCGTCTCTG
CAGGCACCTGCAAAAACGGCAGGGAGCATTGGTACAGAAAAGCAAGAACTTCTCAAGACGGCTATCAAGTCATTC
GACGACGCTCTGCGTGTCTCACAGGGAAAGAACATGCTGGCTTTGTTGGGAAAAGCCCGTGCATTCTACTCGATG
CATAAATTCGCCGACTCACTGGCTGCCTATCAAGATGTCCTCCAGAAGATGCCAGACCTTGTCGACCCGGATCCG
CGAATTGGCATCGGCTGCTGTTTTTGGCAGCTGGGATACAGGCAAGACGCAAAAATAGCCTGGGAACGCGCTCTA
GAAATCAACCCCGAGTCAAAGGTGGCTAATATTCTGCTCGGCCTCTTCTACCTCGACTCATGTGGCCGCATGCCA
ATCAACAGCGAAAATTTCATCAAGCTATACAAAATCGCCATGACTGAATATACACAAAAGGCATTTAAGATTGAC
AAGGATATGCCTCTCACTTGTGCCACGTTTGCCAATTACTTCTTGTCCCGCAAGGCCTGGAGCAATATCGACAAG
CTGGCACACAAAGCCATTCAACATACCGACGTCAATGCTATTGCCAGCGATGGTTGGTATCTGCTGGCGAGAATG
GCCCACTACAACGGCGAGACAGAGAAAGCTAGTGACTACTACCGGCGTGCGGATGACGCGCGGGGCGGCACAGAC
ACTGGATATCTCCCTGCGAAATTCGGCGTTGCTCAATTGTCTGTCCTCAAAGACGACTTGGGTGAAGCCAAGCTT
CGACTAGAGAAAATCATTCAACAATCCAAAAGCCTCGAGGCCATGGTTCTACTCGGGACTTTGTATGCCGAGGAG
ATTTTCGCTAGCCAAAAAGGCGACGGCAAAGACGATAAGACGTCTGAGGTAAAAAAGGCTATTGCGCTGCTAGAG
GGCGTTCGCAGTGCTTGGAAAGACGCCAAGAAGGGTCTTTCTCCCGATCCTTCTGTTCTGCTGAACCTGGCTCGG
TTGTACGAATCGGAGAATCCAGAAAAGGCGCTACAGTGCCTGCTGCAAGTGGAACAGCTGGAAATGGAGCAGATA
CCAGAATCAGAGCGTCCAGCAGATATCACGGACGAGGCCGAGTTACAAGCTGCCATAAGAAAGCTTTTACCACCG
CAGCTGCTAAATAACATTGGATGCTTCCACTACCAAGCCGAGAGGTACGAGCTTGCCAGCGATCTATTTGAGGCG
GCCCTAGGTGCATGCATGAAAATAGGAGAAAAGGACGCCGAGATGGATACAGACGCGCTGGTCTCGACCATCAGC
TTTAATCTGGGAAGGACATATGAGGCTAGAGGCTTGACAGACAAGGCGATCGAGGTCTATCAGGGCCTGCTGTCT
CGTCATGACGACTACACTGACGCACGGACAAGACTGGCCTACATCAAGCTGAGAAGACACCCCAACAAAGAAGGA
CCCGACGCTGTTGCCAAGTTGTACCAAGAGAATACGAGCGACTTGGAAGTGCGCGCCTTGTTTGGCTGGTACTTG
GGCAAAGTCCATTCACGAAAGCGACCAGCCAATGTCGCAGAGGATCAAGAGTTTCGCCATTACAAGCATACTTTG
CAAAATTACGACAAGCACGACAGATATGCTCTCGTTGGTATGGGCAACCTCTACCTCATGCAGGCAAGAGAAATG
CGACGAGAATCAGACCAGGACAGACAAAAGCGAAGTGCAGTGTACTGCAAGGCTGTCGAATTCTTCGAAAAAGCC
TTGTCTCTGGACCCAAAGAATGCCTACGCAGCACAAGGCATCGCCATTGCCTTGGTCGAGGACAGAAAAGATTAC
AAGACAGCACTGCCCATCTTCAATAAAGTCCGGGAAACGGTCAAAGACTCGCATCTATTTGTCAATCTGGGTCAC
ATGTACTCGGAGCTGAGGCAATACACGAAAGCAATTGAAAACTACGAGACTGCTCTGACCAAGGATGGCAAAGCA
AGTGACCCTGTCATTCTCTCTTGCCTTGGTCGGACCTGGCTCAACAAGGGTCGCGCTGAGAGAGATATTGATGCT
TACAACAAGGCCTTGGAATGCGCACAAAAGGTAAGAGACAAGACACTGCTGCGACCAAGGGCCTATCTGTCTTGC
TAATGAGAAATTAGGCTTTATCTATAGCCCCAGATCAAGTGCACTACAAATTCAATGTCGCCTTTGTGCAAATTC
AGCTCGTGACTACTATTCAGGGGCTTCCAGAAATGAGGCGAACATTGGAGCAACTAGAAAAAGCGGCAGAGGGTC
TCGAGGCTGCAATTGAATCCCTGGACACCATTGCCACCCTTCCGACGACTCCATATCCTAAACATGATGTGGAGC
AGCGGGCAAACATGGCGCGCAACACGCTACGTAAGCAACTAGAGAGAGCTATTGGGAAGCAACGAGAATGGGAGG
ATAAGAACAGAGAGAAGATACAGGCGGCACGAGAGCAACGAGAGGCCGAGGTAAGACGGCGTGAGGCGGAGCGTG
AAATGATCTTGGAGAAGGAGCGCGAACGGCAGGAAAAGATCAAGAAGGAACGCGAGGAAATCGCTGCTCGGGACA
GGGAGCGAGCAGAGCAACGAGCCAAGGAGGAGCGTGAGCGCATCGAGGCTGAAATGACCGAGGATGAAACTGGCC
AGAAGGTGAAGCGCAAGAAGCGCAAGCCGGCAACACGGGCAACAAGCGAGACCAAGACCAAGAAGCCATCTCGCA
AGAAGAGGAACGGACGTGAAGACGGCAACGAGTCTTCGTCGCAAGACGAGACGCGGACTAAGAAGCGCAGACGCC
TCACAAAGAAGGAGTCGACCAAGTACAAGTCTGCCGAAGTCATTGTCAACAGCGACGATGACGACGATGACGACG
CCCATGCTTTGAAGCAGGCTGAACAAGAGAGCGGTCGGAAGGAGACACCGCCAACAGAAGCGGATGAGGACGACG
GCGATAGGATGGACATTGACGAGGACAGTCATGGCGATGGTGCCCGACATGCCGAGGCCAACGATGATGACGATG
ATGAAGACGAGGCAGCTGTGCCGCGTCAACAGCACCAGCGGTCTCGTCGGGGCCAGGTCCTGGAGAGCGAGGACG
AGGATGACGACAACGGCGACGACGGTGGCAGCGTCGATGCTCATGGCAAGCCTCGCGCTCAGTCGGGCGTAGAAG
ACGGAAGCAGCCCTGCAGCAGCGGCAGAGAGTGCTGCGTCTCGAGGCAACAACGACTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail