Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|6160
Gene name
LocationContig_54:10369..11625
Strand-
Gene length (bp)1256
Transcript length (bp)1194
Coding sequence length (bp)1194
Protein length (aa) 398

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01331 mRNA_cap_enzyme mRNA capping enzyme, catalytic domain 3.6E-53 46 241
PF03919 mRNA_cap_C mRNA capping enzyme, C-terminal domain 2.0E-31 245 371

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q7SB53|MCE1_NEUCR mRNA-capping enzyme subunit alpha OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=rnp-2 PE=3 SV=1 1 388 1.0E-166
sp|P40997|MCE1_SCHPO mRNA-capping enzyme subunit alpha OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ceg1 PE=1 SV=1 4 386 8.0E-105
sp|Q6C783|MCE1_YARLI mRNA-capping enzyme subunit alpha OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=CEG1 PE=3 SV=1 15 395 8.0E-94
sp|Q6BT58|MCE1_DEBHA mRNA-capping enzyme subunit alpha OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=CEG1 PE=3 SV=2 15 385 1.0E-84
sp|P78587|MCE1_CANAX mRNA-capping enzyme subunit alpha OS=Candida albicans GN=CGT1 PE=1 SV=1 15 396 4.0E-84
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q7SB53|MCE1_NEUCR mRNA-capping enzyme subunit alpha OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=rnp-2 PE=3 SV=1 1 388 1.0E-166
sp|P40997|MCE1_SCHPO mRNA-capping enzyme subunit alpha OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ceg1 PE=1 SV=1 4 386 8.0E-105
sp|Q6C783|MCE1_YARLI mRNA-capping enzyme subunit alpha OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=CEG1 PE=3 SV=1 15 395 8.0E-94
sp|Q6BT58|MCE1_DEBHA mRNA-capping enzyme subunit alpha OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=CEG1 PE=3 SV=2 15 385 1.0E-84
sp|P78587|MCE1_CANAX mRNA-capping enzyme subunit alpha OS=Candida albicans GN=CGT1 PE=1 SV=1 15 396 4.0E-84
sp|Q6FQ31|MCE1_CANGA mRNA-capping enzyme subunit alpha OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=CEG1 PE=3 SV=1 8 393 5.0E-71
sp|Q01159|MCE1_YEAST mRNA-capping enzyme subunit alpha OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CEG1 PE=1 SV=2 1 397 7.0E-68
sp|Q755D0|MCE1_ASHGO mRNA-capping enzyme subunit alpha OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=CEG1 PE=3 SV=1 15 388 7.0E-68
sp|Q6CWR0|MCE1_KLULA mRNA-capping enzyme subunit alpha OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=CEG1 PE=3 SV=1 15 386 2.0E-67
sp|O60942|MCE1_HUMAN mRNA-capping enzyme OS=Homo sapiens GN=RNGTT PE=1 SV=1 24 372 5.0E-30
sp|Q6NY98|MCE1_DANRE mRNA-capping enzyme OS=Danio rerio GN=rngtt PE=2 SV=1 41 371 5.0E-28
sp|O55236|MCE1_MOUSE mRNA-capping enzyme OS=Mus musculus GN=Rngtt PE=1 SV=1 24 395 8.0E-28
sp|Q17607|MCE1_CAEEL mRNA-capping enzyme OS=Caenorhabditis elegans GN=cel-1 PE=1 SV=2 27 371 3.0E-24
sp|Q84424|MCE_PBCV1 mRNA-capping enzyme OS=Paramecium bursaria Chlorella virus 1 GN=A103R PE=1 SV=1 42 371 1.0E-15
sp|Q5UQX1|MCE_MIMIV Probable mRNA-capping enzyme OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R382 PE=1 SV=1 26 352 7.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0004484 mRNA guanylyltransferase activity Yes
GO:0006370 7-methylguanosine mRNA capping Yes
GO:0005524 ATP binding Yes
GO:0000166 nucleotide binding No
GO:0003824 catalytic activity No
GO:0006397 mRNA processing No
GO:1901360 organic cyclic compound metabolic process No
GO:0097367 carbohydrate derivative binding No
GO:0006807 nitrogen compound metabolic process No
GO:0036260 RNA capping No
GO:0032553 ribonucleotide binding No
GO:0070568 guanylyltransferase activity No
GO:0043167 ion binding No
GO:0090304 nucleic acid metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0006396 RNA processing No
GO:0003674 molecular_function No
GO:0005488 binding No
GO:0008150 biological_process No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0006725 cellular aromatic compound metabolic process No
GO:0008192 RNA guanylyltransferase activity No
GO:0043170 macromolecule metabolic process No
GO:0036094 small molecule binding No
GO:0016070 RNA metabolic process No
GO:0009452 7-methylguanosine RNA capping No
GO:0016071 mRNA metabolic process No
GO:0043168 anion binding No
GO:0046483 heterocycle metabolic process No
GO:0016740 transferase activity No
GO:0030554 adenyl nucleotide binding No
GO:0044238 primary metabolic process No
GO:0009987 cellular process No
GO:0008152 metabolic process No
GO:0017076 purine nucleotide binding No
GO:0032559 adenyl ribonucleotide binding No
GO:0044237 cellular metabolic process No
GO:0071704 organic substance metabolic process No
GO:1901363 heterocyclic compound binding No
GO:0032555 purine ribonucleotide binding No
GO:1901265 nucleoside phosphate binding No
GO:0097159 organic cyclic compound binding No
GO:0016779 nucleotidyltransferase activity No
GO:0006139 nucleobase-containing compound metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|6160
MEQPPDSQIASIDQPGVKADRQLLYAMRKEVADLLGRQQLSFPGAQPVSFARKHLDELTMQDYYVCEKSDGIRYL
LYSTADENGGEAHYLIDRKNDYWFITNRNLHFPLVNDANSFHTATLVDGELVWDSLSNGKKEPRFLVFDCLVMDG
NKLMDRTLDKRLAYFNERLYTPYKRLFKEYPEELRFQPFFVEMKPFQLAYGIEMMFKQVLPGLRHGNDGLIFTCR
NTPYRHGTDPHILKWKPPEENTIDFRLKLHFPMVEPDEEERTEGITESFVDYDNVPGSELFMYKGDGGGAADRYE
YFADLYLNQEEWEVLKGLNDPLNDRIIECNQDDEGRWRLVRFRDDKNEANHKSTVLSVLDSISDRVSEKDLYRAA
GPIRDSWKTRQARADQENKRGR*
Coding >OphauB2|6160
ATGGAGCAACCTCCAGACAGTCAAATTGCCTCGATTGACCAGCCGGGTGTCAAGGCAGATCGGCAGTTGCTGTAC
GCCATGCGCAAGGAGGTGGCCGACTTGCTGGGCCGACAGCAGCTCAGCTTCCCCGGTGCGCAGCCCGTCAGCTTT
GCTCGCAAGCATCTCGACGAACTAACAATGCAAGATTACTACGTGTGTGAAAAGTCGGATGGTATCCGCTACCTT
TTATACTCGACAGCCGATGAAAATGGTGGAGAGGCGCATTATCTTATCGATCGCAAAAACGATTACTGGTTCATC
ACGAATCGAAACCTGCACTTTCCGCTAGTCAACGATGCCAACTCGTTTCATACGGCCACGCTTGTTGACGGCGAA
CTGGTTTGGGATAGTCTCTCCAATGGCAAAAAGGAGCCGAGATTTCTTGTCTTTGACTGTCTGGTTATGGATGGG
AATAAGTTGATGGACCGAACCCTCGACAAGCGCCTAGCCTACTTCAACGAACGTCTCTACACGCCATACAAGAGG
TTGTTTAAAGAATATCCCGAAGAGCTTCGCTTCCAGCCTTTTTTTGTCGAGATGAAGCCATTTCAACTGGCATAT
GGCATAGAAATGATGTTTAAGCAAGTGTTGCCTGGACTGCGGCACGGGAACGACGGGCTCATATTCACATGCCGC
AATACGCCCTACCGTCATGGTACAGACCCGCATATTCTCAAGTGGAAACCGCCCGAGGAAAACACCATCGATTTC
AGGCTCAAGCTACATTTTCCCATGGTTGAGCCTGATGAGGAGGAGAGGACAGAAGGCATCACAGAGTCATTTGTC
GACTATGACAATGTGCCTGGCTCAGAGCTGTTCATGTACAAGGGCGATGGTGGTGGGGCCGCAGATCGCTACGAG
TACTTTGCCGACTTATATTTAAACCAGGAAGAGTGGGAAGTCCTGAAAGGACTCAACGATCCACTCAATGACCGT
ATCATCGAGTGCAACCAGGATGATGAGGGTCGCTGGCGCTTGGTGCGCTTTCGAGACGATAAAAACGAAGCCAAC
CACAAAAGCACTGTATTGAGTGTTCTTGACAGCATTAGCGACCGTGTATCTGAAAAGGACTTGTATCGGGCAGCA
GGGCCCATTAGAGACAGCTGGAAGACTCGTCAAGCTCGTGCGGACCAGGAGAATAAACGAGGGCGTTAG
Transcript >OphauB2|6160
ATGGAGCAACCTCCAGACAGTCAAATTGCCTCGATTGACCAGCCGGGTGTCAAGGCAGATCGGCAGTTGCTGTAC
GCCATGCGCAAGGAGGTGGCCGACTTGCTGGGCCGACAGCAGCTCAGCTTCCCCGGTGCGCAGCCCGTCAGCTTT
GCTCGCAAGCATCTCGACGAACTAACAATGCAAGATTACTACGTGTGTGAAAAGTCGGATGGTATCCGCTACCTT
TTATACTCGACAGCCGATGAAAATGGTGGAGAGGCGCATTATCTTATCGATCGCAAAAACGATTACTGGTTCATC
ACGAATCGAAACCTGCACTTTCCGCTAGTCAACGATGCCAACTCGTTTCATACGGCCACGCTTGTTGACGGCGAA
CTGGTTTGGGATAGTCTCTCCAATGGCAAAAAGGAGCCGAGATTTCTTGTCTTTGACTGTCTGGTTATGGATGGG
AATAAGTTGATGGACCGAACCCTCGACAAGCGCCTAGCCTACTTCAACGAACGTCTCTACACGCCATACAAGAGG
TTGTTTAAAGAATATCCCGAAGAGCTTCGCTTCCAGCCTTTTTTTGTCGAGATGAAGCCATTTCAACTGGCATAT
GGCATAGAAATGATGTTTAAGCAAGTGTTGCCTGGACTGCGGCACGGGAACGACGGGCTCATATTCACATGCCGC
AATACGCCCTACCGTCATGGTACAGACCCGCATATTCTCAAGTGGAAACCGCCCGAGGAAAACACCATCGATTTC
AGGCTCAAGCTACATTTTCCCATGGTTGAGCCTGATGAGGAGGAGAGGACAGAAGGCATCACAGAGTCATTTGTC
GACTATGACAATGTGCCTGGCTCAGAGCTGTTCATGTACAAGGGCGATGGTGGTGGGGCCGCAGATCGCTACGAG
TACTTTGCCGACTTATATTTAAACCAGGAAGAGTGGGAAGTCCTGAAAGGACTCAACGATCCACTCAATGACCGT
ATCATCGAGTGCAACCAGGATGATGAGGGTCGCTGGCGCTTGGTGCGCTTTCGAGACGATAAAAACGAAGCCAAC
CACAAAAGCACTGTATTGAGTGTTCTTGACAGCATTAGCGACCGTGTATCTGAAAAGGACTTGTATCGGGCAGCA
GGGCCCATTAGAGACAGCTGGAAGACTCGTCAAGCTCGTGCGGACCAGGAGAATAAACGAGGGCGTTAG
Gene >OphauB2|6160
ATGGAGCAACCTCCAGACAGTCAAATTGCCTCGATTGACCAGCCGGGTGTCAAGGCAGATCGGCAGTTGCTGTAC
GCCATGCGCAAGGAGGTGGCCGACTTGCTGGGCCGACAGCAGCTCAGCTTCCCCGGTGCGCAGCCCGTCAGCTTT
GCTCGCAAGCATCTCGACGAACTAACAATGCAAGAGTGCGTCGCCCCGTCGCTGACAAGTTGCCGGCCGAGCAAA
CCAGCACTGACATGGATTCTAGTTACTACGTGTGTGAAAAGTCGGATGGTATCCGCTACCTTTTATACTCGACAG
CCGATGAAAATGGTGGAGAGGCGCATTATCTTATCGATCGCAAAAACGATTACTGGTTCATCACGAATCGAAACC
TGCACTTTCCGCTAGTCAACGATGCCAACTCGTTTCATACGGCCACGCTTGTTGACGGCGAACTGGTTTGGGATA
GTCTCTCCAATGGCAAAAAGGAGCCGAGATTTCTTGTCTTTGACTGTCTGGTTATGGATGGGAATAAGTTGATGG
ACCGAACCCTCGACAAGCGCCTAGCCTACTTCAACGAACGTCTCTACACGCCATACAAGAGGTTGTTTAAAGAAT
ATCCCGAAGAGCTTCGCTTCCAGCCTTTTTTTGTCGAGATGAAGCCATTTCAACTGGCATATGGCATAGAAATGA
TGTTTAAGCAAGTGTTGCCTGGACTGCGGCACGGGAACGACGGGCTCATATTCACATGCCGCAATACGCCCTACC
GTCATGGTACAGACCCGCATATTCTCAAGTGGAAACCGCCCGAGGAAAACACCATCGATTTCAGGCTCAAGCTAC
ATTTTCCCATGGTTGAGCCTGATGAGGAGGAGAGGACAGAAGGCATCACAGAGTCATTTGTCGACTATGACAATG
TGCCTGGCTCAGAGCTGTTCATGTACAAGGGCGATGGTGGTGGGGCCGCAGATCGCTACGAGTACTTTGCCGACT
TATATTTAAACCAGGAAGAGTGGGAAGTCCTGAAAGGACTCAACGATCCACTCAATGACCGTATCATCGAGTGCA
ACCAGGATGATGAGGGTCGCTGGCGCTTGGTGCGCTTTCGAGACGATAAAAACGAAGCCAACCACAAAAGCACTG
TATTGAGTGTTCTTGACAGCATTAGCGACCGTGTATCTGAAAAGGACTTGTATCGGGCAGCAGGGCCCATTAGAG
ACAGCTGGAAGACTCGTCAAGCTCGTGCGGACCAGGAGAATAAACGAGGGCGTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail