Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|6147
Gene name
LocationContig_53:91111..92810
Strand+
Gene length (bp)1699
Transcript length (bp)1512
Coding sequence length (bp)1512
Protein length (aa) 504

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup759
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1
Ophiocordyceps australis map64 (Brazil) OphauB2|6147 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|05796
Ophiocordyceps camponoti-rufipedis Ophun1|5133
Ophiocordyceps kimflemingae Ophio5|653
Ophiocordyceps subramaniannii Hirsu2|245

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|6147
MLGILDKEQPSRRAVLVMLSPRLLSKRSSLLLLAFSVFIGGLLVASSRLGELCHDGSLCGLSSLRRKLSPAGHEA
VAPTSQGPRQGSAKEADECAHFPDTSKVLLVMKTGASEAYGKVPNQIMTNLKCLPDLLVFGDMEQRVAGHKVHDS
LESVLAQVKEENSDFELYFRQKTCPVDQEACNKNHKVGEEAWKLDKYKNIHMAEKTYAMRRHYDWYLFVDADTYV
VWPTLMQWLERLDAADRHYIGSVAYVGNFPFGHGGSGYLVSQATMRTMFDGQANVANRWDQRVTRECCGDYVFSL
ALHNETGIDVENAWPTINGEKPNTLPYAHDEWCQPIATMHHVGAQDVSDLWGFEVERRFAGPMRIKDVFHRFVED
KLEPSRAHWDNLSDSVFYLNRTARQYSDHELKRAKWQDLSALELAAHRSFDDCRRACQSIDRCFQYRFHNSICAI
SYTIKHGRPAEPQDDHQLHHHSGWIVKRIKQWVQDHDKCGDVEFPFNTRWFAS*
Coding >OphauB2|6147
ATGCTTGGCATCTTGGACAAGGAGCAACCATCACGAAGGGCCGTACTCGTCATGCTGTCGCCGCGACTGCTGTCA
AAACGGTCCAGCCTGCTCTTGCTTGCTTTTAGCGTCTTCATCGGCGGCTTGCTAGTTGCCTCGTCACGACTGGGC
GAGCTATGCCATGACGGCAGCTTGTGCGGGCTGTCGTCGCTGCGAAGAAAGCTTTCTCCGGCGGGCCATGAAGCG
GTGGCGCCGACGAGCCAAGGGCCTCGACAAGGCAGCGCCAAGGAGGCGGACGAGTGCGCACACTTCCCCGACACG
TCCAAGGTGCTGCTCGTCATGAAGACGGGCGCATCCGAGGCCTATGGCAAGGTGCCCAACCAGATAATGACCAAC
CTCAAGTGCCTGCCCGACTTGCTCGTGTTTGGCGACATGGAGCAGAGAGTGGCAGGCCACAAGGTCCATGACAGC
CTGGAGTCGGTGCTGGCCCAGGTCAAGGAGGAAAACAGCGACTTTGAGCTCTACTTTCGTCAAAAGACGTGTCCC
GTGGACCAAGAGGCGTGCAACAAGAACCACAAGGTGGGCGAGGAGGCGTGGAAGCTGGACAAGTACAAAAACATC
CACATGGCCGAGAAGACGTATGCCATGCGGCGGCACTACGACTGGTATCTCTTTGTCGACGCCGACACGTACGTG
GTGTGGCCGACGCTCATGCAGTGGCTCGAGAGGCTCGACGCAGCCGACAGACACTACATTGGCAGCGTGGCCTAT
GTCGGCAACTTTCCCTTTGGCCATGGCGGAAGCGGCTATCTCGTGTCGCAGGCGACGATGCGCACCATGTTTGAC
GGCCAGGCCAATGTGGCCAACCGCTGGGACCAGCGTGTCACGCGCGAGTGCTGCGGCGACTATGTCTTTTCGCTT
GCTCTGCACAACGAGACGGGCATTGATGTCGAGAATGCGTGGCCCACCATCAATGGCGAAAAGCCAAACACGCTG
CCCTATGCCCACGACGAGTGGTGCCAGCCCATAGCAACCATGCACCACGTCGGAGCCCAAGACGTGTCGGATCTC
TGGGGCTTCGAGGTCGAGCGGCGCTTCGCAGGGCCCATGCGCATCAAAGACGTCTTTCACCGCTTTGTCGAGGAC
AAACTCGAGCCCTCGCGTGCCCACTGGGACAACCTCAGCGACAGCGTCTTCTACCTCAACCGCACCGCCCGGCAA
TACTCGGACCACGAGCTCAAGCGCGCCAAGTGGCAAGACTTGTCGGCTCTCGAGCTCGCCGCCCACCGCAGCTTC
GACGACTGTCGCCGCGCTTGCCAGAGCATCGACCGCTGCTTCCAGTACCGCTTCCATAATTCCATCTGCGCCATA
AGCTACACCATTAAGCACGGCAGGCCGGCCGAGCCTCAAGACGACCACCAGCTGCACCATCACAGCGGCTGGATC
GTCAAGAGAATCAAGCAGTGGGTCCAAGACCACGACAAATGCGGCGATGTCGAGTTTCCATTCAACACGCGCTGG
TTTGCATCATGA
Transcript >OphauB2|6147
ATGCTTGGCATCTTGGACAAGGAGCAACCATCACGAAGGGCCGTACTCGTCATGCTGTCGCCGCGACTGCTGTCA
AAACGGTCCAGCCTGCTCTTGCTTGCTTTTAGCGTCTTCATCGGCGGCTTGCTAGTTGCCTCGTCACGACTGGGC
GAGCTATGCCATGACGGCAGCTTGTGCGGGCTGTCGTCGCTGCGAAGAAAGCTTTCTCCGGCGGGCCATGAAGCG
GTGGCGCCGACGAGCCAAGGGCCTCGACAAGGCAGCGCCAAGGAGGCGGACGAGTGCGCACACTTCCCCGACACG
TCCAAGGTGCTGCTCGTCATGAAGACGGGCGCATCCGAGGCCTATGGCAAGGTGCCCAACCAGATAATGACCAAC
CTCAAGTGCCTGCCCGACTTGCTCGTGTTTGGCGACATGGAGCAGAGAGTGGCAGGCCACAAGGTCCATGACAGC
CTGGAGTCGGTGCTGGCCCAGGTCAAGGAGGAAAACAGCGACTTTGAGCTCTACTTTCGTCAAAAGACGTGTCCC
GTGGACCAAGAGGCGTGCAACAAGAACCACAAGGTGGGCGAGGAGGCGTGGAAGCTGGACAAGTACAAAAACATC
CACATGGCCGAGAAGACGTATGCCATGCGGCGGCACTACGACTGGTATCTCTTTGTCGACGCCGACACGTACGTG
GTGTGGCCGACGCTCATGCAGTGGCTCGAGAGGCTCGACGCAGCCGACAGACACTACATTGGCAGCGTGGCCTAT
GTCGGCAACTTTCCCTTTGGCCATGGCGGAAGCGGCTATCTCGTGTCGCAGGCGACGATGCGCACCATGTTTGAC
GGCCAGGCCAATGTGGCCAACCGCTGGGACCAGCGTGTCACGCGCGAGTGCTGCGGCGACTATGTCTTTTCGCTT
GCTCTGCACAACGAGACGGGCATTGATGTCGAGAATGCGTGGCCCACCATCAATGGCGAAAAGCCAAACACGCTG
CCCTATGCCCACGACGAGTGGTGCCAGCCCATAGCAACCATGCACCACGTCGGAGCCCAAGACGTGTCGGATCTC
TGGGGCTTCGAGGTCGAGCGGCGCTTCGCAGGGCCCATGCGCATCAAAGACGTCTTTCACCGCTTTGTCGAGGAC
AAACTCGAGCCCTCGCGTGCCCACTGGGACAACCTCAGCGACAGCGTCTTCTACCTCAACCGCACCGCCCGGCAA
TACTCGGACCACGAGCTCAAGCGCGCCAAGTGGCAAGACTTGTCGGCTCTCGAGCTCGCCGCCCACCGCAGCTTC
GACGACTGTCGCCGCGCTTGCCAGAGCATCGACCGCTGCTTCCAGTACCGCTTCCATAATTCCATCTGCGCCATA
AGCTACACCATTAAGCACGGCAGGCCGGCCGAGCCTCAAGACGACCACCAGCTGCACCATCACAGCGGCTGGATC
GTCAAGAGAATCAAGCAGTGGGTCCAAGACCACGACAAATGCGGCGATGTCGAGTTTCCATTCAACACGCGCTGG
TTTGCATCATGA
Gene >OphauB2|6147
ATGCTTGGCATCTTGGACAAGGAGCAACCATCACGAAGGGCCGTACTCGTCATGCTGTCGCCGCGACTGCTGTCA
AAACGGTCCAGCCTGCTCTTGCTTGCTTTTAGCGTCTTCATCGGCGGCTTGCTAGTTGCCTCGTCACGACTGGGC
GAGCTATGCCATGACGGCAGCTTGTGCGGGCTGTCGTCGCTGCGAAGAAAGCTTTCTCCGGCGGGCCATGAAGCG
GTGGCGCCGACGAGCCAAGGGCCTCGACAAGGCAGCGCCAAGGAGGCGGACGAGTGCGCACACTTCCCCGACACG
TCCAAGGTGCTGCTCGTCATGAAGACGGGCGCATCCGAGGCCTATGGCAAGGTGCCCAACCAGATAATGACCAAC
CTCAAGTGCCTGCCCGACTTGCTCGTGTTTGGCGACATGGAGCAGAGAGTGGCAGGCCACAAGGTCCATGACAGC
CTGGAGTCGGTGCTGGCCCAGGTCAAGGAGGAAAACAGCGACTTTGAGCTCTACTTTCGTCAAAAGACGTGTCCC
GTGGACCAAGAGGCGTGCAACAAGAACCACAAGGTGGGCGAGGAGGCGTGGAAGCTGGACAAGTACAAAAACATC
CACATGGCCGAGAAGACGTATGCCATGCGGCGGCACTACGACTGGTATCTCTTTGTCGACGCCGACACGTACGTG
GTGTGGCCGACGCTCATGCAGTGGCTCGAGAGGCTCGACGCAGCCGACAGACACTACATTGGCAGCGTGGCCTAT
GTCGGCAACTTTCCCTTTGGCCATGGCGGAAGCGGCTATCTCGTGTCGCAGGCGACGATGCGCACCATGTTTGAC
GGCCAGGCCAATGTGGCCAACCGCTGGGACCAGCGTGTCACGCGCGAGTGCTGCGGCGACTATGTCTTTTCGCTT
GCTCTGCACAACGAGACGGGCATTGATGTCGAGAATGCGGTATGTGCATGTCTTTTTACACTGCTAGTAGTAGTA
GTACTACTACTTACTACTACTACTAACTTAGTAGTACTACTAACTTGCTGCTACTGCTGTTACTGCTGCTGCTGC
TACTACTACTACTACTGCTACTACTACTACTACTACTGTATAGACACAAAAAAAAAAAGACTGACCCGCGCCACA
GTGGCCCACCATCAATGGCGAAAAGCCAAACACGCTGCCCTATGCCCACGACGAGTGGTGCCAGCCCATAGCAAC
CATGCACCACGTCGGAGCCCAAGACGTGTCGGATCTCTGGGGCTTCGAGGTCGAGCGGCGCTTCGCAGGGCCCAT
GCGCATCAAAGACGTCTTTCACCGCTTTGTCGAGGACAAACTCGAGCCCTCGCGTGCCCACTGGGACAACCTCAG
CGACAGCGTCTTCTACCTCAACCGCACCGCCCGGCAATACTCGGACCACGAGCTCAAGCGCGCCAAGTGGCAAGA
CTTGTCGGCTCTCGAGCTCGCCGCCCACCGCAGCTTCGACGACTGTCGCCGCGCTTGCCAGAGCATCGACCGCTG
CTTCCAGTACCGCTTCCATAATTCCATCTGCGCCATAAGCTACACCATTAAGCACGGCAGGCCGGCCGAGCCTCA
AGACGACCACCAGCTGCACCATCACAGCGGCTGGATCGTCAAGAGAATCAAGCAGTGGGTCCAAGACCACGACAA
ATGCGGCGATGTCGAGTTTCCATTCAACACGCGCTGGTTTGCATCATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail