Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|6130
Gene name
LocationContig_53:53359..55092
Strand-
Gene length (bp)1733
Transcript length (bp)741
Coding sequence length (bp)741
Protein length (aa) 247

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) 1.4E-15 70 140

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q09330|MLO3_SCHPO mRNA export protein mlo3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mlo3 PE=1 SV=1 1 222 2.0E-30
sp|Q12159|YRA1_YEAST RNA annealing protein YRA1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YRA1 PE=1 SV=2 1 219 2.0E-18
sp|Q8L773|THO4A_ARATH THO complex subunit 4A OS=Arabidopsis thaliana GN=ALY1 PE=1 SV=1 68 144 2.0E-07
sp|Q58EA2|THO4A_XENLA THO complex subunit 4-A OS=Xenopus laevis GN=alyref-a PE=2 SV=1 69 152 2.0E-06
sp|Q28FB9|THOC4_XENTR THO complex subunit 4 OS=Xenopus tropicalis GN=alyref PE=2 SV=1 69 152 2.0E-06
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q09330|MLO3_SCHPO mRNA export protein mlo3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mlo3 PE=1 SV=1 1 222 2.0E-30
sp|Q12159|YRA1_YEAST RNA annealing protein YRA1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YRA1 PE=1 SV=2 1 219 2.0E-18
sp|Q8L773|THO4A_ARATH THO complex subunit 4A OS=Arabidopsis thaliana GN=ALY1 PE=1 SV=1 68 144 2.0E-07
sp|Q58EA2|THO4A_XENLA THO complex subunit 4-A OS=Xenopus laevis GN=alyref-a PE=2 SV=1 69 152 2.0E-06
sp|Q28FB9|THOC4_XENTR THO complex subunit 4 OS=Xenopus tropicalis GN=alyref PE=2 SV=1 69 152 2.0E-06
sp|B5FXN8|THOC4_TAEGU THO complex subunit 4 OS=Taeniopygia guttata GN=ALYREF PE=2 SV=1 69 151 2.0E-06
sp|Q94EH8|THO4C_ARATH THO complex subunit 4C OS=Arabidopsis thaliana GN=ALY3 PE=1 SV=1 68 150 2.0E-06
sp|O08583|THOC4_MOUSE THO complex subunit 4 OS=Mus musculus GN=Alyref PE=1 SV=3 69 151 5.0E-06
sp|Q54WM4|EIF3G_DICDI Eukaryotic translation initiation factor 3 subunit G OS=Dictyostelium discoideum GN=eif3G PE=3 SV=1 50 143 7.0E-06
sp|Q86V81|THOC4_HUMAN THO complex subunit 4 OS=Homo sapiens GN=ALYREF PE=1 SV=3 69 151 7.0E-06
sp|Q3T0I4|THOC4_BOVIN THO complex subunit 4 OS=Bos taurus GN=ALYREF PE=2 SV=1 69 151 7.0E-06
sp|Q6NQ72|THO4D_ARATH THO complex subunit 4D OS=Arabidopsis thaliana GN=ALY4 PE=1 SV=1 68 151 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0003723 RNA binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No
GO:1901363 heterocyclic compound binding No
GO:0097159 organic cyclic compound binding No
GO:0003676 nucleic acid binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 36 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|6130
MSGKLDRPLEDIVSAQRRSATHRRSQRRATGRPATTAPVGGIQKANKATRGGALKAAPAKTSPNNGESKIIVSNL
PKDVLESQIKEYFVQSVGPIKRVDLVYGPNSVSRGIANVTFHKADGASKAFQKLNGLLVDNRPIKIEIVVGASQA
DKVIPTVKSLAERTSQPKSQPKSAAGGKQHPVSSKGAGNETGNRKRRGRSARPAKKTTEELDSEMADYFVSNPVI
ENPNGGISAPNGDATMEDEIM*
Coding >OphauB2|6130
ATGTCTGGAAAGCTCGACAGGCCTCTTGAAGACATTGTGTCGGCTCAACGACGATCTGCTACGCATCGCCGTTCT
CAGAGACGTGCTACCGGTCGCCCGGCCACAACTGCGCCGGTCGGGGGCATTCAAAAGGCCAACAAAGCCACCCGT
GGAGGTGCTCTCAAAGCAGCTCCAGCCAAGACTTCACCCAACAATGGTGAAAGCAAAATCATTGTCAGCAATCTC
CCCAAGGACGTCCTTGAATCACAAATCAAGGAGTACTTTGTCCAATCGGTCGGTCCCATCAAAAGAGTGGATCTT
GTCTACGGCCCCAATTCTGTGAGCCGAGGCATAGCCAACGTCACCTTCCATAAAGCAGATGGTGCAAGCAAGGCT
TTCCAGAAGCTGAACGGCTTGCTCGTCGATAATCGTCCGATCAAGATTGAAATTGTTGTCGGAGCTTCTCAAGCT
GATAAGGTTATTCCAACTGTAAAGTCTTTGGCTGAACGGACCTCTCAGCCCAAGTCCCAGCCCAAGTCTGCTGCT
GGTGGCAAACAGCATCCTGTCTCGTCAAAAGGTGCTGGAAATGAGACTGGCAACAGAAAGCGTCGTGGCAGAAGC
GCCCGACCAGCCAAGAAGACGACCGAGGAACTTGATTCGGAGATGGCAGACTACTTCGTTTCAAACCCTGTTATA
GAGAACCCCAATGGAGGTATTTCTGCACCCAACGGAGATGCCACGATGGAAGACGAAATCATGTAA
Transcript >OphauB2|6130
ATGTCTGGAAAGCTCGACAGGCCTCTTGAAGACATTGTGTCGGCTCAACGACGATCTGCTACGCATCGCCGTTCT
CAGAGACGTGCTACCGGTCGCCCGGCCACAACTGCGCCGGTCGGGGGCATTCAAAAGGCCAACAAAGCCACCCGT
GGAGGTGCTCTCAAAGCAGCTCCAGCCAAGACTTCACCCAACAATGGTGAAAGCAAAATCATTGTCAGCAATCTC
CCCAAGGACGTCCTTGAATCACAAATCAAGGAGTACTTTGTCCAATCGGTCGGTCCCATCAAAAGAGTGGATCTT
GTCTACGGCCCCAATTCTGTGAGCCGAGGCATAGCCAACGTCACCTTCCATAAAGCAGATGGTGCAAGCAAGGCT
TTCCAGAAGCTGAACGGCTTGCTCGTCGATAATCGTCCGATCAAGATTGAAATTGTTGTCGGAGCTTCTCAAGCT
GATAAGGTTATTCCAACTGTAAAGTCTTTGGCTGAACGGACCTCTCAGCCCAAGTCCCAGCCCAAGTCTGCTGCT
GGTGGCAAACAGCATCCTGTCTCGTCAAAAGGTGCTGGAAATGAGACTGGCAACAGAAAGCGTCGTGGCAGAAGC
GCCCGACCAGCCAAGAAGACGACCGAGGAACTTGATTCGGAGATGGCAGACTACTTCGTTTCAAACCCTGTTATA
GAGAACCCCAATGGAGGTATTTCTGCACCCAACGGAGATGCCACGATGGAAGACGAAATCATGTAA
Gene >OphauB2|6130
ATGTCTGGAAAGCTCGACAGGCCTCTTGAAGACATTGTGTCGGCTCAACGACGATCTGCTACGCATCGCCGTTCT
CAGAGACGTGCTACCGGTCGCCCGGCCACAACTGCGCCGGTCGGGGGCATTCAAAAGGCCAACAAAGCCACCCGT
GGAGGTGCTCTCAAAGCAGCTCCAGCCAAGACTTCACCCAACAATGGTGAAAGCAAAATCATTGTCAGCAATCTC
GTGAGTTGAAATGTTACATTCACCATTATTGTGTTTTTGAAACTAATCTTGTTGTAGCCCAAGGACGTCCTTGAA
TCACAAATCAAGGTATGTAGCCGTTGAGGCGCCATGCCTCCGGTCTTCGTTCGACTCGTCATCGTCGCATATTTT
GCCTTGACTGGTCATCACGCCCTCGTTCCCGATTGCATCTCAACATGTGCCATGACGATGCCCTTGTCTCCTTCC
CGCAATTTAGCGAAGTGCCGGCACTATGGTGTGTCTGGACCTGGAAGTTGAGAACAGCCTCCCTGTTGAACACTC
CCTGATGCCTGGTCAGCATCTTCATGGGATAAGTAAACTATTCTGGGTGACTGTGGCAGCACCGCAGCTAGGCTT
CTTTTGCAGCGGTTGGCCAATGCGATATTCTTATGTCGGCCAGGCGAGCAAAGCAGTGAGCATCGCAGCAAGAAT
ATAGCTTCCAAGCCATGGGTGCACTGATATAGGTACTGCCATGTTTTTTTGGGAGAAAAAGAGCATTGGCATTGG
CTTAGTCGTGCCCCAGCAGTTGGGCTATATGGAGCTTGACGCTCTCGCTCGCTGGCCATCAAGATCTCTCATGAC
CTGCTATATCAGAGCAGTCTTAGTGGCGATAGACTCGCCCATGGCATGCCGTCTAAGCTCGCCAGAGCTGCTCTT
TCGTCTCACTGCTCTGCTCGCTTGTGGACATTATTGTCGACGTATTGCCAAGCACTTTGTTTTTTTGCCTTTCGA
TGGGATTCGGTCGCGATTCCGGAGACGACGTCGAACGAAGACTGGACTGGGTTCTCGTTTACAATGCGGCCCAAT
TCTTTCTATTTACTGACAGCTTTGACCATGGTAGGAGTACTTTGTCCAATCGGTCGGTCCCATCAAAAGAGTGGA
TCTTGTCTACGGCCCCAATTCTGTGAGCCGAGGCATAGCCAACGTCACCTTCCATAAAGCAGATGGTGCAAGCAA
GGCTTTCCAGAAGCTGAACGGCTTGCTCGTCGATAATCGTCCGATCAAGGTTTGATAAGAGCATTGAATTAGCCT
ATGTGCAACAATTGACCTCGAACAGATTGAAATTGTTGTCGGAGCTTCTCAAGCTGATAAGGTTATTCCAACTGT
AAAGTCTTTGGCTGAACGGACCTCGTGAGTTATGACGTGCAGAGGTTGGTTCGTTGCATTGGCTTACATACTTCT
AGTCAGCCCAAGTCCCAGCCCAAGTCTGCTGCTGGTGGCAAACAGCATCCTGTCTCGTCAAAAGGTGCTGGAAAT
GAGACTGGCAACAGAAAGCGTCGTGGCAGAAGCGCCCGACCAGCCAAGAAGACGACCGAGGAACTTGATTCGGAG
ATGGCAGACTACTTCGTTTCAAACCCTGTTATAGAGAACCCCAATGGAGGTATTTCTGCACCCAACGGAGATGCC
ACGATGGAAGACGAAATCATGGTTTGTTACCCATGATCAACAGTCTATGACTATAATCAATGCTAATGATTTCCT
CAAAGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail