Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|6128
Gene name
LocationContig_53:50356..51118
Strand-
Gene length (bp)762
Transcript length (bp)690
Coding sequence length (bp)690
Protein length (aa) 230

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03357 Snf7 Snf7 2.2E-18 24 196

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P36095|VPS24_YEAST Vacuolar protein-sorting-associated protein 24 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VPS24 PE=1 SV=1 1 229 1.0E-32
sp|O14296|VPS24_SCHPO Vacuolar protein sorting-associated protein 24 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=vps24 PE=3 SV=1 1 229 6.0E-32
sp|Q54P63|CHMP3_DICDI Charged multivesicular body protein 3 OS=Dictyostelium discoideum GN=chmp3 PE=3 SV=1 6 229 4.0E-27
sp|Q6NRM7|CHMP3_XENLA Charged multivesicular body protein 3 OS=Xenopus laevis GN=chmp3 PE=2 SV=3 6 199 5.0E-27
sp|Q58CS7|CHMP3_BOVIN Charged multivesicular body protein 3 OS=Bos taurus GN=CHMP3 PE=2 SV=4 6 229 8.0E-27
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P36095|VPS24_YEAST Vacuolar protein-sorting-associated protein 24 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VPS24 PE=1 SV=1 1 229 1.0E-32
sp|O14296|VPS24_SCHPO Vacuolar protein sorting-associated protein 24 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=vps24 PE=3 SV=1 1 229 6.0E-32
sp|Q54P63|CHMP3_DICDI Charged multivesicular body protein 3 OS=Dictyostelium discoideum GN=chmp3 PE=3 SV=1 6 229 4.0E-27
sp|Q6NRM7|CHMP3_XENLA Charged multivesicular body protein 3 OS=Xenopus laevis GN=chmp3 PE=2 SV=3 6 199 5.0E-27
sp|Q58CS7|CHMP3_BOVIN Charged multivesicular body protein 3 OS=Bos taurus GN=CHMP3 PE=2 SV=4 6 229 8.0E-27
sp|Q5RAU5|CHMP3_PONAB Charged multivesicular body protein 3 OS=Pongo abelii GN=CHMP3 PE=2 SV=3 6 199 2.0E-26
sp|Q5BKM3|CHMP3_XENTR Charged multivesicular body protein 3 OS=Xenopus tropicalis GN=chmp3 PE=2 SV=4 6 199 3.0E-26
sp|Q4R574|CHMP3_MACFA Charged multivesicular body protein 3 OS=Macaca fascicularis GN=CHMP3 PE=2 SV=3 6 199 3.0E-26
sp|Q9Y3E7|CHMP3_HUMAN Charged multivesicular body protein 3 OS=Homo sapiens GN=CHMP3 PE=1 SV=3 6 199 3.0E-26
sp|Q9CQ10|CHMP3_MOUSE Charged multivesicular body protein 3 OS=Mus musculus GN=Chmp3 PE=1 SV=3 6 229 4.0E-26
sp|Q8CGS4|CHMP3_RAT Charged multivesicular body protein 3 OS=Rattus norvegicus GN=Chmp3 PE=1 SV=3 6 229 1.0E-25
sp|Q6NY88|CHMP3_DANRE Charged multivesicular body protein 3 OS=Danio rerio GN=chmp3 PE=2 SV=3 6 229 9.0E-24
sp|Q9FFB3|VP241_ARATH Vacuolar protein sorting-associated protein 24 homolog 1 OS=Arabidopsis thaliana GN=VPS24-1 PE=1 SV=1 10 229 3.0E-22
sp|Q9LXH5|VP242_ARATH Putative vacuolar protein sorting-associated protein 24 homolog 2 OS=Arabidopsis thaliana GN=VPS24-2 PE=2 SV=1 70 194 4.0E-18
sp|Q6NVL7|CHM2B_XENTR Charged multivesicular body protein 2b OS=Xenopus tropicalis GN=chmp2b PE=2 SV=1 4 208 9.0E-10
sp|Q66IV6|CH2BB_XENLA Charged multivesicular body protein 2b-B OS=Xenopus laevis GN=chmp2b-b PE=2 SV=1 4 208 4.0E-09
sp|Q7SYR0|CH2BA_XENLA Charged multivesicular body protein 2b-A OS=Xenopus laevis GN=chmp2b-a PE=2 SV=1 4 208 1.0E-08
sp|Q5F3A2|CHM2B_CHICK Charged multivesicular body protein 2b OS=Gallus gallus GN=CHMP2B PE=2 SV=1 4 208 1.0E-08
sp|Q3SX42|CHM2B_BOVIN Charged multivesicular body protein 2b OS=Bos taurus GN=CHMP2B PE=2 SV=1 4 195 2.0E-07
sp|Q8BJF9|CHM2B_MOUSE Charged multivesicular body protein 2b OS=Mus musculus GN=Chmp2b PE=1 SV=1 4 195 2.0E-07
sp|Q5RAV2|CHM2B_PONAB Charged multivesicular body protein 2b OS=Pongo abelii GN=CHMP2B PE=2 SV=1 4 195 7.0E-07
sp|Q9UQN3|CHM2B_HUMAN Charged multivesicular body protein 2b OS=Homo sapiens GN=CHMP2B PE=1 SV=1 4 195 7.0E-07
sp|Q6NXD2|CHM2B_DANRE Charged multivesicular body protein 2b OS=Danio rerio GN=chmp2b PE=2 SV=1 4 200 9.0E-07
sp|Q54DB1|CM2A2_DICDI Charged multivesicular body protein 2a homolog 2 OS=Dictyostelium discoideum GN=chmp2a2 PE=3 SV=1 7 182 6.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0007034 vacuolar transport Yes
GO:0046907 intracellular transport No
GO:0009987 cellular process No
GO:0051179 localization No
GO:0008150 biological_process No
GO:0051649 establishment of localization in cell No
GO:0051234 establishment of localization No
GO:0006810 transport No
GO:0051641 cellular localization No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 70 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|6128
MDTLRALFTKPDPQAQVRKCNALLRSNARKLDRDIVAVKQVEAKTKNYIIQADRRAQRDPTRAKQAQKEARDFAR
ELVRARRTSTRLATSKAQLNSVQMQVNEAFAVRKIEGSIKASVGIMKDVNRLIHLPELSGTMRELSVELMKAGII
EEMVDDVLPNDADMLFEEEEADGEVDKVLGEILQGKKEPSLPAAPLPEPNKLAQEEEEDEEEAEVMMDQMRNRLD
ALRS*
Coding >OphauB2|6128
ATGGACACTCTTCGCGCACTCTTCACCAAGCCAGATCCACAAGCACAGGTTCGAAAATGCAACGCGTTATTAAGA
TCAAATGCGCGTAAGCTTGACCGCGACATTGTAGCGGTGAAACAAGTCGAAGCCAAGACGAAAAACTACATTATT
CAGGCAGATCGAAGGGCTCAACGCGATCCCACGCGTGCCAAGCAGGCTCAAAAAGAGGCGCGAGATTTTGCACGT
GAACTAGTCCGTGCTCGGCGCACATCGACGCGTCTTGCCACCTCAAAGGCCCAACTCAACTCGGTTCAAATGCAA
GTCAACGAGGCTTTTGCTGTGCGCAAGATTGAAGGCTCTATCAAAGCTAGTGTTGGAATAATGAAGGATGTCAAT
CGCCTTATTCATCTTCCCGAGCTCTCGGGTACCATGCGCGAGCTCAGCGTCGAGCTCATGAAAGCTGGAATCATT
GAAGAGATGGTAGATGACGTATTACCCAACGACGCCGATATGCTGTTTGAGGAGGAGGAAGCAGATGGAGAAGTC
GACAAGGTTCTCGGTGAAATACTCCAGGGCAAGAAGGAGCCAAGTCTGCCAGCAGCACCCTTGCCAGAGCCTAAC
AAGTTGGCACAAGAGGAAGAGGAAGACGAAGAAGAAGCAGAAGTCATGATGGATCAGATGCGAAATCGTCTAGAC
GCGCTACGAAGCTGA
Transcript >OphauB2|6128
ATGGACACTCTTCGCGCACTCTTCACCAAGCCAGATCCACAAGCACAGGTTCGAAAATGCAACGCGTTATTAAGA
TCAAATGCGCGTAAGCTTGACCGCGACATTGTAGCGGTGAAACAAGTCGAAGCCAAGACGAAAAACTACATTATT
CAGGCAGATCGAAGGGCTCAACGCGATCCCACGCGTGCCAAGCAGGCTCAAAAAGAGGCGCGAGATTTTGCACGT
GAACTAGTCCGTGCTCGGCGCACATCGACGCGTCTTGCCACCTCAAAGGCCCAACTCAACTCGGTTCAAATGCAA
GTCAACGAGGCTTTTGCTGTGCGCAAGATTGAAGGCTCTATCAAAGCTAGTGTTGGAATAATGAAGGATGTCAAT
CGCCTTATTCATCTTCCCGAGCTCTCGGGTACCATGCGCGAGCTCAGCGTCGAGCTCATGAAAGCTGGAATCATT
GAAGAGATGGTAGATGACGTATTACCCAACGACGCCGATATGCTGTTTGAGGAGGAGGAAGCAGATGGAGAAGTC
GACAAGGTTCTCGGTGAAATACTCCAGGGCAAGAAGGAGCCAAGTCTGCCAGCAGCACCCTTGCCAGAGCCTAAC
AAGTTGGCACAAGAGGAAGAGGAAGACGAAGAAGAAGCAGAAGTCATGATGGATCAGATGCGAAATCGTCTAGAC
GCGCTACGAAGCTGA
Gene >OphauB2|6128
ATGGACACTCTTCGCGCACTCTTCACCAAGCCAGATCCACAAGCACAGGTTCGTTTTCCATGGGCAGCAGGTCGA
CAAGCGCTATGAGGGCGCTGATTTCTGGCATCGGCGTCGTTACAGGTTCGAAAATGCAACGCGTTATTAAGATCA
AATGCGCGTAAGCTTGACCGCGACATTGTAGCGGTGAAACAAGTCGAAGCCAAGACGAAAAACTACATTATTCAG
GCAGATCGAAGGGCTCAACGCGATCCCACGCGTGCCAAGCAGGCTCAAAAAGAGGCGCGAGATTTTGCACGTGAA
CTAGTCCGTGCTCGGCGCACATCGACGCGTCTTGCCACCTCAAAGGCCCAACTCAACTCGGTTCAAATGCAAGTC
AACGAGGCTTTTGCTGTGCGCAAGATTGAAGGCTCTATCAAAGCTAGTGTTGGAATAATGAAGGATGTCAATCGC
CTTATTCATCTTCCCGAGCTCTCGGGTACCATGCGCGAGCTCAGCGTCGAGCTCATGAAAGCTGGAATCATTGAA
GAGATGGTAGATGACGTATTACCCAACGACGCCGATATGCTGTTTGAGGAGGAGGAAGCAGATGGAGAAGTCGAC
AAGGTTCTCGGTGAAATACTCCAGGGCAAGAAGGAGCCAAGTCTGCCAGCAGCACCCTTGCCAGAGCCTAACAAG
TTGGCACAAGAGGAAGAGGAAGACGAAGAAGAAGCAGAAGTCATGATGGATCAGATGCGAAATCGTCTAGACGCG
CTACGAAGCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail