Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|6125
Gene name
LocationContig_53:33567..34275
Strand-
Gene length (bp)708
Transcript length (bp)708
Coding sequence length (bp)708
Protein length (aa) 236

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10181 PIG-H GPI-GlcNAc transferase complex, PIG-H component 2.4E-26 125 205

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q9Y7L7|GPI15_SCHPO Phosphatidylinositol N-acetylglucosaminyltransferase subunit gpi15 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gpi15 PE=3 SV=1 94 219 2.0E-13

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 66 0.5

Transmembrane Domains

Domain # Start End Length
1 35 57 22
2 95 117 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|6125
MASLLRTAPRLHVRRPSPTAAEFTVTTEPPPTLRLRLLSLAVVALRLTLCLAVLLVLHSQWCASASGCARLLSLS
RPLTLAAPRSSLLWPWPCLALARLPAPALLALLAATLYLVGLGRAHARESLLVLRGLGVQTTEAPVSFFSPASLL
SSPFSWVCSSGAATRFIPTEKIHDILLNEAFRGFEVRYYLVVVVEGEQDVVVVFPGLLPPRHIVETVWRGARQCL
YEGRTEDKGG*
Coding >OphauB2|6125
ATGGCCAGTCTGCTGAGGACAGCGCCGCGGCTGCACGTACGGCGGCCGTCACCCACGGCAGCCGAATTCACCGTG
ACGACGGAACCGCCGCCGACGCTGAGGCTGAGGCTGCTGAGCCTGGCCGTGGTGGCGCTCCGCCTGACGCTCTGC
CTGGCGGTGCTTCTCGTCCTGCACTCGCAATGGTGCGCCTCGGCGTCTGGGTGTGCGCGCCTGCTGAGCCTGTCG
CGGCCCCTCACCCTCGCCGCGCCGCGCAGCTCATTGTTGTGGCCCTGGCCGTGTCTCGCGCTGGCTCGTCTGCCC
GCGCCTGCGCTGCTGGCCCTCTTGGCTGCCACGCTGTACCTGGTTGGCCTTGGGCGCGCCCACGCCCGCGAGTCG
CTGCTTGTGCTGCGCGGCCTGGGCGTGCAGACGACGGAGGCGCCCGTCTCCTTCTTCTCCCCGGCTTCGCTCCTG
TCGTCTCCCTTTTCCTGGGTCTGCTCCTCGGGCGCCGCCACGCGCTTTATCCCCACGGAAAAGATTCACGACATA
CTCCTCAACGAGGCCTTTCGCGGCTTCGAGGTCCGCTACTACCTCGTTGTTGTTGTCGAGGGCGAGCAAGACGTC
GTCGTCGTCTTTCCCGGCCTGCTGCCCCCACGCCACATTGTCGAGACGGTCTGGAGAGGTGCCCGCCAATGTCTG
TATGAGGGACGTACAGAGGACAAGGGAGGCTAG
Transcript >OphauB2|6125
ATGGCCAGTCTGCTGAGGACAGCGCCGCGGCTGCACGTACGGCGGCCGTCACCCACGGCAGCCGAATTCACCGTG
ACGACGGAACCGCCGCCGACGCTGAGGCTGAGGCTGCTGAGCCTGGCCGTGGTGGCGCTCCGCCTGACGCTCTGC
CTGGCGGTGCTTCTCGTCCTGCACTCGCAATGGTGCGCCTCGGCGTCTGGGTGTGCGCGCCTGCTGAGCCTGTCG
CGGCCCCTCACCCTCGCCGCGCCGCGCAGCTCATTGTTGTGGCCCTGGCCGTGTCTCGCGCTGGCTCGTCTGCCC
GCGCCTGCGCTGCTGGCCCTCTTGGCTGCCACGCTGTACCTGGTTGGCCTTGGGCGCGCCCACGCCCGCGAGTCG
CTGCTTGTGCTGCGCGGCCTGGGCGTGCAGACGACGGAGGCGCCCGTCTCCTTCTTCTCCCCGGCTTCGCTCCTG
TCGTCTCCCTTTTCCTGGGTCTGCTCCTCGGGCGCCGCCACGCGCTTTATCCCCACGGAAAAGATTCACGACATA
CTCCTCAACGAGGCCTTTCGCGGCTTCGAGGTCCGCTACTACCTCGTTGTTGTTGTCGAGGGCGAGCAAGACGTC
GTCGTCGTCTTTCCCGGCCTGCTGCCCCCACGCCACATTGTCGAGACGGTCTGGAGAGGTGCCCGCCAATGTCTG
TATGAGGGACGTACAGAGGACAAGGGAGGCTAG
Gene >OphauB2|6125
ATGGCCAGTCTGCTGAGGACAGCGCCGCGGCTGCACGTACGGCGGCCGTCACCCACGGCAGCCGAATTCACCGTG
ACGACGGAACCGCCGCCGACGCTGAGGCTGAGGCTGCTGAGCCTGGCCGTGGTGGCGCTCCGCCTGACGCTCTGC
CTGGCGGTGCTTCTCGTCCTGCACTCGCAATGGTGCGCCTCGGCGTCTGGGTGTGCGCGCCTGCTGAGCCTGTCG
CGGCCCCTCACCCTCGCCGCGCCGCGCAGCTCATTGTTGTGGCCCTGGCCGTGTCTCGCGCTGGCTCGTCTGCCC
GCGCCTGCGCTGCTGGCCCTCTTGGCTGCCACGCTGTACCTGGTTGGCCTTGGGCGCGCCCACGCCCGCGAGTCG
CTGCTTGTGCTGCGCGGCCTGGGCGTGCAGACGACGGAGGCGCCCGTCTCCTTCTTCTCCCCGGCTTCGCTCCTG
TCGTCTCCCTTTTCCTGGGTCTGCTCCTCGGGCGCCGCCACGCGCTTTATCCCCACGGAAAAGATTCACGACATA
CTCCTCAACGAGGCCTTTCGCGGCTTCGAGGTCCGCTACTACCTCGTTGTTGTTGTCGAGGGCGAGCAAGACGTC
GTCGTCGTCTTTCCCGGCCTGCTGCCCCCACGCCACATTGTCGAGACGGTCTGGAGAGGTGCCCGCCAATGTCTG
TATGAGGGACGTACAGAGGACAAGGGAGGCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail