Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|6123
Gene name
LocationContig_53:30687..31373
Strand-
Gene length (bp)686
Transcript length (bp)564
Coding sequence length (bp)564
Protein length (aa) 188

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00071 Ras Ras family 1.8E-18 7 169

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q10133|RHO2_SCHPO GTP-binding protein rho2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rho2 PE=1 SV=1 3 186 3.0E-16
sp|Q15669|RHOH_HUMAN Rho-related GTP-binding protein RhoH OS=Homo sapiens GN=RHOH PE=1 SV=1 5 171 1.0E-15
sp|Q5REY6|RHOA_PONAB Transforming protein RhoA OS=Pongo abelii GN=RHOA PE=2 SV=2 1 186 1.0E-15
sp|P61586|RHOA_HUMAN Transforming protein RhoA OS=Homo sapiens GN=RHOA PE=1 SV=1 1 186 1.0E-15
sp|P61585|RHOA_BOVIN Transforming protein RhoA OS=Bos taurus GN=RHOA PE=1 SV=1 1 186 1.0E-15
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q10133|RHO2_SCHPO GTP-binding protein rho2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rho2 PE=1 SV=1 3 186 3.0E-16
sp|Q15669|RHOH_HUMAN Rho-related GTP-binding protein RhoH OS=Homo sapiens GN=RHOH PE=1 SV=1 5 171 1.0E-15
sp|Q5REY6|RHOA_PONAB Transforming protein RhoA OS=Pongo abelii GN=RHOA PE=2 SV=2 1 186 1.0E-15
sp|P61586|RHOA_HUMAN Transforming protein RhoA OS=Homo sapiens GN=RHOA PE=1 SV=1 1 186 1.0E-15
sp|P61585|RHOA_BOVIN Transforming protein RhoA OS=Bos taurus GN=RHOA PE=1 SV=1 1 186 1.0E-15
sp|P48148|RHO1_DROME Ras-like GTP-binding protein Rho1 OS=Drosophila melanogaster GN=Rho1 PE=1 SV=1 1 171 1.0E-15
sp|Q9D3G9|RHOH_MOUSE Rho-related GTP-binding protein RhoH OS=Mus musculus GN=Rhoh PE=1 SV=1 5 171 1.0E-15
sp|P06781|RHO2_YEAST GTP-binding protein RHO2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RHO2 PE=1 SV=2 7 179 2.0E-15
sp|P61589|RHOA_RAT Transforming protein RhoA OS=Rattus norvegicus GN=Rhoa PE=1 SV=1 1 186 2.0E-15
sp|Q9QUI0|RHOA_MOUSE Transforming protein RhoA OS=Mus musculus GN=Rhoa PE=1 SV=1 1 186 2.0E-15
sp|Q3SZA1|RHOF_BOVIN Rho-related GTP-binding protein RhoF OS=Bos taurus GN=RHOF PE=2 SV=1 6 181 2.0E-15
sp|Q2HJG3|RHOH_BOVIN Rho-related GTP-binding protein RhoH OS=Bos taurus GN=RHOH PE=2 SV=1 5 171 3.0E-15
sp|O42825|RHO1_CANAL GTP-binding protein RHO1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RHO1 PE=3 SV=1 7 172 3.0E-15
sp|P24406|RHOA_CANLF Transforming protein RhoA OS=Canis lupus familiaris GN=RHOA PE=2 SV=1 1 186 3.0E-15
sp|Q9HBH0|RHOF_HUMAN Rho-related GTP-binding protein RhoF OS=Homo sapiens GN=RHOF PE=1 SV=1 6 181 4.0E-15
sp|Q9C3Y4|RHOA_EMENI GTP-binding protein rhoA OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=rhoA PE=3 SV=1 1 172 4.0E-15
sp|Q8BYP3|RHOF_MOUSE Rho-related GTP-binding protein RhoF OS=Mus musculus GN=Rhof PE=1 SV=1 6 181 1.0E-14
sp|Q7T2E8|RHOAC_DANRE Rho-related GTP-binding protein RhoA-C OS=Danio rerio GN=rhoac PE=1 SV=1 1 186 1.0E-14
sp|P06780|RHO1_YEAST GTP-binding protein RHO1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RHO1 PE=1 SV=3 7 178 2.0E-14
sp|Q6NUX8|RHOAA_DANRE Rho-related GTP-binding protein RhoA-A OS=Danio rerio GN=rhoaa PE=1 SV=1 1 172 2.0E-14
sp|Q22038|RHO1_CAEEL Ras-like GTP-binding protein rhoA OS=Caenorhabditis elegans GN=rho-1 PE=1 SV=1 1 171 4.0E-14
sp|Q6DHE8|RHOAD_DANRE Rho-related GTP-binding protein RhoA-D OS=Danio rerio GN=rhoad PE=1 SV=1 1 186 4.0E-14
sp|Q00246|RHO4_YEAST GTP-binding protein RHO4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RHO4 PE=1 SV=2 6 173 6.0E-14
sp|Q9PSX7|RHOC_CHICK Rho-related GTP-binding protein RhoC OS=Gallus gallus GN=RHOC PE=1 SV=1 1 172 1.0E-13
sp|Q6DHM9|RHOAB_DANRE Rho-related GTP-binding protein RhoA-B OS=Danio rerio GN=rhoab PE=1 SV=1 1 186 2.0E-13
sp|P01122|RHO_APLCA Ras-like GTP-binding protein RHO OS=Aplysia californica GN=RHO PE=2 SV=1 1 172 3.0E-13
sp|Q9GPR2|RACI_DICDI Rho-related protein racI OS=Dictyostelium discoideum GN=racI PE=3 SV=1 1 167 5.0E-13
sp|Q09914|RHO1_SCHPO GTP-binding protein rho1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rho1 PE=2 SV=1 7 186 6.0E-13
sp|P92978|RAC11_ARATH Rac-like GTP-binding protein ARAC11 OS=Arabidopsis thaliana GN=ARAC11 PE=1 SV=2 6 170 1.0E-12
sp|Q38902|RAC1_ARATH Rac-like GTP-binding protein ARAC1 OS=Arabidopsis thaliana GN=ARAC1 PE=1 SV=1 6 170 2.0E-12
sp|Q9HF54|RHO1_ASHGO GTP-binding protein RHO1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=RHO1 PE=3 SV=1 7 170 2.0E-12
sp|Q5RCK9|RHOC_PONAB Rho-related GTP-binding protein RhoC OS=Pongo abelii GN=RHOC PE=2 SV=1 1 172 2.0E-12
sp|Q62159|RHOC_MOUSE Rho-related GTP-binding protein RhoC OS=Mus musculus GN=Rhoc PE=1 SV=2 1 172 2.0E-12
sp|P08134|RHOC_HUMAN Rho-related GTP-binding protein RhoC OS=Homo sapiens GN=RHOC PE=1 SV=1 1 172 2.0E-12
sp|Q1RMJ6|RHOC_BOVIN Rho-related GTP-binding protein RhoC OS=Bos taurus GN=RHOC PE=2 SV=1 1 172 2.0E-12
sp|Q8J212|RHO1_KLULA GTP-binding protein Rho1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=RHO1 PE=3 SV=1 7 170 2.0E-12
sp|Q9P8V0|RHO4_ASHGO GTP-binding protein RHO4 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=RHO4 PE=3 SV=1 6 170 2.0E-12
sp|P22122|RHO_DIPOM Ras-like GTP-binding protein O-RHO OS=Diplobatis ommata PE=2 SV=1 1 186 2.0E-12
sp|P34145|RAC1B_DICDI Rho-related protein rac1B OS=Dictyostelium discoideum GN=rac1B PE=1 SV=2 6 186 2.0E-12
sp|Q9HE04|RHO5_SCHPO GTP-binding protein rho5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rho5 PE=3 SV=1 7 177 4.0E-12
sp|O82480|RAC7_ARATH Rac-like GTP-binding protein ARAC7 OS=Arabidopsis thaliana GN=ARAC7 PE=1 SV=1 6 173 4.0E-12
sp|Q35638|RHO1_PEA Rac-like GTP-binding protein RHO1 OS=Pisum sativum GN=RHO1 PE=2 SV=1 6 170 6.0E-12
sp|C4YDI6|CDC42_CANAW Cell division control protein 42 homolog OS=Candida albicans (strain WO-1) GN=CDC42 PE=3 SV=1 5 171 6.0E-12
sp|P0CY33|CDC42_CANAL Cell division control protein 42 homolog OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CDC42 PE=3 SV=1 5 171 6.0E-12
sp|Q39435|RAC1_BETVU Rac-like GTP-binding protein RHO1 OS=Beta vulgaris GN=RHO1 PE=2 SV=1 6 163 9.0E-12
sp|Q9SBJ6|RAC6_ARATH Rac-like GTP-binding protein ARAC6 OS=Arabidopsis thaliana GN=ARAC6 PE=1 SV=2 6 170 1.0E-11
sp|Q4R4R6|CDC42_MACFA Cell division control protein 42 homolog OS=Macaca fascicularis GN=CDC42 PE=2 SV=1 5 171 1.0E-11
sp|Q8CFN2|CDC42_RAT Cell division control protein 42 homolog OS=Rattus norvegicus GN=Cdc42 PE=1 SV=2 5 171 1.0E-11
sp|Q007T2|CDC42_PIG Cell division control protein 42 homolog OS=Sus scrofa GN=CDC42 PE=2 SV=2 5 171 1.0E-11
sp|P60766|CDC42_MOUSE Cell division control protein 42 homolog OS=Mus musculus GN=Cdc42 PE=1 SV=2 5 171 1.0E-11
sp|P60953|CDC42_HUMAN Cell division control protein 42 homolog OS=Homo sapiens GN=CDC42 PE=1 SV=2 5 171 1.0E-11
sp|P60952|CDC42_CANLF Cell division control protein 42 homolog OS=Canis lupus familiaris GN=CDC42 PE=2 SV=2 5 171 1.0E-11
sp|Q2KJ93|CDC42_BOVIN Cell division control protein 42 homolog OS=Bos taurus GN=CDC42 PE=1 SV=1 5 171 1.0E-11
sp|Q90694|CDC42_CHICK Cell division control protein 42 homolog OS=Gallus gallus GN=CDC42 PE=2 SV=1 5 171 1.0E-11
sp|Q38912|RAC3_ARATH Rac-like GTP-binding protein ARAC3 OS=Arabidopsis thaliana GN=ARAC3 PE=1 SV=1 6 171 2.0E-11
sp|Q24192|RHOL_DROME Ras-like GTP-binding protein RhoL OS=Drosophila melanogaster GN=RhoL PE=2 SV=1 3 180 2.0E-11
sp|P34144|RAC1A_DICDI Rho-related protein rac1A OS=Dictyostelium discoideum GN=rac1A PE=1 SV=2 6 184 2.0E-11
sp|Q38903|RAC2_ARATH Rac-like GTP-binding protein ARAC2 OS=Arabidopsis thaliana GN=ARAC2 PE=1 SV=1 6 171 3.0E-11
sp|Q9HF56|CDC42_ASHGO Cell division control protein 42 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=CDC42 PE=3 SV=1 5 171 3.0E-11
sp|P62747|RHOB_RAT Rho-related GTP-binding protein RhoB OS=Rattus norvegicus GN=Rhob PE=1 SV=1 1 185 4.0E-11
sp|P62746|RHOB_MOUSE Rho-related GTP-binding protein RhoB OS=Mus musculus GN=Rhob PE=1 SV=1 1 185 4.0E-11
sp|P62745|RHOB_HUMAN Rho-related GTP-binding protein RhoB OS=Homo sapiens GN=RHOB PE=1 SV=1 1 185 4.0E-11
sp|Q3ZBW5|RHOB_BOVIN Rho-related GTP-binding protein RhoB OS=Bos taurus GN=RHOB PE=2 SV=1 1 185 4.0E-11
sp|P34146|RAC1C_DICDI Rho-related protein rac1C OS=Dictyostelium discoideum GN=rac1C PE=1 SV=2 6 184 5.0E-11
sp|Q9SSX0|RAC1_ORYSJ Rac-like GTP-binding protein 1 OS=Oryza sativa subsp. japonica GN=RAC1 PE=1 SV=1 6 173 5.0E-11
sp|Q54YY4|RACN_DICDI Rho-related protein racN OS=Dictyostelium discoideum GN=racN PE=3 SV=1 1 163 6.0E-11
sp|O04369|RAC1_LOTJA Rac-like GTP-binding protein RAC1 OS=Lotus japonicus GN=RAC1 PE=2 SV=1 6 163 6.0E-11
sp|O13928|RHO3_SCHPO GTP-binding protein rho3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rho3 PE=1 SV=2 3 186 7.0E-11
sp|Q6EP31|RAC5_ORYSJ Rac-like GTP-binding protein 5 OS=Oryza sativa subsp. japonica GN=RAC5 PE=2 SV=2 6 163 8.0E-11
sp|Q9GPR7|RACH_DICDI Rho-related protein racH OS=Dictyostelium discoideum GN=racH PE=3 SV=1 6 170 9.0E-11
sp|O76321|RECG_ENTHI Rho-related protein racG OS=Entamoeba histolytica GN=RACG PE=3 SV=1 6 170 1.0E-10
sp|P48554|RAC2_DROME Ras-related protein Rac2 OS=Drosophila melanogaster GN=Rac2 PE=1 SV=1 6 170 1.0E-10
sp|P97348|RHOD_MOUSE Rho-related GTP-binding protein RhoD OS=Mus musculus GN=Rhod PE=1 SV=1 5 172 2.0E-10
sp|P34148|RACB_DICDI Rho-related protein racB OS=Dictyostelium discoideum GN=racB PE=1 SV=1 5 170 2.0E-10
sp|Q01112|CDC42_SCHPO Cell division control protein 42 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cdc42 PE=1 SV=1 5 164 2.0E-10
sp|Q29HY3|CDC42_DROPS Cdc42 homolog OS=Drosophila pseudoobscura pseudoobscura GN=Cdc42 PE=3 SV=1 5 171 2.0E-10
sp|Q41254|RAC9_GOSHI Rac-like GTP-binding protein RAC9 OS=Gossypium hirsutum GN=RAC9 PE=2 SV=1 6 170 2.0E-10
sp|Q5R9F4|RND3_PONAB Rho-related GTP-binding protein RhoE OS=Pongo abelii GN=RND3 PE=2 SV=1 1 156 2.0E-10
sp|P40793|CDC42_DROME Cdc42 homolog OS=Drosophila melanogaster GN=Cdc42 PE=1 SV=1 5 171 2.0E-10
sp|Q38937|RAC5_ARATH Rac-like GTP-binding protein ARAC5 OS=Arabidopsis thaliana GN=ARAC5 PE=1 SV=1 6 163 2.0E-10
sp|Q38919|RAC4_ARATH Rac-like GTP-binding protein ARAC4 OS=Arabidopsis thaliana GN=ARAC4 PE=1 SV=1 6 163 3.0E-10
sp|Q6SA80|RND3_RAT Rho-related GTP-binding protein RhoE OS=Rattus norvegicus GN=Rnd3 PE=2 SV=1 1 156 3.0E-10
sp|P61588|RND3_MOUSE Rho-related GTP-binding protein RhoE OS=Mus musculus GN=Rnd3 PE=1 SV=1 1 156 3.0E-10
sp|P61587|RND3_HUMAN Rho-related GTP-binding protein RhoE OS=Homo sapiens GN=RND3 PE=1 SV=1 1 156 3.0E-10
sp|Q9SU67|RAC8_ARATH Rac-like GTP-binding protein ARAC8 OS=Arabidopsis thaliana GN=ARAC8 PE=1 SV=2 6 171 3.0E-10
sp|Q17031|CDC42_ANOGA Cdc42 homolog OS=Anopheles gambiae GN=Cdc42 PE=2 SV=2 5 171 3.0E-10
sp|Q874R1|RHO4_SCHPO GTP-binding protein rho4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rho4 PE=1 SV=2 7 163 3.0E-10
sp|P34147|RACA_DICDI Rho-related protein racA OS=Dictyostelium discoideum GN=racA PE=1 SV=2 6 183 4.0E-10
sp|Q16YG0|CDC42_AEDAE Cdc42 homolog OS=Aedes aegypti GN=Cdc42 PE=3 SV=1 5 171 4.0E-10
sp|Q9XGU0|RAC9_ARATH Rac-like GTP-binding protein ARAC9 OS=Arabidopsis thaliana GN=ARAC9 PE=1 SV=1 6 170 5.0E-10
sp|Q68Y52|RAC2_ORYSJ Rac-like GTP-binding protein 2 OS=Oryza sativa subsp. japonica GN=RAC2 PE=2 SV=1 6 173 6.0E-10
sp|Q67VP4|RAC4_ORYSJ Rac-like GTP-binding protein 4 OS=Oryza sativa subsp. japonica GN=RAC4 PE=2 SV=1 6 171 8.0E-10
sp|O82481|RAC10_ARATH Rac-like GTP-binding protein ARAC10 OS=Arabidopsis thaliana GN=ARAC10 PE=1 SV=1 6 173 9.0E-10
sp|Q41253|RAC13_GOSHI Rac-like GTP-binding protein RAC13 OS=Gossypium hirsutum GN=RAC13 PE=2 SV=1 6 170 1.0E-09
sp|P84096|RHOG_MOUSE Rho-related GTP-binding protein RhoG OS=Mus musculus GN=Rhog PE=1 SV=1 5 180 1.0E-09
sp|P84095|RHOG_HUMAN Rho-related GTP-binding protein RhoG OS=Homo sapiens GN=RHOG PE=1 SV=1 5 180 1.0E-09
sp|P84097|RHOG_CRICR Rho-related GTP-binding protein RhoG OS=Cricetus cricetus GN=RHOG PE=2 SV=1 5 180 1.0E-09
sp|Q54FL2|RABG2_DICDI Ras-related protein RabG2 OS=Dictyostelium discoideum GN=rabG2 PE=3 SV=2 2 178 1.0E-09
sp|Q03206|RAC1_CAEEL Ras-related protein ced-10 OS=Caenorhabditis elegans GN=ced-10 PE=1 SV=2 6 170 2.0E-09
sp|P19073|CDC42_YEAST Cell division control protein 42 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC42 PE=1 SV=2 5 171 2.0E-09
sp|P53879|RHO5_YEAST GTP-binding protein RHO5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RHO5 PE=1 SV=2 5 170 3.0E-09
sp|Q7L0Q8|RHOU_HUMAN Rho-related GTP-binding protein RhoU OS=Homo sapiens GN=RHOU PE=1 SV=1 6 163 3.0E-09
sp|Q6Z808|RAC3_ORYSJ Rac-like GTP-binding protein 3 OS=Oryza sativa subsp. japonica GN=RAC3 PE=2 SV=1 6 171 3.0E-09
sp|O00212|RHOD_HUMAN Rho-related GTP-binding protein RhoD OS=Homo sapiens GN=RHOD PE=1 SV=2 5 172 4.0E-09
sp|Q24816|RACC_ENTHI Rho-related protein racC OS=Entamoeba histolytica GN=RACC PE=1 SV=1 3 184 4.0E-09
sp|Q9HF51|RHO3_ASHGO GTP-binding protein RHO3 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=RHO3 PE=3 SV=1 3 170 5.0E-09
sp|Q05062|CDC42_CAEEL Cell division control protein 42 homolog OS=Caenorhabditis elegans GN=cdc-42 PE=1 SV=2 5 170 5.0E-09
sp|O88931|RAC2_CAVPO Ras-related C3 botulinum toxin substrate 2 OS=Cavia porcellus GN=RAC2 PE=2 SV=2 6 170 6.0E-09
sp|Q94124|RAC2_CAEEL Ras-related protein rac-2 OS=Caenorhabditis elegans GN=rac-2 PE=3 SV=1 6 170 1.0E-08
sp|A5D7J5|RHOU_BOVIN Rho-related GTP-binding protein RhoU OS=Bos taurus GN=RHOU PE=2 SV=1 6 163 1.0E-08
sp|P31021|RHO1_ENTHI Ras-like GTP-binding protein RHO1 OS=Entamoeba histolytica GN=RHO1 PE=3 SV=1 6 163 2.0E-08
sp|Q619T5|RASEF_CAEBR Ras and EF-hand domain-containing protein homolog OS=Caenorhabditis briggsae GN=tag-312 PE=3 SV=1 5 185 2.0E-08
sp|Q9GPQ8|RACL_DICDI Rho-related protein racL OS=Dictyostelium discoideum GN=racL PE=3 SV=1 6 167 3.0E-08
sp|Q9TVU5|RAB1_THEPA Ras-related protein Rab-1 OS=Theileria parva GN=rab1 PE=1 SV=1 7 167 3.0E-08
sp|Q22908|RASEF_CAEEL Ras and EF-hand domain-containing protein homolog OS=Caenorhabditis elegans GN=tag-312 PE=3 SV=2 5 185 5.0E-08
sp|Q4UB16|RAB1_THEAN Ras-related protein Rab-1 OS=Theileria annulata GN=rab1 PE=3 SV=1 7 167 6.0E-08
sp|Q2HJ68|RND1_BOVIN Rho-related GTP-binding protein Rho6 OS=Bos taurus GN=RND1 PE=2 SV=1 7 169 7.0E-08
sp|Q55FU9|RAB24_DICDI Ras-related protein Rab-24 OS=Dictyostelium discoideum GN=rab24 PE=3 SV=1 4 184 7.0E-08
sp|Q00245|RHO3_YEAST GTP-binding protein RHO3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RHO3 PE=1 SV=2 3 170 8.0E-08
sp|Q92730|RND1_HUMAN Rho-related GTP-binding protein Rho6 OS=Homo sapiens GN=RND1 PE=1 SV=1 7 169 9.0E-08
sp|Q54E92|RABG1_DICDI Ras-related protein RabG1 OS=Dictyostelium discoideum GN=rabG1 PE=3 SV=1 2 162 5.0E-07
sp|Q54GY8|RAB18_DICDI Ras-related protein Rab-18 OS=Dictyostelium discoideum GN=rab18 PE=3 SV=1 7 171 9.0E-07
sp|Q9FLQ3|RAN4_ARATH GTP-binding nuclear protein Ran-4 OS=Arabidopsis thaliana GN=RAN4 PE=3 SV=1 1 152 1.0E-06
sp|Q9GPS0|RACG_DICDI Rho-related protein racG OS=Dictyostelium discoideum GN=racG PE=3 SV=1 5 171 1.0E-06
sp|Q9P8J9|RHO3_SCHCO GTP-binding protein Rho3 OS=Schizophyllum commune GN=RHO3 PE=2 SV=1 3 186 2.0E-06
sp|O23657|RABC1_ARATH Ras-related protein RABC1 OS=Arabidopsis thaliana GN=RABC1 PE=1 SV=1 7 183 2.0E-06
sp|Q23862|RACE_DICDI Rho-related protein racE OS=Dictyostelium discoideum GN=racE PE=1 SV=1 6 162 3.0E-06
sp|P33153|CRL1_CANAW GTP-binding RHO-like protein OS=Candida albicans (strain WO-1) GN=CRL1 PE=3 SV=2 5 162 3.0E-06
sp|Q96WY0|RHOC_EMENI GTP-binding protein rhoC OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=rhoC PE=3 SV=2 7 170 4.0E-06
sp|Q8RXF8|MIRO1_ARATH Mitochondrial Rho GTPase 1 OS=Arabidopsis thaliana GN=MIRO1 PE=1 SV=1 3 178 6.0E-06
sp|P52198|RND2_HUMAN Rho-related GTP-binding protein RhoN OS=Homo sapiens GN=RND2 PE=1 SV=2 7 123 1.0E-05
sp|P34150|RACD_DICDI Rho-related protein racD OS=Dictyostelium discoideum GN=racD PE=2 SV=3 53 158 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0005525 GTP binding Yes
GO:0003924 GTPase activity Yes
GO:0017111 nucleoside-triphosphatase activity No
GO:0005488 binding No
GO:0016787 hydrolase activity No
GO:0003674 molecular_function No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0000166 nucleotide binding No
GO:0043167 ion binding No
GO:0019001 guanyl nucleotide binding No
GO:0032553 ribonucleotide binding No
GO:0097367 carbohydrate derivative binding No
GO:0016817 hydrolase activity, acting on acid anhydrides No
GO:0043168 anion binding No
GO:0003824 catalytic activity No
GO:0017076 purine nucleotide binding No
GO:0097159 organic cyclic compound binding No
GO:1901265 nucleoside phosphate binding No
GO:0032555 purine ribonucleotide binding No
GO:0016818 hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides No
GO:1901363 heterocyclic compound binding No
GO:0036094 small molecule binding No
GO:0016462 pyrophosphatase activity No
GO:0032561 guanyl ribonucleotide binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 70 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|6123
MDPVTVKLLLVGDDKCGKTTFLSRLSASQETNPIPLLRDIHQPFSFNIKIGKQACRLDFYDTSSPHNWRLLDPDM
IVICYDISQRLSLINVTRFWLEQLKRAFWRFDGLPVMIAGLKRDLRCESDPNGVIYPQEAYQVAQAMRADGYVEC
SALTGELVELAFEDICRTAVKTLNEAGGQSEGGCLVQ*
Coding >OphauB2|6123
ATGGACCCTGTTACTGTCAAGCTGCTGCTGGTAGGCGATGACAAGTGCGGCAAGACGACATTTTTATCAAGGCTC
AGCGCAAGCCAAGAAACGAACCCCATCCCACTATTGCGCGACATCCATCAGCCATTTAGCTTTAACATCAAAATC
GGCAAGCAAGCATGTCGTCTCGACTTCTATGACACTTCGAGCCCTCACAACTGGCGTCTGCTAGACCCAGACATG
ATTGTCATATGCTACGATATTAGCCAGAGGCTTAGCCTCATCAATGTGACAAGATTTTGGCTAGAGCAACTCAAA
AGAGCATTCTGGCGGTTCGATGGCCTGCCCGTCATGATTGCCGGACTCAAGCGCGACTTGAGATGCGAGTCGGAT
CCCAATGGCGTCATTTACCCTCAAGAGGCCTATCAAGTGGCACAAGCCATGCGCGCTGATGGCTATGTCGAATGT
TCGGCCCTCACAGGGGAACTGGTAGAGCTGGCCTTTGAGGACATTTGCCGCACGGCTGTCAAGACGCTGAACGAG
GCTGGCGGCCAGAGTGAGGGCGGCTGTCTTGTGCAATGA
Transcript >OphauB2|6123
ATGGACCCTGTTACTGTCAAGCTGCTGCTGGTAGGCGATGACAAGTGCGGCAAGACGACATTTTTATCAAGGCTC
AGCGCAAGCCAAGAAACGAACCCCATCCCACTATTGCGCGACATCCATCAGCCATTTAGCTTTAACATCAAAATC
GGCAAGCAAGCATGTCGTCTCGACTTCTATGACACTTCGAGCCCTCACAACTGGCGTCTGCTAGACCCAGACATG
ATTGTCATATGCTACGATATTAGCCAGAGGCTTAGCCTCATCAATGTGACAAGATTTTGGCTAGAGCAACTCAAA
AGAGCATTCTGGCGGTTCGATGGCCTGCCCGTCATGATTGCCGGACTCAAGCGCGACTTGAGATGCGAGTCGGAT
CCCAATGGCGTCATTTACCCTCAAGAGGCCTATCAAGTGGCACAAGCCATGCGCGCTGATGGCTATGTCGAATGT
TCGGCCCTCACAGGGGAACTGGTAGAGCTGGCCTTTGAGGACATTTGCCGCACGGCTGTCAAGACGCTGAACGAG
GCTGGCGGCCAGAGTGAGGGCGGCTGTCTTGTGCAATGA
Gene >OphauB2|6123
ATGGACCCTGTTACTGTCAAGCTGCTGCTGGTAGGCGATGACAAGTGCGGCAAGACGACATTTTTATCGTTTGTC
ACGTCCAGTCGGTTCCTGACTGCTCTGCCCCTAATGACTTTGTAACAGAAGGCTCAGCGCAAGCCAAGAAACGAA
CCCCATCCCACTATTGCGCGACATCCATCAGCCATTTAGCTTTAACATCAAAATCGGCAAGCAAGCATGTCGTCT
CGACTTCTATGACACTTCGAGCCCTCACAACTGGCGTCTGCTAGACCCAGACATGATTGTCATATGCTACGATAT
TAGCCAGAGGCTTAGCCTCATCAATGTGACAAGATTTGTAAGTTTTACTTGCAGTCCATCACCAAAGCAGGCCAG
GCTGATGCTGTGCATCGACGAGACAAAAGTGGCTAGAGCAACTCAAAAGAGCATTCTGGCGGTTCGATGGCCTGC
CCGTCATGATTGCCGGACTCAAGCGCGACTTGAGATGCGAGTCGGATCCCAATGGCGTCATTTACCCTCAAGAGG
CCTATCAAGTGGCACAAGCCATGCGCGCTGATGGCTATGTCGAATGTTCGGCCCTCACAGGGGAACTGGTAGAGC
TGGCCTTTGAGGACATTTGCCGCACGGCTGTCAAGACGCTGAACGAGGCTGGCGGCCAGAGTGAGGGCGGCTGTC
TTGTGCAATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail