Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|6103
Gene name
LocationContig_52:100733..102936
Strand+
Gene length (bp)2203
Transcript length (bp)2034
Coding sequence length (bp)2034
Protein length (aa) 678

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF09731 Mitofilin Mitochondrial inner membrane protein 1.7E-18 141 249
PF09731 Mitofilin Mitochondrial inner membrane protein 1.2E-119 314 670

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q7SFD8|MIC60_NEUCR MICOS complex subunit mic60 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=mic60 PE=3 SV=1 133 677 0.0E+00
sp|C7YIH6|MIC60_NECH7 MICOS complex subunit MIC60 OS=Nectria haematococca (strain 77-13-4 / ATCC MYA-4622 / FGSC 9596 / MPVI) GN=MIC60 PE=3 SV=1 1 677 0.0E+00
sp|A7F6C1|MIC60_SCLS1 MICOS complex subunit mic60 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=mic60 PE=3 SV=1 1 663 0.0E+00
sp|D1Z5G1|MIC60_SORMK MICOS complex subunit MIC60 OS=Sordaria macrospora (strain ATCC MYA-333 / DSM 997 / K(L3346) / K-hell) GN=MIC60 PE=3 SV=1 295 677 1.0E-169
sp|Q0V4H8|MIC60_PHANO MICOS complex subunit MIC60 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=MIC60 PE=3 SV=2 141 677 3.0E-158
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q7SFD8|MIC60_NEUCR MICOS complex subunit mic60 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=mic60 PE=3 SV=1 133 677 0.0E+00
sp|C7YIH6|MIC60_NECH7 MICOS complex subunit MIC60 OS=Nectria haematococca (strain 77-13-4 / ATCC MYA-4622 / FGSC 9596 / MPVI) GN=MIC60 PE=3 SV=1 1 677 0.0E+00
sp|A7F6C1|MIC60_SCLS1 MICOS complex subunit mic60 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=mic60 PE=3 SV=1 1 663 0.0E+00
sp|D1Z5G1|MIC60_SORMK MICOS complex subunit MIC60 OS=Sordaria macrospora (strain ATCC MYA-333 / DSM 997 / K(L3346) / K-hell) GN=MIC60 PE=3 SV=1 295 677 1.0E-169
sp|Q0V4H8|MIC60_PHANO MICOS complex subunit MIC60 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=MIC60 PE=3 SV=2 141 677 3.0E-158
sp|B2WBQ6|MIC60_PYRTR MICOS complex subunit MIC60 OS=Pyrenophora tritici-repentis (strain Pt-1C-BFP) GN=MIC60 PE=3 SV=1 146 677 5.0E-158
sp|D4DHX2|MIC60_TRIVH MICOS complex subunit MIC60 OS=Trichophyton verrucosum (strain HKI 0517) GN=MIC60 PE=3 SV=1 128 665 9.0E-156
sp|C6H203|MIC60_AJECH MICOS complex subunit MIC60 OS=Ajellomyces capsulatus (strain H143) GN=MIC60 PE=3 SV=1 1 677 6.0E-155
sp|C5P436|MIC60_COCP7 MICOS complex subunit MIC60 OS=Coccidioides posadasii (strain C735) GN=MIC60 PE=3 SV=1 135 677 1.0E-154
sp|A1CHB5|MIC60_ASPCL MICOS complex subunit mic60 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=mic60 PE=3 SV=1 141 677 2.0E-154
sp|D4ANR0|MIC60_ARTBC MICOS complex subunit MIC60 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=MIC60 PE=3 SV=1 136 665 2.0E-154
sp|C4JHS3|MIC60_UNCRE MICOS complex subunit MIC60 OS=Uncinocarpus reesii (strain UAMH 1704) GN=MIC60 PE=3 SV=1 156 677 3.0E-154
sp|C5GFG7|MIC60_AJEDR MICOS complex subunit MIC60 OS=Ajellomyces dermatitidis (strain ER-3 / ATCC MYA-2586) GN=MIC60 PE=3 SV=1 156 677 2.0E-152
sp|C5JIS0|MIC60_AJEDS MICOS complex subunit MIC60 OS=Ajellomyces dermatitidis (strain SLH14081) GN=MIC60 PE=3 SV=1 156 677 3.0E-152
sp|Q5B6I7|MIC60_EMENI MICOS complex subunit mic60 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=mic60 PE=3 SV=1 125 677 1.0E-151
sp|C0NUJ9|MIC60_AJECG MICOS complex subunit MIC60 OS=Ajellomyces capsulatus (strain G186AR / H82 / ATCC MYA-2454 / RMSCC 2432) GN=MIC60 PE=3 SV=1 1 677 1.0E-150
sp|A1CXH2|MIC60_NEOFI MICOS complex subunit MIC60 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=MIC60 PE=3 SV=1 141 677 2.0E-150
sp|C0RYV1|MIC60_PARBP MICOS complex subunit MIC60 OS=Paracoccidioides brasiliensis (strain Pb03) GN=MIC60 PE=3 SV=2 141 677 2.0E-149
sp|C5FGB1|MIC60_ARTOC MICOS complex subunit MIC60 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=MIC60 PE=3 SV=1 1 651 2.0E-149
sp|B8MJK3|MIC60_TALSN MICOS complex subunit MIC60 OS=Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) GN=MIC60 PE=3 SV=1 134 677 3.0E-149
sp|C1G784|MIC60_PARBD MICOS complex subunit MIC60 OS=Paracoccidioides brasiliensis (strain Pb18) GN=MIC60 PE=3 SV=2 141 677 3.0E-149
sp|B6QHK6|MIC60_TALMQ MICOS complex subunit mic60 OS=Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) GN=mic60 PE=3 SV=1 121 677 8.0E-149
sp|B6H457|MIC60_PENRW MICOS complex subunit mic60 OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=mic60 PE=3 SV=1 141 677 2.0E-148
sp|A6RBC5|MIC60_AJECN MICOS complex subunit MIC60 OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=MIC60 PE=3 SV=1 141 677 4.0E-148
sp|C1GYK6|MIC60_PARBA MICOS complex subunit MIC60 OS=Paracoccidioides lutzii (strain ATCC MYA-826 / Pb01) GN=MIC60 PE=3 SV=1 156 677 8.0E-145
sp|A2QI68|MIC60_ASPNC MICOS complex subunit mic60 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=mic60 PE=3 SV=1 156 677 2.0E-144
sp|Q4WP49|MIC60_ASPFU MICOS complex subunit mic60 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=mic60 PE=3 SV=1 141 664 2.0E-143
sp|B0Y5Z6|MIC60_ASPFC MICOS complex subunit mic60 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=mic60 PE=3 SV=1 141 664 2.0E-143
sp|Q6C060|MIC60_YARLI MICOS complex subunit MIC60 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=MIC60 PE=3 SV=1 123 671 2.0E-64
sp|A5DSD2|MIC60_LODEL MICOS complex subunit MIC60 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=MIC60 PE=3 SV=1 122 671 1.0E-32
sp|C5M3V6|MIC60_CANTT MICOS complex subunit MIC60 OS=Candida tropicalis (strain ATCC MYA-3404 / T1) GN=MIC60 PE=3 SV=1 145 671 8.0E-31
sp|B9WLF1|MIC60_CANDC MICOS complex subunit MIC60 OS=Candida dubliniensis (strain CD36 / ATCC MYA-646 / CBS 7987 / NCPF 3949 / NRRL Y-17841) GN=MIC60 PE=3 SV=1 453 671 2.0E-29
sp|C4YLH0|MIC60_CANAW MICOS complex subunit MIC60 OS=Candida albicans (strain WO-1) GN=MIC60 PE=3 SV=1 145 671 5.0E-29
sp|Q5A044|MIC60_CANAL MICOS complex subunit MIC60 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MIC60 PE=3 SV=1 453 671 2.0E-28
sp|Q6BXM9|MIC60_DEBHA MICOS complex subunit MIC60 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=MIC60 PE=3 SV=2 157 671 4.0E-28
sp|C4QXN2|MIC60_PICPG MICOS complex subunit MIC60 OS=Komagataella pastoris (strain GS115 / ATCC 20864) GN=MIC60 PE=3 SV=1 119 671 1.0E-27
sp|Q6FSU7|MIC60_CANGA MICOS complex subunit MIC60 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=MIC60 PE=3 SV=1 315 670 2.0E-25
sp|Q6CSB8|MIC60_KLULA MICOS complex subunit MIC60 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=MIC60 PE=3 SV=1 119 670 4.0E-25
sp|A3LQS0|MIC60_PICST MICOS complex subunit MIC60 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=MIC60 PE=3 SV=2 142 671 4.0E-23
sp|A5D9S8|MIC60_PICGU MICOS complex subunit MIC60 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=MIC60 PE=3 SV=2 407 670 1.0E-22
sp|A7TSS9|MIC60_VANPO MICOS complex subunit MIC60 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=MIC60 PE=3 SV=1 390 670 3.0E-21
sp|O59725|MIC60_SCHPO MICOS complex subunit mic60 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mic60 PE=3 SV=1 394 673 2.0E-20
sp|C5E325|MIC60_LACTC MICOS complex subunit MIC60 OS=Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284) GN=MIC60 PE=3 SV=1 361 670 3.0E-20
sp|Q754G4|MIC60_ASHGO MICOS complex subunit MIC60 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=MIC60 PE=3 SV=2 405 670 6.0E-20
sp|A6ZZY0|MIC60_YEAS7 MICOS complex subunit MIC60 OS=Saccharomyces cerevisiae (strain YJM789) GN=MIC60 PE=3 SV=1 318 670 2.0E-18
sp|B3LRA0|MIC60_YEAS1 MICOS complex subunit MIC60 OS=Saccharomyces cerevisiae (strain RM11-1a) GN=MIC60 PE=3 SV=1 318 670 2.0E-18
sp|P36112|MIC60_YEAST MICOS complex subunit MIC60 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MIC60 PE=1 SV=1 318 670 2.0E-18
sp|B5VMG3|MIC60_YEAS6 MICOS complex subunit MIC60 OS=Saccharomyces cerevisiae (strain AWRI1631) GN=MIC60 PE=3 SV=1 318 670 5.0E-18
sp|C8ZCI0|MIC60_YEAS8 MICOS complex subunit MIC60 OS=Saccharomyces cerevisiae (strain Lalvin EC1118 / Prise de mousse) GN=MIC60 PE=3 SV=1 318 670 1.0E-17
sp|P91928|MIC60_DROME MICOS complex subunit Mic60 OS=Drosophila melanogaster GN=Mitofilin PE=1 SV=4 407 669 9.0E-12
sp|Q16891|MIC60_HUMAN MICOS complex subunit MIC60 OS=Homo sapiens GN=IMMT PE=1 SV=1 402 669 2.0E-11
sp|Q8CAQ8|MIC60_MOUSE MICOS complex subunit Mic60 OS=Mus musculus GN=Immt PE=1 SV=1 393 669 1.0E-09
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 23 0.45

Transmembrane Domains

Domain # Start End Length
1 145 164 19

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|6103
MLRSSLQSAKVLGSTSIAAAAGRQLPIATSRRLGARSYAKFKRGAQGVPKPPILPASETLSSEREPPPLDLGQGQ
PKGVKDVPLTPPTPSQVDAGNVPHPSTTIDDVGESKVFQDELSRFSAPPTPPPPPPPQEKKGTFRRLRKFVLALL
LVGVAGFGGGVWYARINDNFHDFFTEYIPYGERAVLALEELDYRKRFPQAQQRGTLSHASDQPVRIPAQSGASWR
VSDKGESAGRHSNASPSRESKSPSLTGEKPSSEPLPAEIGELKTMTADRVHSQPEEKPTNPSFDSFKPPEVNEPS
RFPPIKLIDLMELPDANEPIVRDLVHMLNDVILVINADGAHAKYASTMDKAKNDIIKMGDRLKTLKTMEEKKAAA
QVKSSIVEFDKAATQLIKRVEQTMVVQELEWRKEYEEEMSRVQQNYDERVNLLIERERQLNEARLRTELMAQALA
LKKEFVKEVEQRVEQERQGRLSKLKELSAAVSELGKLTAECNEVVDSNLKTQQLHVAVEAVRASLEDAQHPQPFI
RELVALKEIAADDPVVNAAIASVTPAAYQRGISSPSQLIDRFRRVAGEVRKASLLPEDAGVASHASSWMLSHMLF
KKQGLAQGSDVESILTRTQTYLEQGNLDAAAREMNGLDGWAKTLSKDWLSEVRKVLEVQQALDVIATEARLQSLR
ID*
Coding >OphauB2|6103
ATGCTGCGCTCATCGCTTCAATCGGCAAAGGTGCTCGGCAGCACGTCCATTGCGGCTGCTGCAGGGCGCCAATTG
CCAATTGCGACGTCGCGGCGATTGGGTGCTAGATCCTATGCCAAGTTTAAGCGCGGCGCTCAAGGCGTGCCAAAG
CCTCCCATCTTGCCCGCGTCGGAGACTCTTAGCTCCGAGAGAGAACCGCCGCCGCTCGACCTCGGCCAGGGCCAG
CCCAAGGGTGTCAAGGACGTGCCTCTTACTCCTCCAACCCCCTCTCAAGTTGACGCTGGCAATGTGCCTCATCCA
TCGACGACAATTGATGACGTGGGCGAGTCCAAGGTGTTCCAAGACGAGCTATCGAGATTCTCGGCTCCGCCCACG
CCCCCTCCCCCGCCTCCGCCTCAGGAGAAGAAGGGCACGTTTCGTCGGCTGCGTAAATTTGTACTGGCATTACTT
CTTGTTGGGGTAGCTGGGTTTGGAGGCGGTGTCTGGTATGCGCGCATCAATGACAACTTTCATGACTTCTTCACC
GAGTATATTCCCTATGGAGAGCGAGCAGTCTTGGCTCTTGAGGAACTGGACTATAGGAAGAGATTTCCTCAGGCT
CAACAACGCGGAACGCTGTCTCATGCCAGCGACCAGCCAGTCAGAATACCTGCGCAGAGTGGTGCTTCTTGGAGG
GTCTCGGACAAGGGAGAATCTGCTGGACGCCATTCCAACGCTTCCCCCTCACGGGAAAGCAAATCGCCGTCATTG
ACTGGAGAGAAGCCGTCGTCGGAGCCCTTGCCTGCAGAGATTGGCGAGCTCAAGACCATGACTGCCGACAGGGTG
CATTCTCAACCTGAAGAGAAGCCCACAAATCCATCTTTCGACTCTTTCAAACCGCCCGAGGTCAATGAGCCATCT
CGTTTTCCGCCTATCAAGTTGATTGATCTCATGGAGCTTCCAGACGCCAATGAGCCCATTGTGCGAGATTTGGTT
CATATGCTCAATGACGTGATTCTCGTCATCAACGCCGACGGGGCCCACGCCAAGTACGCATCAACAATGGACAAG
GCTAAAAACGACATCATCAAGATGGGCGACAGGCTCAAGACTCTAAAGACCATGGAAGAGAAGAAGGCTGCGGCA
CAGGTCAAGTCGTCGATTGTCGAGTTTGACAAGGCTGCCACACAGCTGATTAAGCGAGTCGAGCAAACCATGGTG
GTTCAAGAGCTTGAGTGGCGAAAAGAATATGAGGAGGAAATGTCGCGGGTTCAGCAAAACTATGATGAACGAGTC
AATCTACTGATAGAGCGTGAGCGCCAACTCAACGAGGCCAGGTTGCGGACCGAGCTCATGGCGCAAGCCTTGGCA
CTCAAGAAGGAATTCGTCAAGGAGGTTGAGCAGCGGGTTGAGCAGGAACGCCAAGGCCGCCTCAGCAAGCTCAAG
GAGCTGTCAGCTGCCGTGTCGGAACTGGGGAAGCTGACGGCTGAGTGCAACGAGGTGGTGGATTCCAACCTCAAG
ACTCAGCAGCTGCATGTGGCTGTTGAGGCGGTTCGAGCCAGCCTTGAAGACGCGCAGCATCCGCAGCCCTTTATC
CGCGAGCTAGTGGCACTCAAGGAGATTGCGGCCGACGACCCAGTGGTGAATGCAGCAATTGCTTCAGTCACGCCA
GCGGCCTACCAGCGGGGCATTTCGTCACCGTCGCAGCTCATTGACCGATTCCGCCGAGTAGCAGGCGAGGTGCGC
AAGGCATCACTGTTGCCTGAAGACGCCGGAGTCGCCAGTCACGCATCGAGCTGGATGCTTAGCCACATGCTCTTC
AAGAAGCAGGGCCTTGCCCAGGGCAGCGATGTGGAGAGCATCCTGACGCGCACACAGACATATCTGGAGCAGGGA
AATCTCGACGCTGCTGCCAGAGAGATGAATGGGCTAGATGGGTGGGCCAAGACGCTGAGCAAAGACTGGCTAAGC
GAGGTGCGCAAGGTGTTGGAGGTGCAGCAGGCACTCGATGTAATTGCTACTGAGGCGCGATTGCAGAGCTTGAGG
ATAGACTAG
Transcript >OphauB2|6103
ATGCTGCGCTCATCGCTTCAATCGGCAAAGGTGCTCGGCAGCACGTCCATTGCGGCTGCTGCAGGGCGCCAATTG
CCAATTGCGACGTCGCGGCGATTGGGTGCTAGATCCTATGCCAAGTTTAAGCGCGGCGCTCAAGGCGTGCCAAAG
CCTCCCATCTTGCCCGCGTCGGAGACTCTTAGCTCCGAGAGAGAACCGCCGCCGCTCGACCTCGGCCAGGGCCAG
CCCAAGGGTGTCAAGGACGTGCCTCTTACTCCTCCAACCCCCTCTCAAGTTGACGCTGGCAATGTGCCTCATCCA
TCGACGACAATTGATGACGTGGGCGAGTCCAAGGTGTTCCAAGACGAGCTATCGAGATTCTCGGCTCCGCCCACG
CCCCCTCCCCCGCCTCCGCCTCAGGAGAAGAAGGGCACGTTTCGTCGGCTGCGTAAATTTGTACTGGCATTACTT
CTTGTTGGGGTAGCTGGGTTTGGAGGCGGTGTCTGGTATGCGCGCATCAATGACAACTTTCATGACTTCTTCACC
GAGTATATTCCCTATGGAGAGCGAGCAGTCTTGGCTCTTGAGGAACTGGACTATAGGAAGAGATTTCCTCAGGCT
CAACAACGCGGAACGCTGTCTCATGCCAGCGACCAGCCAGTCAGAATACCTGCGCAGAGTGGTGCTTCTTGGAGG
GTCTCGGACAAGGGAGAATCTGCTGGACGCCATTCCAACGCTTCCCCCTCACGGGAAAGCAAATCGCCGTCATTG
ACTGGAGAGAAGCCGTCGTCGGAGCCCTTGCCTGCAGAGATTGGCGAGCTCAAGACCATGACTGCCGACAGGGTG
CATTCTCAACCTGAAGAGAAGCCCACAAATCCATCTTTCGACTCTTTCAAACCGCCCGAGGTCAATGAGCCATCT
CGTTTTCCGCCTATCAAGTTGATTGATCTCATGGAGCTTCCAGACGCCAATGAGCCCATTGTGCGAGATTTGGTT
CATATGCTCAATGACGTGATTCTCGTCATCAACGCCGACGGGGCCCACGCCAAGTACGCATCAACAATGGACAAG
GCTAAAAACGACATCATCAAGATGGGCGACAGGCTCAAGACTCTAAAGACCATGGAAGAGAAGAAGGCTGCGGCA
CAGGTCAAGTCGTCGATTGTCGAGTTTGACAAGGCTGCCACACAGCTGATTAAGCGAGTCGAGCAAACCATGGTG
GTTCAAGAGCTTGAGTGGCGAAAAGAATATGAGGAGGAAATGTCGCGGGTTCAGCAAAACTATGATGAACGAGTC
AATCTACTGATAGAGCGTGAGCGCCAACTCAACGAGGCCAGGTTGCGGACCGAGCTCATGGCGCAAGCCTTGGCA
CTCAAGAAGGAATTCGTCAAGGAGGTTGAGCAGCGGGTTGAGCAGGAACGCCAAGGCCGCCTCAGCAAGCTCAAG
GAGCTGTCAGCTGCCGTGTCGGAACTGGGGAAGCTGACGGCTGAGTGCAACGAGGTGGTGGATTCCAACCTCAAG
ACTCAGCAGCTGCATGTGGCTGTTGAGGCGGTTCGAGCCAGCCTTGAAGACGCGCAGCATCCGCAGCCCTTTATC
CGCGAGCTAGTGGCACTCAAGGAGATTGCGGCCGACGACCCAGTGGTGAATGCAGCAATTGCTTCAGTCACGCCA
GCGGCCTACCAGCGGGGCATTTCGTCACCGTCGCAGCTCATTGACCGATTCCGCCGAGTAGCAGGCGAGGTGCGC
AAGGCATCACTGTTGCCTGAAGACGCCGGAGTCGCCAGTCACGCATCGAGCTGGATGCTTAGCCACATGCTCTTC
AAGAAGCAGGGCCTTGCCCAGGGCAGCGATGTGGAGAGCATCCTGACGCGCACACAGACATATCTGGAGCAGGGA
AATCTCGACGCTGCTGCCAGAGAGATGAATGGGCTAGATGGGTGGGCCAAGACGCTGAGCAAAGACTGGCTAAGC
GAGGTGCGCAAGGTGTTGGAGGTGCAGCAGGCACTCGATGTAATTGCTACTGAGGCGCGATTGCAGAGCTTGAGG
ATAGACTAG
Gene >OphauB2|6103
ATGCTGCGCTCATCGCTTCAATCGGCAAAGGTGCTCGGCAGCACGTCCATTGCGGCTGCTGCAGGGCGCCAATTG
CCAATTGCGACGTCGCGGCGATTGGGTGCTGTATGTGGACTGCTTGCCTGGCCCCTGTGCTGTCATTGTTGGTAT
TATTATTATTACTTGATGTGTATGCTGATCAGAGTGCCACTTCAACGCAGAGATCCTATGCCAAGTTTAAGCGCG
GCGCTCAAGGCGTGCCAAAGCCTCCCATCTTGCCCGCGTCGGAGACTCTTAGCTCCGAGAGAGAACCGCCGCCGC
TCGACCTCGGCCAGGGCCAGCCCAAGGGTGTCAAGGACGTGCCTCTTACTCCTCCAACCCCCTCTCAAGTTGACG
CTGGCAATGTGCCTCATCCATCGACGACAATTGATGACGTGGGCGAGTCCAAGGTGTTCCAAGACGAGCTATCGA
GATTCTCGGCTCCGCCCACGCCCCCTCCCCCGCCTCCGCCTCAGGAGAAGAAGGGCACGTTTCGTCGGCTGCGTA
AATTTGTACTGGCATTACTTCTTGTTGGGGTAGCTGGGTTTGGAGGCGGTGTCTGGTATGCGCGCATCAATGACA
ACTTTCATGACTTCTTCACCGAGTATATTCCCTATGGAGAGCGAGCAGTCTTGGCTCTTGAGGAACTGGACTATA
GGAAGAGATTTCCTCAGGCTCAACAACGCGGAACGCTGTCTCATGCCAGCGACCAGCCAGTCAGAATACCTGCGC
AGAGTGGTGCTTCTTGGAGGGTCTCGGACAAGGGAGAATCTGCTGGACGCCATTCCAACGCTTCCCCCTCACGGG
AAAGCAAATCGCCGTCATTGACTGGAGAGAAGCCGTCGTCGGAGCCCTTGCCTGCAGAGATTGGCGAGCTCAAGA
CCATGACTGCCGACAGGGTGCATTCTCAACCTGAAGAGAAGCCCACAAATCCATCTTTCGACTCTTTCAAACCGC
CCGAGGTCAATGAGCCATCTCGTTTTCCGCCTATCAAGTTGATTGATCTCATGGAGCTTCCAGACGCCAATGAGC
CCATTGTGCGAGATTTGGTTCATATGCTCAATGACGTGATTCTCGTCATCAACGCCGACGGGGCCCACGCCAAGT
ACGCATCAACAATGGACAAGGCTAAAAACGACATCATCAAGATGGGCGACAGGCTCAAGACTCTAAAGACCATGG
AAGAGAAGAAGGCTGCGGCACAGGTCAAGTCGTCGATTGTCGAGTTTGACAAGGCTGCCACACAGCTGATTAAGC
GAGTCGAGCAAACCATGGTGGTTCAAGAGCTTGAGTGGCGAAAAGAATATGAGGAGGAAATGTCGCGGGTTCAGC
AAAACTATGATGAACGAGTCAATCTACTGATAGAGCGTGAGCGCCAACTCAACGAGGCCAGGTTGCGGACCGAGC
TCATGGCGCAAGCCTTGGCACTCAAGAAGGAATTCGTCAAGGAGGTTGAGCAGCGGGTTGAGCAGGAACGCCAAG
GCCGCCTCAGCAAGCTCAAGGAGCTGTCAGCTGCCGTGTCGGAACTGGGGAAGCTGACGGCTGAGTGCAACGAGG
TGGTGGATTCCAACCTCAAGACTCAGCAGCTGCATGTGGCTGTTGAGGCGGTTCGAGCCAGCCTTGAAGACGCGC
AGCATCCGCAGCCCTTTATCCGCGAGCTAGTGGCACTCAAGGAGATTGCGGCCGACGACCCAGTGGTGAATGCAG
CAATTGCTTCAGTCACGCCAGCGGCCTACCAGCGGGGCATTTCGTCACCGTCGCAGCTCATTGACCGATTCCGCC
GAGTAGCAGGCGAGGTGCGCAAGGCATCACTGTTGCCTGAAGACGCCGGAGTCGCCAGTCACGCATCGAGCTGGA
TGCTTAGCCACATGCTCTTCAAGAAGCAGGGCCTTGCCCAGGGCAGCGATGTGGAGAGCATCCTGACGCGCACAC
AGACATATCTGGAGCAGGGAAATCTCGACGCTGCTGCCAGAGAGATGAATGGGCTAGATGGGTGGGCCAAGACGC
TGAGCAAAGACTGGCTAAGCGAGGTGCGCAAGGTGTTGGAGGTGCAGCAGGCACTCGATGTAAGTCAAGTGAAGC
ACAGTAGTAACACGACTAACAAATCACAATGGCTAACGACTTGGATTCTCCTGGACAGGTAATTGCTACTGAGGC
GCGATTGCAGAGCTTGAGGATAGACTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail