Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|6097
Gene name
LocationContig_52:75411..76777
Strand-
Gene length (bp)1366
Transcript length (bp)1263
Coding sequence length (bp)1263
Protein length (aa) 421

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10568 Tom37 Outer mitochondrial membrane transport complex protein 1.6E-36 20 144
PF17172 GST_N_4 Glutathione S-transferase N-terminal domain 3.9E-08 19 117

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UUA5|MTXL_SCHPO Metaxin-like protein C409.19c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC409.19c PE=3 SV=1 1 281 1.0E-21
sp|Q4VBW0|MTX3_DANRE Metaxin-3 OS=Danio rerio GN=mtx3 PE=2 SV=2 2 264 2.0E-13
sp|P47802|MTX1_MOUSE Metaxin-1 OS=Mus musculus GN=Mtx1 PE=1 SV=1 2 154 4.0E-13
sp|P50110|SAM37_YEAST Sorting assembly machinery 37 kDa subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SAM37 PE=1 SV=1 4 201 4.0E-12
sp|Q4R3I0|MTX1_MACFA Metaxin-1 OS=Macaca fascicularis GN=MTX1 PE=2 SV=1 2 154 5.0E-12
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UUA5|MTXL_SCHPO Metaxin-like protein C409.19c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC409.19c PE=3 SV=1 1 281 1.0E-21
sp|Q4VBW0|MTX3_DANRE Metaxin-3 OS=Danio rerio GN=mtx3 PE=2 SV=2 2 264 2.0E-13
sp|P47802|MTX1_MOUSE Metaxin-1 OS=Mus musculus GN=Mtx1 PE=1 SV=1 2 154 4.0E-13
sp|P50110|SAM37_YEAST Sorting assembly machinery 37 kDa subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SAM37 PE=1 SV=1 4 201 4.0E-12
sp|Q4R3I0|MTX1_MACFA Metaxin-1 OS=Macaca fascicularis GN=MTX1 PE=2 SV=1 2 154 5.0E-12
sp|Q27HK4|MTX1_PIG Metaxin-1 OS=Sus scrofa GN=MTX1 PE=2 SV=1 2 150 5.0E-12
sp|Q2TBS1|MTX1_BOVIN Metaxin-1 OS=Bos taurus GN=MTX1 PE=2 SV=1 2 150 6.0E-12
sp|Q13505|MTX1_HUMAN Metaxin-1 OS=Homo sapiens GN=MTX1 PE=1 SV=2 2 150 1.0E-11
sp|Q3KPT9|MTX3_XENLA Metaxin-3 OS=Xenopus laevis GN=mtx3 PE=2 SV=2 1 150 7.0E-09
sp|Q9VHB6|MTX1_DROME Metaxin-1 homolog OS=Drosophila melanogaster GN=CG9393 PE=2 SV=1 4 285 3.0E-08
sp|Q5HYI7|MTX3_HUMAN Metaxin-3 OS=Homo sapiens GN=MTX3 PE=1 SV=2 2 281 2.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0001401 SAM complex Yes
GO:0032991 protein-containing complex No
GO:0098799 outer mitochondrial membrane protein complex No
GO:0005575 cellular_component No
GO:0098796 membrane protein complex No
GO:0005742 mitochondrial outer membrane translocase complex No
GO:0098798 mitochondrial protein-containing complex No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 23 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|6097
MLDLYVWGQAFDLPSIDIECLAAIHYLHHAASKTAWRLIPSSDVSVSPSGQFPALLHDGTWISGYRQIVDHLTAK
SLCRDLDEHLDAAQRADVVASSAYLLSHAAPLVDLSLFVSAANWAATTRPAYTALLPFPLTWTVPPLLRAQAIER
SEHLGLAALDSDFDPSSALHLTGQSLPESFRRHLPHLSHKSVRGEMTPEQAVAIRLVGLAKERLILLDALMAEAS
PAHEPPRFFAKTPLSSLDCLAYGHLALMLKPPVPRSFLKDCIQSEAPRLAVFVDGLSINVEDLPWASPPPTTILR
LALRFLDSAIRNAPTIGDYYANQLCRDPHSGAGGSRKRVLMHLSGLLAIAAAAGYALYTYRSLQPFGASTQVWRN
QRGGSAMSRLSAMFGASLGLADVTPMPSIGGTGHGRLVDTDSDLD*
Coding >OphauB2|6097
ATGCTCGACCTCTATGTCTGGGGCCAGGCCTTTGACCTGCCCTCGATTGATATCGAATGCCTAGCAGCCATTCAC
TACCTCCACCACGCGGCCTCCAAGACTGCCTGGCGCCTAATCCCGAGTAGTGATGTGTCCGTCAGCCCGTCGGGC
CAATTTCCCGCGCTATTACACGACGGGACCTGGATCAGCGGCTACAGGCAAATCGTGGACCATCTCACTGCAAAG
TCGCTGTGCCGGGACCTTGACGAGCACTTGGATGCGGCGCAGCGTGCAGACGTGGTGGCCTCGTCGGCCTATCTC
TTGTCCCACGCAGCACCCCTCGTCGATCTCTCCCTCTTCGTCTCGGCCGCAAACTGGGCCGCCACGACGCGGCCG
GCCTATACGGCCCTGCTGCCCTTTCCCCTCACTTGGACGGTGCCCCCACTGCTGCGCGCCCAGGCCATTGAGCGC
TCTGAACACCTTGGCCTTGCTGCGCTAGACTCCGACTTTGATCCCAGCAGCGCCTTGCACTTGACGGGCCAGTCT
CTCCCAGAGTCTTTCCGTCGCCATTTGCCGCACCTCAGCCACAAATCGGTGCGCGGAGAAATGACGCCAGAACAG
GCCGTCGCAATTCGCCTCGTTGGCCTCGCAAAGGAACGCCTCATCCTGCTTGATGCCCTCATGGCCGAGGCGTCT
CCTGCTCATGAGCCTCCGCGCTTCTTTGCAAAGACGCCCCTCTCCTCCCTCGACTGCCTGGCATATGGCCATCTT
GCCCTCATGCTCAAGCCCCCCGTGCCCCGCTCCTTTTTAAAGGACTGCATCCAGTCTGAAGCACCGCGGCTGGCA
GTCTTTGTCGATGGCCTGTCCATCAATGTCGAGGACCTGCCCTGGGCAAGCCCGCCGCCTACAACGATCCTTCGA
CTTGCTCTTCGCTTCCTCGACTCGGCCATTCGTAATGCCCCAACTATTGGCGACTACTACGCAAATCAGCTGTGC
CGCGACCCCCATAGTGGTGCTGGAGGCTCTCGCAAAAGAGTCTTGATGCACCTTTCGGGCTTGCTGGCCATCGCT
GCCGCTGCCGGTTATGCCTTGTATACGTATCGGTCCCTGCAGCCGTTTGGCGCCAGTACCCAGGTCTGGAGAAAC
CAGCGAGGAGGCTCGGCAATGAGTCGACTCAGCGCCATGTTTGGCGCTTCCCTAGGCCTTGCTGATGTGACGCCC
ATGCCCTCGATAGGCGGTACAGGCCACGGTCGCCTCGTAGATACTGACTCGGATCTAGATTAG
Transcript >OphauB2|6097
ATGCTCGACCTCTATGTCTGGGGCCAGGCCTTTGACCTGCCCTCGATTGATATCGAATGCCTAGCAGCCATTCAC
TACCTCCACCACGCGGCCTCCAAGACTGCCTGGCGCCTAATCCCGAGTAGTGATGTGTCCGTCAGCCCGTCGGGC
CAATTTCCCGCGCTATTACACGACGGGACCTGGATCAGCGGCTACAGGCAAATCGTGGACCATCTCACTGCAAAG
TCGCTGTGCCGGGACCTTGACGAGCACTTGGATGCGGCGCAGCGTGCAGACGTGGTGGCCTCGTCGGCCTATCTC
TTGTCCCACGCAGCACCCCTCGTCGATCTCTCCCTCTTCGTCTCGGCCGCAAACTGGGCCGCCACGACGCGGCCG
GCCTATACGGCCCTGCTGCCCTTTCCCCTCACTTGGACGGTGCCCCCACTGCTGCGCGCCCAGGCCATTGAGCGC
TCTGAACACCTTGGCCTTGCTGCGCTAGACTCCGACTTTGATCCCAGCAGCGCCTTGCACTTGACGGGCCAGTCT
CTCCCAGAGTCTTTCCGTCGCCATTTGCCGCACCTCAGCCACAAATCGGTGCGCGGAGAAATGACGCCAGAACAG
GCCGTCGCAATTCGCCTCGTTGGCCTCGCAAAGGAACGCCTCATCCTGCTTGATGCCCTCATGGCCGAGGCGTCT
CCTGCTCATGAGCCTCCGCGCTTCTTTGCAAAGACGCCCCTCTCCTCCCTCGACTGCCTGGCATATGGCCATCTT
GCCCTCATGCTCAAGCCCCCCGTGCCCCGCTCCTTTTTAAAGGACTGCATCCAGTCTGAAGCACCGCGGCTGGCA
GTCTTTGTCGATGGCCTGTCCATCAATGTCGAGGACCTGCCCTGGGCAAGCCCGCCGCCTACAACGATCCTTCGA
CTTGCTCTTCGCTTCCTCGACTCGGCCATTCGTAATGCCCCAACTATTGGCGACTACTACGCAAATCAGCTGTGC
CGCGACCCCCATAGTGGTGCTGGAGGCTCTCGCAAAAGAGTCTTGATGCACCTTTCGGGCTTGCTGGCCATCGCT
GCCGCTGCCGGTTATGCCTTGTATACGTATCGGTCCCTGCAGCCGTTTGGCGCCAGTACCCAGGTCTGGAGAAAC
CAGCGAGGAGGCTCGGCAATGAGTCGACTCAGCGCCATGTTTGGCGCTTCCCTAGGCCTTGCTGATGTGACGCCC
ATGCCCTCGATAGGCGGTACAGGCCACGGTCGCCTCGTAGATACTGACTCGGATCTAGATTAG
Gene >OphauB2|6097
ATGCTCGACCTCTATGTCTGGGGCCAGGCCTTTGACCTGCCCTCGATTGATATCGAATGCCTAGCAGCCATTCAC
TACCTCCACCACGCGGCCTCCAAGACTGCCTGGCGCCTAATCCCGAGTAGTGATGTGTCCGTCAGCCCGTCGGGT
AAGTGGTGCCAGCTTTGCCTCTTTTTGTTAAGAAAAAAAAAAAGCCCTTTTAGCCTCGTGCACGTGGCTGATGCA
GCTTTGACTCCTTTGCACACCGGCAGGCCAATTTCCCGCGCTATTACACGACGGGACCTGGATCAGCGGCTACAG
GCAAATCGTGGACCATCTCACTGCAAAGTCGCTGTGCCGGGACCTTGACGAGCACTTGGATGCGGCGCAGCGTGC
AGACGTGGTGGCCTCGTCGGCCTATCTCTTGTCCCACGCAGCACCCCTCGTCGATCTCTCCCTCTTCGTCTCGGC
CGCAAACTGGGCCGCCACGACGCGGCCGGCCTATACGGCCCTGCTGCCCTTTCCCCTCACTTGGACGGTGCCCCC
ACTGCTGCGCGCCCAGGCCATTGAGCGCTCTGAACACCTTGGCCTTGCTGCGCTAGACTCCGACTTTGATCCCAG
CAGCGCCTTGCACTTGACGGGCCAGTCTCTCCCAGAGTCTTTCCGTCGCCATTTGCCGCACCTCAGCCACAAATC
GGTGCGCGGAGAAATGACGCCAGAACAGGCCGTCGCAATTCGCCTCGTTGGCCTCGCAAAGGAACGCCTCATCCT
GCTTGATGCCCTCATGGCCGAGGCGTCTCCTGCTCATGAGCCTCCGCGCTTCTTTGCAAAGACGCCCCTCTCCTC
CCTCGACTGCCTGGCATATGGCCATCTTGCCCTCATGCTCAAGCCCCCCGTGCCCCGCTCCTTTTTAAAGGACTG
CATCCAGTCTGAAGCACCGCGGCTGGCAGTCTTTGTCGATGGCCTGTCCATCAATGTCGAGGACCTGCCCTGGGC
AAGCCCGCCGCCTACAACGATCCTTCGACTTGCTCTTCGCTTCCTCGACTCGGCCATTCGTAATGCCCCAACTAT
TGGCGACTACTACGCAAATCAGCTGTGCCGCGACCCCCATAGTGGTGCTGGAGGCTCTCGCAAAAGAGTCTTGAT
GCACCTTTCGGGCTTGCTGGCCATCGCTGCCGCTGCCGGTTATGCCTTGTATACGTATCGGTCCCTGCAGCCGTT
TGGCGCCAGTACCCAGGTCTGGAGAAACCAGCGAGGAGGCTCGGCAATGAGTCGACTCAGCGCCATGTTTGGCGC
TTCCCTAGGCCTTGCTGATGTGACGCCCATGCCCTCGATAGGCGGTACAGGCCACGGTCGCCTCGTAGATACTGA
CTCGGATCTAGATTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail