Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|6096
Gene name
LocationContig_52:73720..75149
Strand+
Gene length (bp)1429
Transcript length (bp)1272
Coding sequence length (bp)1272
Protein length (aa) 424

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06728 PIG-U GPI transamidase subunit PIG-U 3.0E-122 15 388

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q8K358|PIGU_MOUSE Phosphatidylinositol glycan anchor biosynthesis class U protein OS=Mus musculus GN=Pigu PE=1 SV=4 28 408 9.0E-76
sp|Q9H490|PIGU_HUMAN Phosphatidylinositol glycan anchor biosynthesis class U protein OS=Homo sapiens GN=PIGU PE=1 SV=3 28 408 4.0E-75
sp|Q8CHJ1|PIGU_RAT Phosphatidylinositol glycan anchor biosynthesis class U protein OS=Rattus norvegicus GN=Pigu PE=1 SV=3 28 408 3.0E-74
sp|Q8CHJ0|PIGU_CRIGR Phosphatidylinositol glycan anchor biosynthesis class U protein OS=Cricetulus griseus GN=PIGU PE=1 SV=3 28 408 9.0E-74
sp|P41733|CDC91_YEAST GPI transamidase component GAB1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GAB1 PE=1 SV=1 11 423 4.0E-59
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q8K358|PIGU_MOUSE Phosphatidylinositol glycan anchor biosynthesis class U protein OS=Mus musculus GN=Pigu PE=1 SV=4 28 408 9.0E-76
sp|Q9H490|PIGU_HUMAN Phosphatidylinositol glycan anchor biosynthesis class U protein OS=Homo sapiens GN=PIGU PE=1 SV=3 28 408 4.0E-75
sp|Q8CHJ1|PIGU_RAT Phosphatidylinositol glycan anchor biosynthesis class U protein OS=Rattus norvegicus GN=Pigu PE=1 SV=3 28 408 3.0E-74
sp|Q8CHJ0|PIGU_CRIGR Phosphatidylinositol glycan anchor biosynthesis class U protein OS=Cricetulus griseus GN=PIGU PE=1 SV=3 28 408 9.0E-74
sp|P41733|CDC91_YEAST GPI transamidase component GAB1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GAB1 PE=1 SV=1 11 423 4.0E-59
sp|O13883|PIGU_SCHPO GPI transamidase component GAB1 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1952.01 PE=3 SV=2 24 423 3.0E-56
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 26 0.5

Transmembrane Domains

Domain # Start End Length
1 134 156 22
2 180 202 22
3 223 245 22
4 278 300 22
5 307 326 19
6 349 371 22
7 378 396 18

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|6096
MSPLRRDRAGVYFGAALLRLVLTLAFPGLPNLLTGRVEISTPVTSFKRLQEGLFLYNHNVSPYDGGIFHQAPLLL
PLFSLLPDVRKWPICTSLLYILVDILTADALANIADSGEAGQSKLFASARRAKRASGPIAAAAFLFNPFTVATCI
GRSTSVFTSCAILHAVARAIHGYPLSAMVAISFASYLSMYPLLLLPPLILLAYDRQPAHRSTSCVFRFAARCLGV
AAGCLALLLAMSYFLAGGSFDFLARTYGIQLTLSDLTPNVGLWWYFFIEMFDPFRAFFLAVFWLHLASYVSGLSI
RLRSQPLAVITILLGIFAIFKPYPSISDTSLFLAMMPLYRHVYPLMRYTFIASATILYSSFLGPAFYYLWIYAGS
GNANFFYAITLVWSLGQSLLVSDLTFAVLRDEWEVQRPEMVGKEVKQI*
Coding >OphauB2|6096
ATGTCCCCGCTGCGACGAGATCGAGCAGGCGTCTACTTTGGCGCCGCTCTTTTGCGACTTGTCCTCACTCTTGCC
TTTCCAGGCCTGCCCAATTTGTTGACGGGACGCGTCGAGATTTCCACTCCGGTGACGAGCTTCAAACGCCTCCAA
GAAGGTCTCTTCCTCTACAACCATAATGTGTCGCCATACGACGGCGGCATCTTTCACCAGGCCCCATTACTTCTC
CCTCTCTTCTCCTTGCTGCCAGACGTTAGGAAATGGCCCATATGCACTTCGCTGCTCTATATCCTTGTCGACATC
TTGACTGCCGACGCCCTGGCCAACATTGCCGACTCGGGAGAGGCTGGCCAGTCCAAGCTGTTTGCCTCTGCGCGG
CGAGCTAAGCGTGCCTCGGGGCCTATAGCTGCTGCTGCCTTTCTCTTCAACCCCTTCACCGTGGCAACTTGCATT
GGTCGTTCAACCAGCGTCTTTACGTCGTGCGCAATCCTCCATGCCGTCGCTCGCGCCATTCACGGCTACCCCCTG
AGCGCCATGGTGGCCATCTCTTTCGCCTCGTATCTGTCCATGTACCCCTTGCTGCTGCTGCCGCCGCTCATTCTG
CTGGCCTATGACCGTCAGCCCGCCCACCGCTCCACAAGCTGCGTCTTCCGCTTCGCAGCTAGGTGCCTTGGGGTA
GCAGCCGGCTGTCTCGCCTTACTGCTCGCCATGTCGTACTTCCTGGCCGGGGGCTCATTTGACTTCCTCGCCCGC
ACCTATGGCATCCAGCTGACGCTTTCGGATCTGACACCCAATGTTGGTCTATGGTGGTACTTCTTCATTGAAATG
TTTGACCCCTTTCGCGCCTTTTTCCTCGCTGTCTTTTGGCTGCACCTGGCATCATATGTCTCTGGCCTCTCCATT
CGCCTTCGCTCTCAGCCTCTTGCCGTCATCACCATTCTTCTAGGCATCTTTGCCATTTTTAAGCCATATCCCTCC
ATCTCCGACACAAGTCTCTTCCTCGCCATGATGCCTCTATACCGACACGTCTATCCGCTCATGCGCTACACCTTT
ATTGCATCTGCAACGATTCTCTACTCATCTTTTCTCGGTCCCGCCTTTTACTACCTGTGGATCTACGCTGGCAGC
GGCAACGCAAACTTTTTCTACGCCATTACTCTTGTCTGGAGCTTGGGCCAAAGCCTTCTCGTCTCAGACTTGACG
TTTGCCGTTTTGCGCGACGAGTGGGAAGTACAGCGGCCAGAGATGGTTGGCAAGGAGGTTAAGCAAATCTGA
Transcript >OphauB2|6096
ATGTCCCCGCTGCGACGAGATCGAGCAGGCGTCTACTTTGGCGCCGCTCTTTTGCGACTTGTCCTCACTCTTGCC
TTTCCAGGCCTGCCCAATTTGTTGACGGGACGCGTCGAGATTTCCACTCCGGTGACGAGCTTCAAACGCCTCCAA
GAAGGTCTCTTCCTCTACAACCATAATGTGTCGCCATACGACGGCGGCATCTTTCACCAGGCCCCATTACTTCTC
CCTCTCTTCTCCTTGCTGCCAGACGTTAGGAAATGGCCCATATGCACTTCGCTGCTCTATATCCTTGTCGACATC
TTGACTGCCGACGCCCTGGCCAACATTGCCGACTCGGGAGAGGCTGGCCAGTCCAAGCTGTTTGCCTCTGCGCGG
CGAGCTAAGCGTGCCTCGGGGCCTATAGCTGCTGCTGCCTTTCTCTTCAACCCCTTCACCGTGGCAACTTGCATT
GGTCGTTCAACCAGCGTCTTTACGTCGTGCGCAATCCTCCATGCCGTCGCTCGCGCCATTCACGGCTACCCCCTG
AGCGCCATGGTGGCCATCTCTTTCGCCTCGTATCTGTCCATGTACCCCTTGCTGCTGCTGCCGCCGCTCATTCTG
CTGGCCTATGACCGTCAGCCCGCCCACCGCTCCACAAGCTGCGTCTTCCGCTTCGCAGCTAGGTGCCTTGGGGTA
GCAGCCGGCTGTCTCGCCTTACTGCTCGCCATGTCGTACTTCCTGGCCGGGGGCTCATTTGACTTCCTCGCCCGC
ACCTATGGCATCCAGCTGACGCTTTCGGATCTGACACCCAATGTTGGTCTATGGTGGTACTTCTTCATTGAAATG
TTTGACCCCTTTCGCGCCTTTTTCCTCGCTGTCTTTTGGCTGCACCTGGCATCATATGTCTCTGGCCTCTCCATT
CGCCTTCGCTCTCAGCCTCTTGCCGTCATCACCATTCTTCTAGGCATCTTTGCCATTTTTAAGCCATATCCCTCC
ATCTCCGACACAAGTCTCTTCCTCGCCATGATGCCTCTATACCGACACGTCTATCCGCTCATGCGCTACACCTTT
ATTGCATCTGCAACGATTCTCTACTCATCTTTTCTCGGTCCCGCCTTTTACTACCTGTGGATCTACGCTGGCAGC
GGCAACGCAAACTTTTTCTACGCCATTACTCTTGTCTGGAGCTTGGGCCAAAGCCTTCTCGTCTCAGACTTGACG
TTTGCCGTTTTGCGCGACGAGTGGGAAGTACAGCGGCCAGAGATGGTTGGCAAGGAGGTTAAGCAAATCTGA
Gene >OphauB2|6096
ATGTCCCCGCTGCGACGAGATCGAGCAGGCGTCTACTTTGGCGCCGCTCTTTTGCGACTTGTCCTCACTCTTGCC
TTTCCAGGCCTGCCCAATTTGTTGACGGGACGCGTCGAGATTTCCACTCCGGTGACGAGCTTCAAACGCCGTACG
TCTGCCGCTATACGGCGCGCAGCACTTTTTTTTTTTTGCTCTGCAAATTGTATAAACGGAGCTCTTGCTAACAAC
CATGATGCAGTCCAAGAAGGTCTCTTCCTCTACAACCATAATGTGTCGCCATACGACGGCGGCATCTTTCACCAG
GCCCCATTACTTCTCCCTCTCTTCTCCTTGCTGCCAGACGTTAGGAAATGGCCCATATGCACTTCGCTGCTCTAT
ATCCTTGTCGACATCTTGACTGCCGACGCCCTGGCCAACATTGCCGACTCGGGAGAGGCTGGCCAGTCCAAGCTG
TTTGCCTCTGCGCGGCGAGCTAAGCGTGCCTCGGGGCCTATAGCTGCTGCTGCGTGAGTCGATTCGTCGTCATGC
TGTTTCTGTCCCATGGTCAGAAGCTAATGGTTAATCTTTATTTAGCTTTCTCTTCAACCCCTTCACCGTGGCAAC
TTGCATTGGTCGTTCAACCAGCGTCTTTACGTCGTGCGCAATCCTCCATGCCGTCGCTCGCGCCATTCACGGCTA
CCCCCTGAGCGCCATGGTGGCCATCTCTTTCGCCTCGTATCTGTCCATGTACCCCTTGCTGCTGCTGCCGCCGCT
CATTCTGCTGGCCTATGACCGTCAGCCCGCCCACCGCTCCACAAGCTGCGTCTTCCGCTTCGCAGCTAGGTGCCT
TGGGGTAGCAGCCGGCTGTCTCGCCTTACTGCTCGCCATGTCGTACTTCCTGGCCGGGGGCTCATTTGACTTCCT
CGCCCGCACCTATGGCATCCAGCTGACGCTTTCGGATCTGACACCCAATGTTGGTCTATGGTGGTACTTCTTCAT
TGAAATGTTTGACCCCTTTCGCGCCTTTTTCCTCGCTGTCTTTTGGCTGCACCTGGCATCATATGTCTCTGGCCT
CTCCATTCGCCTTCGCTCTCAGCCTCTTGCCGTCATCACCATTCTTCTAGGCATCTTTGCCATTTTTAAGCCATA
TCCCTCCATCTCCGACACAAGTCTCTTCCTCGCCATGATGCCTCTATACCGACACGTCTATCCGCTCATGCGCTA
CACCTTTATTGCATCTGCAACGATTCTCTACTCATCTTTTCTCGGTCCCGCCTTTTACTACCTGTGGATCTACGC
TGGCAGCGGCAACGCAAACTTTTTCTACGCCATTACTCTTGTCTGGAGCTTGGGCCAAAGCCTTCTCGTCTCAGA
CTTGACGTTTGCCGTTTTGCGCGACGAGTGGGAAGTACAGCGGCCAGAGATGGTTGGCAAGGAGGTTAAGCAAAT
CTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail