Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|6093
Gene name
LocationContig_52:64121..68036
Strand+
Gene length (bp)3915
Transcript length (bp)3414
Coding sequence length (bp)3414
Protein length (aa) 1138

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00225 Kinesin Kinesin motor domain 1.7E-109 128 460
PF16796 Microtub_bd Microtubule binding 1.4E-24 123 272

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P17120|BIMC_EMENI Kinesin-like protein bimC OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=bimC PE=2 SV=2 61 1025 0.0E+00
sp|P24339|CUT7_SCHPO Kinesin-like protein cut7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cut7 PE=3 SV=3 121 634 1.0E-147
sp|Q8J1G4|KIP1_ASHGO Kinesin-like protein KIP1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=KIP1 PE=3 SV=1 77 578 2.0E-144
sp|P28742|KIP1_YEAST Kinesin-like protein KIP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KIP1 PE=1 SV=1 116 537 3.0E-131
sp|B2GU58|KIF11_XENTR Kinesin-like protein KIF11 OS=Xenopus tropicalis GN=kif11 PE=2 SV=1 120 685 4.0E-125
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P17120|BIMC_EMENI Kinesin-like protein bimC OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=bimC PE=2 SV=2 61 1025 0.0E+00
sp|P24339|CUT7_SCHPO Kinesin-like protein cut7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cut7 PE=3 SV=3 121 634 1.0E-147
sp|Q8J1G4|KIP1_ASHGO Kinesin-like protein KIP1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=KIP1 PE=3 SV=1 77 578 2.0E-144
sp|P28742|KIP1_YEAST Kinesin-like protein KIP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KIP1 PE=1 SV=1 116 537 3.0E-131
sp|B2GU58|KIF11_XENTR Kinesin-like protein KIF11 OS=Xenopus tropicalis GN=kif11 PE=2 SV=1 120 685 4.0E-125
sp|Q91783|KI11A_XENLA Kinesin-like protein KIF11-A OS=Xenopus laevis GN=kif11-a PE=1 SV=1 120 682 4.0E-123
sp|Q8J1G7|CIN8_ASHGO Kinesin-like protein CIN8 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=CIN8 PE=3 SV=1 106 792 1.0E-122
sp|P28025|KI11B_XENLA Kinesin-like protein KIF11-B OS=Xenopus laevis GN=kif11-b PE=1 SV=2 120 642 2.0E-122
sp|Q6P9P6|KIF11_MOUSE Kinesin-like protein KIF11 OS=Mus musculus GN=Kif11 PE=1 SV=1 119 645 1.0E-119
sp|P82266|K125_ARATH Probable 125 kDa kinesin-related protein OS=Arabidopsis thaliana GN=At2g36200 PE=2 SV=2 120 701 3.0E-118
sp|P52732|KIF11_HUMAN Kinesin-like protein KIF11 OS=Homo sapiens GN=KIF11 PE=1 SV=2 120 645 1.0E-117
sp|O23826|K125_TOBAC 125 kDa kinesin-related protein OS=Nicotiana tabacum GN=TKRP125 PE=1 SV=1 119 685 5.0E-115
sp|P46863|KL61_DROME Bipolar kinesin KRP-130 OS=Drosophila melanogaster GN=Klp61F PE=1 SV=2 122 682 5.0E-113
sp|P46874|KLP2_BOMMO Kinesin-like protein KLP2 (Fragment) OS=Bombyx mori PE=2 SV=1 112 461 2.0E-103
sp|Q6RZZ9|KIF13_DICDI Kinesin-related protein 13 OS=Dictyostelium discoideum GN=kif13 PE=1 SV=1 169 516 4.0E-86
sp|Q61771|KIF3B_MOUSE Kinesin-like protein KIF3B OS=Mus musculus GN=Kif3b PE=1 SV=1 122 490 4.0E-77
sp|O15066|KIF3B_HUMAN Kinesin-like protein KIF3B OS=Homo sapiens GN=KIF3B PE=1 SV=1 122 490 6.0E-77
sp|P46872|KRP85_STRPU Kinesin-II 85 kDa subunit OS=Strongylocentrotus purpuratus GN=KRP85 PE=1 SV=1 116 490 5.0E-76
sp|Q5R4H3|KIF3A_PONAB Kinesin-like protein KIF3A OS=Pongo abelii GN=KIF3A PE=2 SV=1 122 490 9.0E-76
sp|Q9Y496|KIF3A_HUMAN Kinesin-like protein KIF3A OS=Homo sapiens GN=KIF3A PE=1 SV=4 122 490 1.0E-75
sp|Q4R628|KIF3A_MACFA Kinesin-like protein KIF3A OS=Macaca fascicularis GN=KIF3A PE=2 SV=1 122 490 1.0E-75
sp|P28741|KIF3A_MOUSE Kinesin-like protein KIF3A OS=Mus musculus GN=Kif3a PE=1 SV=2 122 490 6.0E-75
sp|P46871|KRP95_STRPU Kinesin-II 95 kDa subunit OS=Strongylocentrotus purpuratus GN=KRP95 PE=1 SV=1 123 490 1.0E-74
sp|Q99PW8|KIF17_MOUSE Kinesin-like protein KIF17 OS=Mus musculus GN=Kif17 PE=1 SV=1 122 490 3.0E-74
sp|P46873|OSM3_CAEEL Osmotic avoidance abnormal protein 3 OS=Caenorhabditis elegans GN=osm-3 PE=2 SV=4 123 488 2.0E-73
sp|Q9P2E2|KIF17_HUMAN Kinesin-like protein KIF17 OS=Homo sapiens GN=KIF17 PE=2 SV=3 123 495 8.0E-73
sp|P46869|FLA10_CHLRE Kinesin-like protein FLA10 OS=Chlamydomonas reinhardtii GN=FLA10 PE=1 SV=1 122 490 1.0E-71
sp|O14782|KIF3C_HUMAN Kinesin-like protein KIF3C OS=Homo sapiens GN=KIF3C PE=1 SV=3 123 490 4.0E-69
sp|A0JN40|KIF3C_BOVIN Kinesin-like protein KIF3C OS=Bos taurus GN=KIF3C PE=2 SV=1 123 490 1.0E-68
sp|Q5R706|KIF3C_PONAB Kinesin-like protein KIF3C OS=Pongo abelii GN=KIF3C PE=2 SV=1 123 490 2.0E-68
sp|P48467|KINH_NEUCR Kinesin heavy chain OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=kin PE=1 SV=2 117 471 3.0E-68
sp|O35066|KIF3C_MOUSE Kinesin-like protein KIF3C OS=Mus musculus GN=Kif3c PE=1 SV=3 123 490 4.0E-68
sp|Q29DY1|KLP68_DROPS Kinesin-like protein Klp68D OS=Drosophila pseudoobscura pseudoobscura GN=Klp68D PE=3 SV=1 114 496 4.0E-68
sp|O55165|KIF3C_RAT Kinesin-like protein KIF3C OS=Rattus norvegicus GN=Kif3c PE=2 SV=1 123 490 5.0E-68
sp|Q61768|KINH_MOUSE Kinesin-1 heavy chain OS=Mus musculus GN=Kif5b PE=1 SV=3 122 467 3.0E-67
sp|P17210|KINH_DROME Kinesin heavy chain OS=Drosophila melanogaster GN=Khc PE=1 SV=2 123 470 3.0E-67
sp|Q2PQA9|KINH_RAT Kinesin-1 heavy chain OS=Rattus norvegicus GN=Kif5b PE=1 SV=1 122 467 3.0E-67
sp|P46867|KLP68_DROME Kinesin-like protein Klp68D OS=Drosophila melanogaster GN=Klp68D PE=2 SV=2 107 467 4.0E-67
sp|Q6FXI5|CIN8_CANGA Kinesin-like protein CIN8 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=CIN8 PE=3 SV=1 292 530 4.0E-67
sp|P27895|CIN8_YEAST Kinesin-like protein CIN8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CIN8 PE=1 SV=3 296 530 7.0E-67
sp|P33176|KINH_HUMAN Kinesin-1 heavy chain OS=Homo sapiens GN=KIF5B PE=1 SV=1 122 467 9.0E-67
sp|O43093|KINH_SYNRA Kinesin heavy chain OS=Syncephalastrum racemosum PE=2 SV=1 120 491 2.0E-66
sp|Q86ZC1|KINH_BOTFU Kinesin heavy chain OS=Botryotinia fuckeliana GN=klp1 PE=3 SV=1 122 471 7.0E-66
sp|Q8T135|KIF5_DICDI Kinesin-related protein 5 OS=Dictyostelium discoideum GN=kif5 PE=1 SV=1 122 467 5.0E-65
sp|Q86Z98|KINH_GIBMO Kinesin heavy chain OS=Gibberella moniliformis GN=KLP1 PE=3 SV=1 118 471 1.0E-64
sp|P21613|KINH_DORPE Kinesin heavy chain OS=Doryteuthis pealeii PE=2 SV=1 115 486 3.0E-64
sp|L0N7N1|KIF14_MOUSE Kinesin-like protein KIF14 OS=Mus musculus GN=Kif14 PE=1 SV=1 10 488 2.0E-63
sp|P34540|KINH_CAEEL Kinesin heavy chain OS=Caenorhabditis elegans GN=unc-116 PE=2 SV=2 163 467 2.0E-63
sp|P33174|KIF4_MOUSE Chromosome-associated kinesin KIF4 OS=Mus musculus GN=Kif4 PE=1 SV=3 120 467 1.0E-62
sp|Q86VH2|KIF27_HUMAN Kinesin-like protein KIF27 OS=Homo sapiens GN=KIF27 PE=2 SV=1 123 467 2.0E-62
sp|Q6YUL8|BC2_ORYSJ Kinesin-like protein BC2 OS=Oryza sativa subsp. japonica GN=BC2 PE=1 SV=1 164 503 2.0E-62
sp|Q2VIQ3|KIF4B_HUMAN Chromosome-associated kinesin KIF4B OS=Homo sapiens GN=KIF4B PE=2 SV=2 120 467 3.0E-62
sp|Q9US60|KLP3_SCHPO Kinesin-like protein 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=klp3 PE=2 SV=1 121 470 4.0E-62
sp|Q7M6Z4|KIF27_MOUSE Kinesin-like protein KIF27 OS=Mus musculus GN=Kif27 PE=1 SV=1 119 467 5.0E-62
sp|Q27IK7|POK1_ARATH Phragmoplast orienting kinesin-1 OS=Arabidopsis thaliana GN=POK1 PE=1 SV=1 169 467 5.0E-62
sp|P35978|KINH_STRPU Kinesin heavy chain OS=Strongylocentrotus purpuratus PE=2 SV=1 124 491 5.0E-62
sp|O60282|KIF5C_HUMAN Kinesin heavy chain isoform 5C OS=Homo sapiens GN=KIF5C PE=1 SV=1 122 467 7.0E-62
sp|P28738|KIF5C_MOUSE Kinesin heavy chain isoform 5C OS=Mus musculus GN=Kif5c PE=1 SV=3 122 467 9.0E-62
sp|Q7M6Z5|KIF27_RAT Kinesin-like protein KIF27 OS=Rattus norvegicus GN=Kif27 PE=1 SV=1 119 467 1.0E-61
sp|Q90640|KIF4_CHICK Chromosome-associated kinesin KIF4 OS=Gallus gallus GN=KIF4 PE=2 SV=1 126 467 1.0E-61
sp|Q9P2P6|STAR9_HUMAN StAR-related lipid transfer protein 9 OS=Homo sapiens GN=STARD9 PE=1 SV=3 122 524 2.0E-61
sp|O95239|KIF4A_HUMAN Chromosome-associated kinesin KIF4A OS=Homo sapiens GN=KIF4A PE=1 SV=3 120 467 2.0E-61
sp|Q54UC9|KIF3_DICDI Kinesin-related protein 3 OS=Dictyostelium discoideum GN=kif3 PE=1 SV=1 165 503 3.0E-61
sp|Q12840|KIF5A_HUMAN Kinesin heavy chain isoform 5A OS=Homo sapiens GN=KIF5A PE=1 SV=2 124 467 7.0E-61
sp|Q91784|KIF4_XENLA Chromosome-associated kinesin KIF4 OS=Xenopus laevis GN=kif4 PE=2 SV=1 119 467 7.0E-61
sp|Q8GS71|FRA1_ARATH Kinesin-like protein FRA1 OS=Arabidopsis thaliana GN=FRA1 PE=1 SV=1 164 467 8.0E-61
sp|P33175|KIF5A_MOUSE Kinesin heavy chain isoform 5A OS=Mus musculus GN=Kif5a PE=1 SV=3 124 467 8.0E-61
sp|Q5R9K7|KIF5A_PONAB Kinesin heavy chain isoform 5A OS=Pongo abelii GN=KIF5A PE=2 SV=1 124 467 1.0E-60
sp|B1AVY7|KI16B_MOUSE Kinesin-like protein KIF16B OS=Mus musculus GN=Kif16b PE=1 SV=1 122 554 5.0E-60
sp|Q6QLM7|KIF5A_RAT Kinesin heavy chain isoform 5A OS=Rattus norvegicus GN=Kif5a PE=1 SV=1 124 467 5.0E-60
sp|Q96L93|KI16B_HUMAN Kinesin-like protein KIF16B OS=Homo sapiens GN=KIF16B PE=1 SV=2 122 554 7.0E-59
sp|Q2M1P5|KIF7_HUMAN Kinesin-like protein KIF7 OS=Homo sapiens GN=KIF7 PE=1 SV=2 155 467 8.0E-59
sp|B7ZNG0|KIF7_MOUSE Kinesin-like protein KIF7 OS=Mus musculus GN=Kif7 PE=1 SV=1 117 467 1.0E-57
sp|Q54TL0|KIF7_DICDI Kinesin-related protein 7 OS=Dictyostelium discoideum GN=kif7 PE=2 SV=1 121 467 2.0E-57
sp|Q15058|KIF14_HUMAN Kinesin-like protein KIF14 OS=Homo sapiens GN=KIF14 PE=1 SV=1 119 540 3.0E-57
sp|Q9NQT8|KI13B_HUMAN Kinesin-like protein KIF13B OS=Homo sapiens GN=KIF13B PE=1 SV=2 121 490 3.0E-57
sp|Q9NGQ2|KIF1_DICDI Kinesin-related protein 1 OS=Dictyostelium discoideum GN=kif1 PE=1 SV=1 122 505 5.0E-57
sp|Q27IK6|POK2_ARATH Phragmoplast orienting kinesin 2 OS=Arabidopsis thaliana GN=POK2 PE=2 SV=1 169 475 7.0E-57
sp|Q9NS87|KIF15_HUMAN Kinesin-like protein KIF15 OS=Homo sapiens GN=KIF15 PE=1 SV=1 100 490 1.0E-56
sp|Q9LDN0|KN12A_ARATH Kinesin-like protein KIN12A OS=Arabidopsis thaliana GN=KIN12A PE=1 SV=1 143 489 4.0E-56
sp|Q9H1H9|KI13A_HUMAN Kinesin-like protein KIF13A OS=Homo sapiens GN=KIF13A PE=1 SV=2 121 490 8.0E-56
sp|Q9GYZ0|KIF15_STRPU Kinesin-like protein KIF15 OS=Strongylocentrotus purpuratus GN=KIF15 PE=1 SV=1 117 467 1.0E-55
sp|Q60575|KIF1B_MOUSE Kinesin-like protein KIF1B OS=Mus musculus GN=Kif1b PE=1 SV=2 120 492 2.0E-55
sp|Q9EQW7|KI13A_MOUSE Kinesin-like protein KIF13A OS=Mus musculus GN=Kif13a PE=1 SV=1 121 490 2.0E-55
sp|O60333|KIF1B_HUMAN Kinesin-like protein KIF1B OS=Homo sapiens GN=KIF1B PE=1 SV=5 120 492 2.0E-55
sp|Q498L9|KI15B_XENLA Kinesin-like protein KIF15-B OS=Xenopus laevis GN=kif15-b PE=1 SV=1 167 490 2.0E-55
sp|Q8L7Y8|KN12B_ARATH Kinesin-like protein KIN12B OS=Arabidopsis thaliana GN=KIN12B PE=1 SV=1 143 479 2.0E-55
sp|Q6RT24|CENPE_MOUSE Centromere-associated protein E OS=Mus musculus GN=Cenpe PE=1 SV=1 118 476 3.0E-55
sp|Q91785|KI15A_XENLA Kinesin-like protein KIF15-A OS=Xenopus laevis GN=kif15-a PE=1 SV=1 167 667 4.0E-55
sp|Q6P9L6|KIF15_MOUSE Kinesin-like protein KIF15 OS=Mus musculus GN=Kif15 PE=1 SV=1 167 490 4.0E-55
sp|Q7Z4S6|KI21A_HUMAN Kinesin-like protein KIF21A OS=Homo sapiens GN=KIF21A PE=1 SV=2 166 518 6.0E-55
sp|Q7TSP2|KIF15_RAT Kinesin-like protein KIF15 OS=Rattus norvegicus GN=Kif15 PE=2 SV=1 167 490 7.0E-55
sp|O35071|KIF1C_MOUSE Kinesin-like protein KIF1C OS=Mus musculus GN=Kif1c PE=1 SV=2 120 492 9.0E-55
sp|Q86Y91|KI18B_HUMAN Kinesin-like protein KIF18B OS=Homo sapiens GN=KIF18B PE=1 SV=3 117 500 1.0E-54
sp|O88658|KIF1B_RAT Kinesin-like protein KIF1B OS=Rattus norvegicus GN=Kif1b PE=1 SV=2 120 492 1.0E-54
sp|Q54NP8|KIF4_DICDI Kinesin-related protein 4 OS=Dictyostelium discoideum GN=kif4 PE=2 SV=1 119 499 1.0E-54
sp|O43896|KIF1C_HUMAN Kinesin-like protein KIF1C OS=Homo sapiens GN=KIF1C PE=1 SV=3 120 492 2.0E-54
sp|Q9QXL2|KI21A_MOUSE Kinesin-like protein KIF21A OS=Mus musculus GN=Kif21a PE=1 SV=2 166 518 2.0E-54
sp|Q80TF6|STAR9_MOUSE StAR-related lipid transfer protein 9 OS=Mus musculus GN=Stard9 PE=1 SV=2 122 491 1.0E-53
sp|Q6S001|KIF11_DICDI Kinesin-related protein 11 OS=Dictyostelium discoideum GN=kif11 PE=3 SV=1 158 527 2.0E-53
sp|Q9QXL1|KI21B_MOUSE Kinesin-like protein KIF21B OS=Mus musculus GN=Kif21b PE=1 SV=2 166 467 2.0E-53
sp|Q91WD7|KI18A_MOUSE Kinesin-like protein KIF18A OS=Mus musculus GN=Kif18a PE=2 SV=1 169 514 3.0E-53
sp|Q0DV28|ARK1_ORYSJ Armadillo repeat-containing kinesin-like protein 1 OS=Oryza sativa subsp. japonica GN=Os03g0152900 PE=2 SV=2 113 490 4.0E-53
sp|O75037|KI21B_HUMAN Kinesin-like protein KIF21B OS=Homo sapiens GN=KIF21B PE=1 SV=2 166 467 5.0E-53
sp|O35787|KIF1C_RAT Kinesin-like protein KIF1C OS=Rattus norvegicus GN=Kif1c PE=1 SV=1 120 492 1.0E-52
sp|Q58G59|KIF7_DANRE Kinesin-like protein kif7 OS=Danio rerio GN=kif7 PE=1 SV=1 165 467 1.0E-52
sp|Q9BVG8|KIFC3_HUMAN Kinesin-like protein KIFC3 OS=Homo sapiens GN=KIFC3 PE=1 SV=4 168 481 2.0E-52
sp|Q4KLL9|KI18B_RAT Kinesin-like protein KIF18B OS=Rattus norvegicus GN=Kif18b PE=2 SV=1 168 500 2.0E-52
sp|Q8NI77|KI18A_HUMAN Kinesin-like protein KIF18A OS=Homo sapiens GN=KIF18A PE=1 SV=2 169 598 3.0E-52
sp|F9W301|KPSS1_ORYSJ Kinesin-1-like protein PSS1 OS=Oryza sativa subsp. japonica GN=PSS1 PE=1 SV=1 169 468 3.0E-52
sp|Q9SV36|ARK1_ARATH Armadillo repeat-containing kinesin-like protein 1 OS=Arabidopsis thaliana GN=ARK1 PE=1 SV=2 157 490 4.0E-52
sp|Q5ZLK6|KI18B_CHICK Kinesin-like protein KIF18B OS=Gallus gallus GN=KIF18B PE=2 SV=1 169 490 4.0E-52
sp|Q12756|KIF1A_HUMAN Kinesin-like protein KIF1A OS=Homo sapiens GN=KIF1A PE=1 SV=2 120 492 6.0E-52
sp|P33173|KIF1A_MOUSE Kinesin-like protein KIF1A OS=Mus musculus GN=Kif1a PE=1 SV=2 120 492 7.0E-52
sp|Q02224|CENPE_HUMAN Centromere-associated protein E OS=Homo sapiens GN=CENPE PE=1 SV=2 117 469 8.0E-52
sp|Q6ZMV9|KIF6_HUMAN Kinesin-like protein KIF6 OS=Homo sapiens GN=KIF6 PE=1 SV=3 169 490 2.0E-51
sp|Q6PFD6|KI18B_MOUSE Kinesin-like protein KIF18B OS=Mus musculus GN=Kif18b PE=2 SV=2 168 500 2.0E-51
sp|Q99PT9|KIF19_MOUSE Kinesin-like protein KIF19 OS=Mus musculus GN=Kif19 PE=1 SV=2 167 490 2.0E-51
sp|Q28WQ1|KIF1A_DROPS Kinesin-like protein unc-104 OS=Drosophila pseudoobscura pseudoobscura GN=unc-104 PE=3 SV=1 121 492 3.0E-51
sp|A1ZAJ2|KIF1A_DROME Kinesin-like protein unc-104 OS=Drosophila melanogaster GN=unc-104 PE=1 SV=1 121 492 4.0E-51
sp|Q6P3R1|KIF22_XENTR Kinesin-like protein KIF22 OS=Xenopus tropicalis GN=kif22 PE=2 SV=1 123 464 4.0E-51
sp|P46865|KINL_LEICH Kinesin-like protein K39 (Fragment) OS=Leishmania chagasi GN=KIN PE=2 SV=1 158 467 5.0E-51
sp|O35231|KIFC3_MOUSE Kinesin-like protein KIFC3 OS=Mus musculus GN=Kifc3 PE=1 SV=4 168 481 5.0E-51
sp|Q2TAC6|KIF19_HUMAN Kinesin-like protein KIF19 OS=Homo sapiens GN=KIF19 PE=2 SV=2 167 490 6.0E-51
sp|D3YXS5|KIF28_MOUSE Kinesin-like protein KIF28P OS=Mus musculus GN=Kif28p PE=3 SV=1 122 467 6.0E-51
sp|O14343|KLP5_SCHPO Kinesin-like protein 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=klp5 PE=1 SV=1 169 467 7.0E-51
sp|Q8S905|NACK1_ARATH Kinesin-like protein NACK1 OS=Arabidopsis thaliana GN=NACK1 PE=1 SV=1 114 489 8.0E-51
sp|P23678|UN104_CAEEL Kinesin-like protein unc-104 OS=Caenorhabditis elegans GN=unc-104 PE=2 SV=4 121 467 9.0E-51
sp|F8WLE0|KIF28_RAT Kinesin-like protein KIF28P OS=Rattus norvegicus GN=Kif28p PE=2 SV=1 122 470 1.0E-50
sp|Q7ZXX2|KIF19_XENLA Kinesin-like protein KIF19 OS=Xenopus laevis GN=kif19 PE=2 SV=1 118 568 1.0E-50
sp|Q9BPU3|KIF2_DICDI Kinesin-related protein 2 OS=Dictyostelium discoideum GN=kif2 PE=2 SV=1 150 454 1.0E-50
sp|Q9FZ06|ARK3_ARATH Armadillo repeat-containing kinesin-like protein 3 OS=Arabidopsis thaliana GN=ARK3 PE=1 SV=1 123 466 1.0E-50
sp|O81635|ATK4_ARATH Kinesin-4 OS=Arabidopsis thaliana GN=ATK4 PE=1 SV=2 122 460 2.0E-50
sp|A8WFU8|KIF22_DANRE Kinesin-like protein KIF22 OS=Danio rerio GN=kif22 PE=2 SV=1 112 466 4.0E-50
sp|Q17BU3|KIF1A_AEDAE Kinesin-like protein unc-104 OS=Aedes aegypti GN=unc-104 PE=3 SV=1 121 492 5.0E-50
sp|Q7ZYL5|KF22B_XENLA Kinesin-like protein KIF22-B OS=Xenopus laevis GN=kif22-b PE=2 SV=2 123 464 1.0E-49
sp|Q9FHN8|KCBP_ARATH Kinesin-like calmodulin-binding protein OS=Arabidopsis thaliana GN=KCBP PE=1 SV=1 123 464 2.0E-49
sp|Q9I869|KF22A_XENLA Kinesin-like protein KIF22-A OS=Xenopus laevis GN=kif22-a PE=1 SV=1 123 464 2.0E-49
sp|Q9LPC6|ARK2_ARATH Armadillo repeat-containing kinesin-like protein 2 OS=Arabidopsis thaliana GN=ARK2 PE=1 SV=2 123 466 2.0E-49
sp|Q7PHR1|KIF1A_ANOGA Kinesin-like protein unc-104 OS=Anopheles gambiae GN=unc-104 PE=3 SV=3 121 492 3.0E-49
sp|Q96FN5|KIF12_HUMAN Kinesin-like protein KIF12 OS=Homo sapiens GN=KIF12 PE=1 SV=3 109 591 6.0E-49
sp|Q8S950|NACK1_TOBAC Kinesin-like protein NACK1 OS=Nicotiana tabacum GN=NACK1 PE=1 SV=1 123 490 6.0E-49
sp|P28739|KLPA_EMENI Kinesin-like protein klpA OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=klpA PE=2 SV=3 122 459 1.0E-48
sp|O59751|KLP6_SCHPO Kinesin-like protein 6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=klp6 PE=1 SV=1 169 461 2.0E-48
sp|P79955|CTK2_XENLA Carboxy-terminal kinesin 2 OS=Xenopus laevis PE=2 SV=1 169 454 3.0E-48
sp|Q8W1Y3|KP1_ARATH Kinesin KP1 OS=Arabidopsis thaliana GN=KP1 PE=1 SV=2 167 460 3.0E-48
sp|Q3V300|KIF22_MOUSE Kinesin-like protein KIF22 OS=Mus musculus GN=Kif22 PE=2 SV=2 123 467 3.0E-48
sp|Q9US03|KLP2_SCHPO Kinesin-like protein 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=klp2 PE=3 SV=1 124 459 4.0E-48
sp|P53086|KIP3_YEAST Kinesin-like protein KIP3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KIP3 PE=1 SV=1 169 461 4.0E-48
sp|Q9D2Z8|KIF12_MOUSE Kinesin-like protein KIF12 OS=Mus musculus GN=Kif12 PE=1 SV=1 109 465 7.0E-48
sp|Q5VQ09|ARK2_ORYSJ Armadillo repeat-containing kinesin-like protein 2 OS=Oryza sativa subsp. japonica GN=Os06g0137100 PE=2 SV=1 121 516 7.0E-48
sp|Q8S949|NACK2_TOBAC Kinesin-like protein NACK2 OS=Nicotiana tabacum GN=NACK2 PE=1 SV=1 169 490 2.0E-47
sp|A6QPL4|KIF22_BOVIN Kinesin-like protein KIF22 OS=Bos taurus GN=KIF22 PE=2 SV=2 123 467 2.0E-47
sp|P20480|NCD_DROME Protein claret segregational OS=Drosophila melanogaster GN=ncd PE=1 SV=1 124 454 2.0E-47
sp|Q5I0E8|KIF22_RAT Kinesin-like protein KIF22 OS=Rattus norvegicus GN=Kif22 PE=2 SV=1 169 467 3.0E-47
sp|Q14807|KIF22_HUMAN Kinesin-like protein KIF22 OS=Homo sapiens GN=KIF22 PE=1 SV=5 169 467 1.0E-46
sp|P45962|KLP3_CAEEL Kinesin-like protein klp-3 OS=Caenorhabditis elegans GN=klp-3 PE=1 SV=1 122 454 2.0E-46
sp|Q5REP4|KIF22_PONAB Kinesin-like protein KIF22 OS=Pongo abelii GN=KIF22 PE=2 SV=1 169 475 3.0E-46
sp|P46864|ATK2_ARATH Kinesin-2 OS=Arabidopsis thaliana GN=ATK2 PE=2 SV=1 124 457 4.0E-46
sp|P46870|KLP1_CHLRE Kinesin-like protein KLP1 OS=Chlamydomonas reinhardtii GN=KLP1 PE=2 SV=1 168 490 5.0E-46
sp|Q9HAQ2|KIF9_HUMAN Kinesin-like protein KIF9 OS=Homo sapiens GN=KIF9 PE=1 SV=4 179 577 2.0E-45
sp|Q92376|KLP1_SCHPO Kinesin-like protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=klp1 PE=2 SV=2 150 461 4.0E-45
sp|Q6S002|KIF10_DICDI Kinesin-related protein 10 OS=Dictyostelium discoideum GN=kif10 PE=3 SV=1 169 477 5.0E-45
sp|Q1MTQ1|TEA2_SCHPO Kinesin-like protein tea2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tea2 PE=1 SV=1 169 465 5.0E-45
sp|P46875|ATK3_ARATH Kinesin-3 OS=Arabidopsis thaliana GN=ATK3 PE=2 SV=1 169 472 9.0E-45
sp|B7ZC32|KIF28_HUMAN Kinesin-like protein KIF28P OS=Homo sapiens GN=KIF28P PE=3 SV=2 167 486 1.0E-44
sp|F4JGP4|ATK5_ARATH Kinesin-5 OS=Arabidopsis thaliana GN=ATK5 PE=2 SV=1 169 457 2.0E-44
sp|Q7XPJ0|KCBP_ORYSJ Kinesin-like calmodulin-binding protein homolog OS=Oryza sativa subsp. japonica GN=Os04g0666900 PE=2 SV=1 166 462 2.0E-44
sp|Q8LNZ2|NACK2_ARATH Kinesin-like protein NACK2 OS=Arabidopsis thaliana GN=NACK2 PE=1 SV=1 169 490 2.0E-44
sp|Q9WV04|KIF9_MOUSE Kinesin-like protein KIF9 OS=Mus musculus GN=Kif9 PE=1 SV=2 179 490 5.0E-44
sp|Q5XI63|KIFC1_RAT Kinesin-like protein KIFC1 OS=Rattus norvegicus GN=Kifc1 PE=2 SV=1 122 454 6.0E-44
sp|Q07970|ATK1_ARATH Kinesin-1 OS=Arabidopsis thaliana GN=ATK1 PE=2 SV=1 122 457 9.0E-44
sp|Q9BW19|KIFC1_HUMAN Kinesin-like protein KIFC1 OS=Homo sapiens GN=KIFC1 PE=1 SV=2 169 454 1.0E-43
sp|Q60443|KIFC1_CRIGR Kinesin-like protein KIFC1 OS=Cricetulus griseus PE=2 SV=1 169 454 2.0E-43
sp|Q9QWT9|KIFC1_MOUSE Kinesin-like protein KIFC1 OS=Mus musculus GN=Kifc1 PE=1 SV=2 122 454 3.0E-43
sp|Q96AC6|KIFC2_HUMAN Kinesin-like protein KIFC2 OS=Homo sapiens GN=KIFC2 PE=2 SV=1 129 437 5.0E-43
sp|Q960Z0|KI10A_DROME Kinesin-like protein Klp10A OS=Drosophila melanogaster GN=Klp10A PE=1 SV=1 164 468 3.0E-42
sp|Q9W1U4|KI59C_DROME Kinesin-like protein Klp59C OS=Drosophila melanogaster GN=Klp59C PE=3 SV=1 164 467 1.0E-41
sp|Q99661|KIF2C_HUMAN Kinesin-like protein KIF2C OS=Homo sapiens GN=KIF2C PE=1 SV=2 164 460 2.0E-41
sp|Q95LP1|KIF2C_MACFA Kinesin-like protein KIF2C OS=Macaca fascicularis GN=KIF2C PE=2 SV=1 164 460 2.0E-41
sp|O08672|KIFC2_MOUSE Kinesin-like protein KIFC2 OS=Mus musculus GN=Kifc2 PE=1 SV=1 98 460 2.0E-41
sp|Q9UIL4|KIF25_HUMAN Kinesin-like protein KIF25 OS=Homo sapiens GN=KIF25 PE=2 SV=2 173 464 2.0E-41
sp|P17119|KAR3_YEAST Kinesin-like protein KAR3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KAR3 PE=1 SV=1 124 461 3.0E-41
sp|Q95LT1|KIF2B_MACFA Kinesin-like protein KIF2B OS=Macaca fascicularis GN=KIF2B PE=2 SV=1 123 460 3.0E-41
sp|Q8N4N8|KIF2B_HUMAN Kinesin-like protein KIF2B OS=Homo sapiens GN=KIF2B PE=1 SV=3 123 460 4.0E-41
sp|P27895|CIN8_YEAST Kinesin-like protein CIN8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CIN8 PE=1 SV=3 118 284 6.0E-41
sp|Q6FXI5|CIN8_CANGA Kinesin-like protein CIN8 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=CIN8 PE=3 SV=1 117 284 3.0E-40
sp|Q922S8|KIF2C_MOUSE Kinesin-like protein KIF2C OS=Mus musculus GN=Kif2c PE=1 SV=1 164 515 3.0E-40
sp|Q8C0N1|KIF2B_MOUSE Kinesin-like protein KIF2B OS=Mus musculus GN=Kif2b PE=1 SV=1 119 460 6.0E-40
sp|Q5XI51|KIF2B_RAT Kinesin-like protein KIF2B OS=Rattus norvegicus GN=Kif2b PE=2 SV=2 119 460 1.0E-39
sp|P28740|KIF2A_MOUSE Kinesin-like protein KIF2A OS=Mus musculus GN=Kif2a PE=1 SV=2 123 471 2.0E-39
sp|Q5ZKV8|KIF2A_CHICK Kinesin-like protein KIF2A OS=Gallus gallus GN=KIF2A PE=2 SV=2 123 460 2.0E-39
sp|Q9FKP4|KCA2_ARATH Kinesin-like protein KCA2 OS=Arabidopsis thaliana GN=KCA2 PE=1 SV=1 124 495 3.0E-39
sp|P70096|KIF2C_CRIGR Kinesin-like protein KIF2C OS=Cricetulus griseus GN=KIF2C PE=1 SV=2 164 460 3.0E-39
sp|O00139|KIF2A_HUMAN Kinesin-like protein KIF2A OS=Homo sapiens GN=KIF2A PE=1 SV=3 123 471 3.0E-39
sp|P18105|NOD_DROME Kinesin-like protein Nod OS=Drosophila melanogaster GN=nod PE=1 SV=1 169 469 5.0E-39
sp|Q5R9Y9|KIF2A_PONAB Kinesin-like protein KIF2A OS=Pongo abelii GN=KIF2A PE=2 SV=1 123 469 6.0E-39
sp|Q91637|KIF2A_XENLA Kinesin-like protein KIF2A OS=Xenopus laevis GN=kif2a PE=1 SV=2 123 460 6.0E-39
sp|Q9WV63|KIF2A_RAT Kinesin-like protein KIF2A OS=Rattus norvegicus GN=Kif2a PE=1 SV=2 123 471 7.0E-39
sp|Q62909|KIF2C_RAT Kinesin-like protein KIF2C OS=Rattus norvegicus GN=Kif2c PE=2 SV=3 164 460 9.0E-39
sp|P28743|KIP2_YEAST Kinesin-like protein KIP2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KIP2 PE=1 SV=1 169 460 2.0E-38
sp|Q2NL05|KIF2A_BOVIN Kinesin-like protein KIF2A OS=Bos taurus GN=KIF2A PE=2 SV=1 123 471 2.0E-38
sp|Q555I8|KIF9_DICDI Kinesin-related protein 9 OS=Dictyostelium discoideum GN=kif9 PE=2 SV=1 169 464 3.0E-38
sp|Q6NWW5|KIF24_MOUSE Kinesin-like protein KIF24 OS=Mus musculus GN=Kif24 PE=1 SV=2 108 461 4.0E-38
sp|Q8J1G1|KIP2_ASHGO Kinesin-like protein KIP2 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=KIP2 PE=3 SV=1 169 460 5.0E-38
sp|Q5T7B8|KIF24_HUMAN Kinesin-like protein KIF24 OS=Homo sapiens GN=KIF24 PE=1 SV=2 115 461 8.0E-38
sp|Q91636|KIF2C_XENLA Kinesin-like protein KIF2C OS=Xenopus laevis GN=kif2c PE=1 SV=2 164 460 9.0E-38
sp|Q9LX99|KCA1_ARATH Kinesin-like protein KCA1 OS=Arabidopsis thaliana GN=KCA1 PE=1 SV=1 124 459 1.0E-37
sp|A6H750|KIF2B_BOVIN Kinesin-like protein KIF2B OS=Bos taurus GN=KIF2B PE=2 SV=1 114 460 1.0E-37
sp|Q39493|DSK1_CYLFU Diatom spindle kinesin-1 OS=Cylindrotheca fusiformis GN=DSK1 PE=2 SV=1 117 461 3.0E-36
sp|Q6S004|KIF6_DICDI Kinesin-related protein 6 OS=Dictyostelium discoideum GN=kif6 PE=2 SV=1 115 460 4.0E-35
sp|P56536|KIF5C_RAT Kinesin heavy chain isoform 5C (Fragment) OS=Rattus norvegicus GN=Kif5c PE=1 SV=2 122 373 5.0E-35
sp|E9Q5G3|KIF23_MOUSE Kinesin-like protein KIF23 OS=Mus musculus GN=Kif23 PE=1 SV=1 169 454 4.0E-34
sp|Q940B8|KIN13_ARATH Kinesin-13A OS=Arabidopsis thaliana GN=KINESIN-13A PE=1 SV=1 123 470 2.0E-33
sp|Q9V877|SUB_DROME Kinesin-like protein subito OS=Drosophila melanogaster GN=sub PE=1 SV=1 167 460 4.0E-32
sp|Q6S003|KIF8_DICDI Kinesin-related protein 8 OS=Dictyostelium discoideum GN=kif8 PE=2 SV=1 123 343 1.0E-29
sp|Q6S003|KIF8_DICDI Kinesin-related protein 8 OS=Dictyostelium discoideum GN=kif8 PE=2 SV=1 362 467 4.0E-26
sp|Q02241|KIF23_HUMAN Kinesin-like protein KIF23 OS=Homo sapiens GN=KIF23 PE=1 SV=3 169 454 1.0E-25
sp|Q80WE4|KI20B_MOUSE Kinesin-like protein KIF20B OS=Mus musculus GN=Kif20b PE=1 SV=3 247 460 2.0E-25
sp|Q96Q89|KI20B_HUMAN Kinesin-like protein KIF20B OS=Homo sapiens GN=KIF20B PE=1 SV=3 259 460 5.0E-24
sp|Q52KG5|KI26A_MOUSE Kinesin-like protein KIF26A OS=Mus musculus GN=Kif26a PE=1 SV=2 167 461 2.0E-23
sp|Q9UTL2|KLP8_SCHPO Kinesin-like protein 8 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=klp8 PE=1 SV=1 122 467 6.0E-23
sp|Q6S000|KIF12_DICDI Kinesin-related protein 12 OS=Dictyostelium discoideum GN=kif12 PE=3 SV=1 256 470 2.0E-21
sp|Q1MTQ7|KLP9_SCHPO Kinesin-like motor protein 9 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=klp9 PE=1 SV=2 170 464 2.0E-21
sp|O95235|KI20A_HUMAN Kinesin-like protein KIF20A OS=Homo sapiens GN=KIF20A PE=1 SV=1 251 667 4.0E-21
sp|Q29RT6|KI20A_BOVIN Kinesin-like protein KIF20A OS=Bos taurus GN=KIF20A PE=2 SV=1 256 466 4.0E-21
sp|Q7TNC6|KI26B_MOUSE Kinesin-like protein KIF26B OS=Mus musculus GN=Kif26b PE=1 SV=3 167 456 7.0E-21
sp|Q2KJY2|KI26B_HUMAN Kinesin-like protein KIF26B OS=Homo sapiens GN=KIF26B PE=2 SV=1 162 456 8.0E-21
sp|P97329|KI20A_MOUSE Kinesin-like protein KIF20A OS=Mus musculus GN=Kif20a PE=2 SV=1 256 467 2.0E-20
sp|O16844|COS_DROME Kinesin-like protein costa OS=Drosophila melanogaster GN=cos PE=1 SV=2 179 467 2.0E-20
sp|Q9ULI4|KI26A_HUMAN Kinesin-like protein KIF26A OS=Homo sapiens GN=KIF26A PE=2 SV=3 161 461 3.0E-19
sp|Q292S8|COS_DROPS Kinesin-like protein costa OS=Drosophila pseudoobscura pseudoobscura GN=cos PE=3 SV=2 181 467 4.0E-19
sp|P32364|SMY1_YEAST Kinesin-related protein SMY1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SMY1 PE=1 SV=1 165 462 3.0E-18
sp|Q96Q89|KI20B_HUMAN Kinesin-like protein KIF20B OS=Homo sapiens GN=KIF20B PE=1 SV=3 139 248 1.0E-09
sp|Q80WE4|KI20B_MOUSE Kinesin-like protein KIF20B OS=Mus musculus GN=Kif20b PE=1 SV=3 139 248 2.0E-09
sp|Q6S000|KIF12_DICDI Kinesin-related protein 12 OS=Dictyostelium discoideum GN=kif12 PE=3 SV=1 127 257 5.0E-09
sp|Q29RT6|KI20A_BOVIN Kinesin-like protein KIF20A OS=Bos taurus GN=KIF20A PE=2 SV=1 169 248 7.0E-09
sp|P97329|KI20A_MOUSE Kinesin-like protein KIF20A OS=Mus musculus GN=Kif20a PE=2 SV=1 169 248 1.0E-08
sp|O95235|KI20A_HUMAN Kinesin-like protein KIF20A OS=Homo sapiens GN=KIF20A PE=1 SV=1 169 248 3.0E-08
[Show less]

GO

GO Term Description Terminal node
GO:0008017 microtubule binding Yes
GO:0003777 microtubule motor activity Yes
GO:0005524 ATP binding Yes
GO:0007018 microtubule-based movement Yes
GO:0032555 purine ribonucleotide binding No
GO:0008150 biological_process No
GO:0005488 binding No
GO:0003774 cytoskeletal motor activity No
GO:0003674 molecular_function No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0000166 nucleotide binding No
GO:0043167 ion binding No
GO:0032553 ribonucleotide binding No
GO:0097367 carbohydrate derivative binding No
GO:0017076 purine nucleotide binding No
GO:0097159 organic cyclic compound binding No
GO:1901265 nucleoside phosphate binding No
GO:0008092 cytoskeletal protein binding No
GO:1901363 heterocyclic compound binding No
GO:0032559 adenyl ribonucleotide binding No
GO:0036094 small molecule binding No
GO:0009987 cellular process No
GO:0007017 microtubule-based process No
GO:0005515 protein binding No
GO:0140657 ATP-dependent activity No
GO:0030554 adenyl nucleotide binding No
GO:0043168 anion binding No
GO:0015631 tubulin binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup146
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4387
Ophiocordyceps australis 1348a (Ghana) OphauG2|5166
Ophiocordyceps australis map64 (Brazil) OphauB2|6091
Ophiocordyceps australis map64 (Brazil) OphauB2|6092
Ophiocordyceps australis map64 (Brazil) OphauB2|6093 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|87
Ophiocordyceps camponoti-floridani Ophcf2|02677
Ophiocordyceps camponoti-rufipedis Ophun1|4371
Ophiocordyceps kimflemingae Ophio5|2062
Ophiocordyceps kimflemingae Ophio5|4888
Ophiocordyceps kimflemingae Ophio5|8395
Ophiocordyceps subramaniannii Hirsu2|5226
Ophiocordyceps subramaniannii Hirsu2|9012

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|6093
MGEEETACFHILVSSHTAPKDKNHILSPRSNHFTTATLAFQRPRTRSKREPSTVASERQRVPSRASSTRTPSLRV
PLSRKASRSAERSAAASPDAAAAVVALGTKRKTRDFDEGDAASEGTNINVVVRCRGRNERETRDNSAVVVRTEGV
KGKLVELSMGANALSNKTYSFDRVYSPVADQNMVFDDTVKPILDEVLAGYNCTIFAYGQTGTGKTYTMSGDMTET
LGMLSDNAGIIPRVLNQLFNKLKLENTDSCIKCSFIELYNEELRDLLAVEENGRLKIYDDTSRKGHSSTIVQGME
EKFIKNASQGIKVLQEGSLKRQVAATKCNDLSSRSHTIFTITACVAKTNEDGGEELVCAGKLNLVDLAGSENIQR
SGAENKRATEAGLINKSLLTLGRVINALVDHSEHIPYRESKLTRLLQDSLGGHTKTCIIATISPAKDNLEETIST
LQYAFRAKNIRNMPQVNPLLNKGVFMSELGSENDRLKSELIATRQRNGVYLSNDAYEEMMAQSESRRIVMEELTA
KMETFERNLQNKTQEMFCLTTSLMELRREHEVTTREHEATKSRLEDANGIIDKQQAVLTDTEAALEAQTRRREAH
QETEEKLAETGQELIGKLKGAVQDIGGLHAKNKRKSHLESVNRAAWSASQAQVAEVTAMVERQLVEMRDEQLGHV
ERVSRRIKSFELEQFVGAKKQLVEQHGLSRADVDEVLDGVVSEAADKVAAEIASEMGHFSTKLHDSYGCLGEKFK
GIVEHLVQDIGRQRREIDGLRQQVQTAKGKAKMQSTKLAAGLQESVNERCRMADNEHQKVAAVVGQLTQLLNAQN
EARKATYYEQGAWQQRAAGEALAGVEASLMELEGGVEALDEGEGKLLQQVHKSRHEFDSGLREAWAAAREQSSAL
QQTTQQVQAERVRVVAEQAEQLDADMAMLGHCVAQARSEAAGQQAAQGQALEALAGRVEAALGGMAARFGGAFER
ARLLGDEPRLCYPLATLRSGIAAAGMQDYEPTGQTPARRLWTYPATLPRTLAPDDDAINNGDTKANNGDDTRTNN
GDDDDTKANNVNNNNNDDDNSDDNDGQASSSSSSPPCPSLRQILVSHATTPTPTKARAAAPGLENMVPSTPRVFE
RGARRPKSPRLV*
Coding >OphauB2|6093
ATGGGCGAGGAGGAGACTGCGTGTTTCCACATACTCGTGTCCTCGCATACTGCACCCAAAGATAAAAACCACATC
CTCAGCCCGCGGAGTAATCATTTTACAACCGCCACGCTGGCTTTCCAACGACCCCGGACGCGCTCCAAACGGGAG
CCGTCCACAGTGGCAAGCGAACGGCAGCGGGTGCCCAGCCGAGCCAGCTCGACGCGGACGCCATCGTTGCGCGTG
CCCTTGTCACGCAAGGCGTCGAGAAGCGCAGAGCGGTCGGCGGCGGCTTCTCCCGACGCGGCGGCGGCGGTGGTG
GCGCTGGGGACCAAGCGCAAAACGCGCGACTTTGACGAGGGCGATGCGGCGAGTGAGGGCACCAATATTAACGTG
GTGGTGCGATGTCGCGGCCGCAATGAGCGCGAGACTCGCGATAATAGCGCCGTGGTGGTGCGGACCGAGGGCGTC
AAGGGCAAGTTGGTGGAGTTGTCCATGGGGGCGAATGCTTTGAGCAACAAGACGTATAGCTTTGACCGCGTCTAC
TCGCCCGTTGCGGACCAGAATATGGTGTTTGACGACACGGTGAAGCCCATTCTTGACGAGGTGCTTGCCGGGTAC
AACTGCACCATTTTTGCCTATGGACAAACGGGCACGGGCAAAACCTACACCATGTCGGGGGACATGACGGAGACG
CTGGGCATGCTCTCAGATAACGCCGGCATTATCCCCCGGGTCCTCAACCAGCTCTTCAACAAGCTCAAGCTGGAA
AACACAGACAGCTGCATCAAGTGCTCCTTTATCGAGCTTTACAATGAGGAGCTGCGCGACTTGCTTGCAGTCGAG
GAGAATGGGCGGCTCAAGATTTACGACGACACGTCGCGCAAGGGCCACAGCTCCACCATTGTGCAGGGCATGGAG
GAAAAGTTTATCAAGAATGCATCGCAGGGCATCAAGGTGCTGCAAGAGGGCAGTTTGAAGCGGCAGGTTGCGGCA
ACCAAGTGCAACGACTTGAGCTCGCGCAGCCACACCATCTTTACCATTACGGCATGCGTGGCCAAGACGAATGAG
GATGGCGGCGAAGAGCTCGTCTGCGCCGGCAAGCTCAATCTGGTCGACTTGGCGGGCAGCGAAAACATTCAGCGG
TCTGGAGCGGAGAATAAGCGAGCCACCGAGGCGGGACTCATCAACAAGTCGCTGCTGACGCTGGGGCGCGTCATC
AATGCGCTTGTGGACCACAGCGAGCACATTCCATATCGCGAGTCGAAGCTGACGCGGTTGCTGCAAGACTCGCTG
GGCGGGCACACCAAGACGTGCATCATTGCCACGATTTCACCAGCCAAGGACAACTTGGAAGAGACGATTTCGACT
CTGCAGTATGCCTTTAGGGCCAAGAATATTCGCAACATGCCGCAAGTGAATCCCCTGCTCAACAAGGGGGTGTTT
ATGAGCGAGCTTGGCAGCGAGAATGACCGGCTCAAGAGCGAGCTGATTGCGACGCGGCAGCGCAACGGCGTCTAC
CTGTCCAACGACGCGTACGAGGAGATGATGGCGCAGAGCGAGTCTCGGAGAATAGTCATGGAGGAGCTGACGGCC
AAGATGGAGACGTTTGAGCGCAACCTGCAAAACAAGACGCAGGAAATGTTTTGCCTCACCACGTCGCTCATGGAG
CTGAGGCGGGAGCACGAGGTGACGACGAGGGAGCACGAGGCTACAAAGAGTCGGCTGGAGGATGCCAATGGCATC
ATTGACAAGCAGCAGGCCGTCTTGACTGATACAGAGGCGGCGCTCGAGGCGCAGACGCGACGGCGGGAAGCGCAC
CAAGAGACGGAAGAGAAGCTGGCGGAGACGGGCCAGGAGCTCATTGGCAAGCTCAAGGGCGCGGTGCAGGACATT
GGGGGCCTGCATGCCAAGAATAAGCGCAAGTCGCATCTCGAGTCGGTCAACCGGGCGGCGTGGAGCGCGTCTCAG
GCGCAAGTGGCCGAGGTGACGGCCATGGTGGAGCGGCAGCTTGTGGAGATGCGCGACGAGCAGCTGGGCCACGTG
GAGAGGGTGTCGCGGCGCATCAAGAGCTTTGAGCTGGAGCAGTTTGTGGGCGCCAAGAAGCAGCTGGTGGAGCAG
CATGGGCTGTCGCGGGCCGACGTGGACGAGGTGCTGGACGGCGTAGTCTCGGAGGCGGCGGACAAGGTGGCGGCG
GAGATTGCGAGCGAAATGGGCCACTTTTCCACCAAGCTTCACGACTCGTATGGGTGTCTGGGAGAAAAGTTCAAG
GGCATTGTGGAGCATCTGGTGCAAGACATTGGTCGACAGCGCAGGGAGATTGATGGGCTGCGGCAGCAAGTGCAG
ACGGCCAAGGGCAAGGCCAAGATGCAGAGCACCAAGCTCGCGGCTGGGCTACAGGAGAGTGTCAATGAGCGCTGC
CGGATGGCGGACAATGAGCACCAAAAGGTGGCGGCAGTGGTGGGACAGCTGACACAGCTGCTCAATGCGCAAAAC
GAGGCGCGCAAGGCGACGTATTACGAGCAAGGCGCGTGGCAGCAGCGGGCGGCGGGAGAAGCATTGGCGGGGGTG
GAGGCGAGTCTCATGGAGCTCGAGGGCGGGGTGGAGGCGCTGGACGAGGGCGAGGGCAAGCTGCTGCAGCAGGTG
CACAAGTCGCGGCACGAGTTTGACAGCGGGCTGCGCGAGGCGTGGGCGGCGGCGCGGGAGCAGAGCAGCGCGCTG
CAGCAAACGACGCAGCAGGTGCAGGCGGAGCGGGTGCGCGTGGTGGCGGAGCAGGCTGAGCAGCTGGATGCCGAC
ATGGCGATGCTCGGCCACTGTGTGGCGCAGGCGCGCAGCGAGGCGGCGGGGCAGCAGGCGGCGCAGGGGCAGGCG
CTGGAGGCGCTGGCGGGCAGGGTGGAGGCGGCGCTGGGCGGCATGGCGGCGCGCTTTGGCGGTGCGTTTGAGCGC
GCCAGACTGCTGGGCGACGAGCCGAGGCTGTGCTATCCGCTGGCCACGCTGCGGAGCGGAATCGCGGCGGCGGGC
ATGCAAGACTATGAGCCGACGGGCCAGACGCCGGCAAGAAGGCTTTGGACGTATCCCGCCACGCTGCCGCGCACG
CTGGCTCCCGACGACGACGCCATTAACAATGGCGACACCAAAGCCAACAATGGCGACGACACTAGAACCAACAAT
GGCGACGACGACGACACTAAAGCCAACAATGTCAACAACAACAACAACGACGACGACAACAGCGACGACAACGAC
GGGCAAGCAAGCAGCAGCAGCAGCAGTCCGCCGTGCCCCAGTCTCCGCCAAATTCTAGTCTCCCATGCCACCACG
CCCACGCCCACAAAGGCGCGCGCAGCAGCCCCGGGGCTGGAAAACATGGTGCCCAGCACGCCACGTGTATTTGAG
CGTGGTGCGAGGAGACCAAAGAGCCCGAGACTTGTTTAA
Transcript >OphauB2|6093
ATGGGCGAGGAGGAGACTGCGTGTTTCCACATACTCGTGTCCTCGCATACTGCACCCAAAGATAAAAACCACATC
CTCAGCCCGCGGAGTAATCATTTTACAACCGCCACGCTGGCTTTCCAACGACCCCGGACGCGCTCCAAACGGGAG
CCGTCCACAGTGGCAAGCGAACGGCAGCGGGTGCCCAGCCGAGCCAGCTCGACGCGGACGCCATCGTTGCGCGTG
CCCTTGTCACGCAAGGCGTCGAGAAGCGCAGAGCGGTCGGCGGCGGCTTCTCCCGACGCGGCGGCGGCGGTGGTG
GCGCTGGGGACCAAGCGCAAAACGCGCGACTTTGACGAGGGCGATGCGGCGAGTGAGGGCACCAATATTAACGTG
GTGGTGCGATGTCGCGGCCGCAATGAGCGCGAGACTCGCGATAATAGCGCCGTGGTGGTGCGGACCGAGGGCGTC
AAGGGCAAGTTGGTGGAGTTGTCCATGGGGGCGAATGCTTTGAGCAACAAGACGTATAGCTTTGACCGCGTCTAC
TCGCCCGTTGCGGACCAGAATATGGTGTTTGACGACACGGTGAAGCCCATTCTTGACGAGGTGCTTGCCGGGTAC
AACTGCACCATTTTTGCCTATGGACAAACGGGCACGGGCAAAACCTACACCATGTCGGGGGACATGACGGAGACG
CTGGGCATGCTCTCAGATAACGCCGGCATTATCCCCCGGGTCCTCAACCAGCTCTTCAACAAGCTCAAGCTGGAA
AACACAGACAGCTGCATCAAGTGCTCCTTTATCGAGCTTTACAATGAGGAGCTGCGCGACTTGCTTGCAGTCGAG
GAGAATGGGCGGCTCAAGATTTACGACGACACGTCGCGCAAGGGCCACAGCTCCACCATTGTGCAGGGCATGGAG
GAAAAGTTTATCAAGAATGCATCGCAGGGCATCAAGGTGCTGCAAGAGGGCAGTTTGAAGCGGCAGGTTGCGGCA
ACCAAGTGCAACGACTTGAGCTCGCGCAGCCACACCATCTTTACCATTACGGCATGCGTGGCCAAGACGAATGAG
GATGGCGGCGAAGAGCTCGTCTGCGCCGGCAAGCTCAATCTGGTCGACTTGGCGGGCAGCGAAAACATTCAGCGG
TCTGGAGCGGAGAATAAGCGAGCCACCGAGGCGGGACTCATCAACAAGTCGCTGCTGACGCTGGGGCGCGTCATC
AATGCGCTTGTGGACCACAGCGAGCACATTCCATATCGCGAGTCGAAGCTGACGCGGTTGCTGCAAGACTCGCTG
GGCGGGCACACCAAGACGTGCATCATTGCCACGATTTCACCAGCCAAGGACAACTTGGAAGAGACGATTTCGACT
CTGCAGTATGCCTTTAGGGCCAAGAATATTCGCAACATGCCGCAAGTGAATCCCCTGCTCAACAAGGGGGTGTTT
ATGAGCGAGCTTGGCAGCGAGAATGACCGGCTCAAGAGCGAGCTGATTGCGACGCGGCAGCGCAACGGCGTCTAC
CTGTCCAACGACGCGTACGAGGAGATGATGGCGCAGAGCGAGTCTCGGAGAATAGTCATGGAGGAGCTGACGGCC
AAGATGGAGACGTTTGAGCGCAACCTGCAAAACAAGACGCAGGAAATGTTTTGCCTCACCACGTCGCTCATGGAG
CTGAGGCGGGAGCACGAGGTGACGACGAGGGAGCACGAGGCTACAAAGAGTCGGCTGGAGGATGCCAATGGCATC
ATTGACAAGCAGCAGGCCGTCTTGACTGATACAGAGGCGGCGCTCGAGGCGCAGACGCGACGGCGGGAAGCGCAC
CAAGAGACGGAAGAGAAGCTGGCGGAGACGGGCCAGGAGCTCATTGGCAAGCTCAAGGGCGCGGTGCAGGACATT
GGGGGCCTGCATGCCAAGAATAAGCGCAAGTCGCATCTCGAGTCGGTCAACCGGGCGGCGTGGAGCGCGTCTCAG
GCGCAAGTGGCCGAGGTGACGGCCATGGTGGAGCGGCAGCTTGTGGAGATGCGCGACGAGCAGCTGGGCCACGTG
GAGAGGGTGTCGCGGCGCATCAAGAGCTTTGAGCTGGAGCAGTTTGTGGGCGCCAAGAAGCAGCTGGTGGAGCAG
CATGGGCTGTCGCGGGCCGACGTGGACGAGGTGCTGGACGGCGTAGTCTCGGAGGCGGCGGACAAGGTGGCGGCG
GAGATTGCGAGCGAAATGGGCCACTTTTCCACCAAGCTTCACGACTCGTATGGGTGTCTGGGAGAAAAGTTCAAG
GGCATTGTGGAGCATCTGGTGCAAGACATTGGTCGACAGCGCAGGGAGATTGATGGGCTGCGGCAGCAAGTGCAG
ACGGCCAAGGGCAAGGCCAAGATGCAGAGCACCAAGCTCGCGGCTGGGCTACAGGAGAGTGTCAATGAGCGCTGC
CGGATGGCGGACAATGAGCACCAAAAGGTGGCGGCAGTGGTGGGACAGCTGACACAGCTGCTCAATGCGCAAAAC
GAGGCGCGCAAGGCGACGTATTACGAGCAAGGCGCGTGGCAGCAGCGGGCGGCGGGAGAAGCATTGGCGGGGGTG
GAGGCGAGTCTCATGGAGCTCGAGGGCGGGGTGGAGGCGCTGGACGAGGGCGAGGGCAAGCTGCTGCAGCAGGTG
CACAAGTCGCGGCACGAGTTTGACAGCGGGCTGCGCGAGGCGTGGGCGGCGGCGCGGGAGCAGAGCAGCGCGCTG
CAGCAAACGACGCAGCAGGTGCAGGCGGAGCGGGTGCGCGTGGTGGCGGAGCAGGCTGAGCAGCTGGATGCCGAC
ATGGCGATGCTCGGCCACTGTGTGGCGCAGGCGCGCAGCGAGGCGGCGGGGCAGCAGGCGGCGCAGGGGCAGGCG
CTGGAGGCGCTGGCGGGCAGGGTGGAGGCGGCGCTGGGCGGCATGGCGGCGCGCTTTGGCGGTGCGTTTGAGCGC
GCCAGACTGCTGGGCGACGAGCCGAGGCTGTGCTATCCGCTGGCCACGCTGCGGAGCGGAATCGCGGCGGCGGGC
ATGCAAGACTATGAGCCGACGGGCCAGACGCCGGCAAGAAGGCTTTGGACGTATCCCGCCACGCTGCCGCGCACG
CTGGCTCCCGACGACGACGCCATTAACAATGGCGACACCAAAGCCAACAATGGCGACGACACTAGAACCAACAAT
GGCGACGACGACGACACTAAAGCCAACAATGTCAACAACAACAACAACGACGACGACAACAGCGACGACAACGAC
GGGCAAGCAAGCAGCAGCAGCAGCAGTCCGCCGTGCCCCAGTCTCCGCCAAATTCTAGTCTCCCATGCCACCACG
CCCACGCCCACAAAGGCGCGCGCAGCAGCCCCGGGGCTGGAAAACATGGTGCCCAGCACGCCACGTGTATTTGAG
CGTGGTGCGAGGAGACCAAAGAGCCCGAGACTTGTTTAA
Gene >OphauB2|6093
ATGGGCGAGGAGGAGACTGCGTGTTTCCACATACTCGTGTCCTCGCATACTGCACCCAAAGATAAAAACCACATC
CTCAGGTATAGTAAAAGGACCAAGACAGAACCAAGGGCACGCCCAAGGAGAAGAAAAAGAAAAAAAACAGCCCGC
GGAGTAATCATTTTACAACCGCCACGCTGGCTTTCCAACGACCCCGGACGCGCTCCAAACGGGAGCCGTCCACAG
TGGCAAGCGAACGGCAGCGGGTGCCCAGCCGAGCCAGCTCGACGCGGACGCCATCGTTGCGCGTGCCCTTGTCAC
GCAAGGCGTCGAGAAGCGCAGAGCGGTCGGCGGCGGCTTCTCCCGACGCGGCGGCGGCGGTGGTGGCGCTGGGGA
CCAAGCGCAAAACGCGCGACTTTGACGAGGGCGATGCGGCGAGTGAGGGCACCAATATTAACGTGGTGGTGCGAT
GTCGCGGCCGCAATGAGCGCGAGACTCGCGATAATAGCGCCGTGGTGGTGCGGACCGAGGGCGTCAAGGGCAAGT
TGGTGGAGTTGTCCATGGGGGCGAATGCTTTGAGCAACAAGACGTATAGCTTTGACCGCGTCTACTCGCCCGTTG
CGGACCAGAATATGGTGTTTGACGACACGGTGAAGCCCATTCTTGACGAGGTTGGTTTTTATTTTTTTATTTTTT
ATTTTTATTTTTTTGACTTGCTGCCATGTTTTTGATGCTGGTGGCCTTTGGCATCGACCAAGAGGGCAAAGGACA
AGGGCTAACCGAGATTTGGCTCTTTTTACTCTAGGTGCTTGCCGGGTACAACTGCACCATTTTTGCCTATGGACA
AACGGGCACGGGCAAAACCTACACCATGTCGGGGGACATGACGGAGACGCTGGGCATGCTCTCAGATAACGCCGG
CATTATCCCCCGGGTCCTCAACCAGCTCTTCAACAAGCTCAAGCTGGAAAACACAGACAGCTGCATCAAGTGCTC
CTTTATCGAGCTTTACAATGAGGAGCTGCGCGACTTGCTTGCAGTCGAGGAGAATGGGCGGCTCAAGATTTACGA
CGACACGTCGCGCAAGGGCCACAGCTCCACCATTGTGCAGGGCATGGAGGAAAAGTTTATCAAGAATGCATCGCA
GGGCATCAAGGTGCTGCAAGAGGGCAGTTTGAAGCGGCAGGTTGCGGCAACCAAGTGCAACGACTTGAGCTCGCG
CAGCCACACCATCTTTACCATTACGGCATGCGTGGCCAAGACGAATGAGGATGGCGGCGAAGAGCTCGTCTGCGC
CGGCAAGCTCAATCTGGTCGACTTGGCGGGCAGCGAAAACATTCAGCGGTCTGGAGCGGAGAATAAGCGAGCCAC
CGAGGCGGGACTCATCAACAAGTCGCTGCTGACGCTGGGGCGCGTCATCAATGCGCTTGTGGACCACAGCGAGCA
CATTCCATATCGCGAGTCGAAGCTGACGCGGTTGCTGCAAGACTCGCTGGGCGGGCACACCAAGACGTGCATCAT
TGCCACGATTTCACCAGCCAAGGACAACTTGGAAGAGACGATTTCGACTCTGCAGTATGCCTTTAGGGCCAAGAA
TATTCGCAACATGCCGCAAGTGAATCCCCTGCTCAACAAGGGGGTGTTTATGAGCGAGCTTGGCAGCGAGAATGA
CCGGCTCAAGAGCGAGCTGATTGCGACGCGGCAGCGCAACGGCGTCTACCTGTCCAACGACGCGTACGAGGAGAT
GATGGCGCAGAGCGAGTCTCGGAGAATAGTCATGGAGGAGCTGACGGCCAAGATGGAGACGTTTGAGCGCAACCT
GCAAAACAAGACGCAGGAAATGTTTTGCCTCACCACGTCGCTCATGGAGCTGAGGCGGGAGCACGAGGTGACGAC
GAGGGAGCACGAGGCTACAAAGAGTCGGCTGGAGGATGCCAATGGCATCATTGACAAGCAGCAGGCCGTCTTGAC
TGATACAGAGGCGGCGCTCGAGGCGCAGACGCGACGGCGGGAAGCGCACCAAGAGACGGAAGAGAAGCTGGCGGA
GACGGGCCAGGAGCTCATTGGCAAGCTCAAGGGCGCGGTGCAGGACATTGGGGGCCTGCATGCCAAGAATAAGCG
CAAGTCGCATCTCGAGTCGGTCAACCGGGCGGCGTGGAGCGCGTCTCAGGCGCAAGTGGCCGAGGTGACGGCCAT
GGTGGAGCGGCAGCTTGTGGAGATGCGCGACGAGCAGCTGGGCCACGTGGAGAGGGTGTCGCGGCGCATCAAGAG
CTTTGTGGACACGGAGCTGGGCAATCTCTGGGCCACGCAAGAGCTTGTGGGGCAGGAGCTGGAGCAGTTTGTGGG
CGCCAAGAAGCAGCTGGTGGAGCAGCATGGGCTGTCGCGGGCCGACGTGGACGAGGTGCTGGACGGCGTCGGGGC
CATGGCTGGCAGTGTCAAGGACAAGGTTGGCCTGGGCTTGCAGGTAGTCTCGGAGGCGGCGGACAAGGTGGCGGC
GGAGATTGCGAGCGAAATGGGCCACTTTTCCACCAAGGTGAGTTTTGAGAGCACCTTTGGGTGTTGTAACCATTA
CTACTGGATCAATGGGTGGGGGGCTAACGCTTTGGCAAATGATAGCTTCACGACTCGTATGGGTGTCTGGGAGAA
AAGTTCAAGGGCATTGTGGAGCATCTGGTGCAAGACATTGGTCGACAGCGCAGGGAGATTGATGGGCTGCGGCAG
CAAGTGCAGACGGCCAAGGGCAAGGCCAAGATGCAGAGCACCAAGCTCGCGGCTGGGCTACAGGAGAGTGTCAAT
GAGCGCTGCCGGATGGCGGACAATGAGCACCAAAAGGTGGCGGCAGTGGTGGGACAGCTGACACAGCTGCTCAAT
GCGCAAAACGAGGCGCGCAAGGCGACGTATTACGAGCAAGGCGCGTGGCAGCAGCGGGCGGCGGGAGAAGCATTG
GCGGGGGTGGAGGCGAGTCTCATGGAGCTCGAGGGCGGGGTGGAGGCGCTGGACGAGGGCGAGGGCAAGCTGCTG
CAGCAGGTGCACAAGTCGCGGCACGAGTTTGACAGCGGGCTGCGCGAGGCGTGGGCGGCGGCGCGGGAGCAGAGC
AGCGCGCTGCAGCAAACGACGCAGCAGGTGCAGGCGGAGCGGGTGCGCGTGGTGGCGGAGCAGGCTGAGCAGCTG
GATGCCGACATGGCGATGCTCGGCCACTGTGTGGCGCAGGCGCGCAGCGAGGCGGCGGGGCAGCAGGCGGCGCAG
GGGCAGGCGCTGGAGGCGCTGGCGGGCAGGGTGGAGGCGGCGCTGGGCGGCATGGCGGCGCGCTTTGGCGGTGCG
TTTGAGCGCGCCAGACTGCTGGGCGACGAGGTGTGTGGCGGTGTGGCGGGGGCGGCGGATGCGCTGCAGCGCGTG
GAGCCGAGGCTGTGCTATCCGCTGGCCACGCTGCGGAGCGGAATCGCGGCGGCGGGCATGCAAGACTATGAGCCG
ACGGGCCAGACGCCGGCAAGAAGGCTTTGGACGTATCCCGCCACGCTGCCGCGCACGCTGGCTCCCGACGACGAC
GCCATTAACAATGGCGACACCAAAGCCAACAATGGCGACGACACTAGAACCAACAATGGCGACGACGACGACACT
AAAGCCAACAATGTCAACAACAACAACAACGACGACGACAACAGCGACGACAACGACGGGCAAGCAAGCAGCAGC
AGCAGCAGTCCGCCGTGCCCCAGTCTCCGCCAAGTTTGTCCCAACCTCCTCCCCTCCACCTCGTCCACAGTCTTG
AGCGCGTGCACTTCATCGCCGCCGCAGATTCTAGTCTCCCATGCCACCACGCCCACGCCCACAAAGGCGCGCGCA
GCAGCCCCGGGGCTGGAAAACATGGTGCCCAGCACGCCACGTGTATTTGAGCGTGGTGCGAGGAGACCAAAGAGC
CCGAGACTTGTTTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail