Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|6082
Gene name
LocationContig_52:20200..20939
Strand-
Gene length (bp)739
Transcript length (bp)669
Coding sequence length (bp)669
Protein length (aa) 223

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O59768|VCX1_SCHPO Vacuolar calcium ion transporter OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=vcx1 PE=3 SV=1 103 220 1.0E-14
sp|Q99385|VCX1_YEAST Vacuolar calcium ion transporter OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VCX1 PE=1 SV=1 150 220 5.0E-12
sp|Q8L783|CAX5_ARATH Vacuolar cation/proton exchanger 5 OS=Arabidopsis thaliana GN=CAX5 PE=2 SV=1 139 220 9.0E-09
sp|Q5KQN0|CAX2_ORYSJ Vacuolar cation/proton exchanger 2 OS=Oryza sativa subsp. japonica GN=CAX2 PE=2 SV=2 144 220 2.0E-08
sp|Q39254|CAX2_ARATH Vacuolar cation/proton exchanger 2 OS=Arabidopsis thaliana GN=CAX2 PE=1 SV=2 83 220 2.0E-08
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O59768|VCX1_SCHPO Vacuolar calcium ion transporter OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=vcx1 PE=3 SV=1 103 220 1.0E-14
sp|Q99385|VCX1_YEAST Vacuolar calcium ion transporter OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VCX1 PE=1 SV=1 150 220 5.0E-12
sp|Q8L783|CAX5_ARATH Vacuolar cation/proton exchanger 5 OS=Arabidopsis thaliana GN=CAX5 PE=2 SV=1 139 220 9.0E-09
sp|Q5KQN0|CAX2_ORYSJ Vacuolar cation/proton exchanger 2 OS=Oryza sativa subsp. japonica GN=CAX2 PE=2 SV=2 144 220 2.0E-08
sp|Q39254|CAX2_ARATH Vacuolar cation/proton exchanger 2 OS=Arabidopsis thaliana GN=CAX2 PE=1 SV=2 83 220 2.0E-08
sp|Q9LFZ8|CAX6_ARATH Putative vacuolar cation/proton exchanger 6 OS=Arabidopsis thaliana GN=CAX6 PE=3 SV=3 139 220 2.0E-08
sp|Q6K1C4|CAX3_ORYSJ Vacuolar cation/proton exchanger 3 OS=Oryza sativa subsp. japonica GN=CAX3 PE=2 SV=2 133 220 1.0E-07
sp|Q75XW3|CAX_APHHA Ca(2+)/H(+) antiporter OS=Aphanothece halophytica PE=1 SV=1 153 220 3.0E-07
sp|P74072|CAX_SYNY3 Ca(2+)/H(+) antiporter OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=slr1336 PE=1 SV=1 152 220 4.0E-07
sp|O34840|CHAA_BACSU Ca(2+)/H(+) antiporter ChaA OS=Bacillus subtilis (strain 168) GN=chaA PE=1 SV=1 173 220 2.0E-06
sp|Q769E5|CAX1A_ORYSJ Vacuolar cation/proton exchanger 1a OS=Oryza sativa subsp. japonica GN=CAX1a PE=1 SV=1 128 220 9.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 16 0.45

Transmembrane Domains

Domain # Start End Length
1 141 163 22
2 168 190 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|6082
MKKTHSDPPDIERKRPGAIARLHGAFRHSTPDVSSLPTVEEPPTAVVANTTSNASSNVTALPVILDEKELATNGS
TPFDQAFAANLAATSSLSQERQGSVVEANTTNEETTIDGSNANHDNATATAKAKKRGFVAELRRTFWMVITYSWL
NVLLVFVPIGIAVANIHGINGGIVFAMNCIAVIPLAGLLSHATESVAYNMGDSLGALLNVTFGNAVELIIFM*
Coding >OphauB2|6082
ATGAAGAAAACCCATTCCGATCCCCCAGATATAGAACGCAAACGCCCCGGTGCAATCGCCAGGCTTCATGGAGCC
TTTCGTCACTCGACTCCCGACGTGTCTTCTTTGCCTACGGTAGAGGAGCCGCCCACTGCCGTTGTTGCCAACACG
ACGAGCAATGCCAGCAGCAATGTTACTGCTCTGCCCGTTATTCTCGATGAAAAGGAACTGGCTACTAATGGATCT
ACTCCATTTGACCAAGCCTTTGCTGCCAATCTTGCCGCCACGTCGAGTCTGTCCCAGGAGAGGCAGGGGTCTGTC
GTAGAAGCCAACACCACCAACGAGGAAACTACTATTGACGGCTCCAACGCCAACCACGACAATGCCACTGCCACT
GCCAAGGCCAAGAAGCGCGGCTTCGTTGCCGAGTTACGTAGGACCTTTTGGATGGTCATAACTTACAGCTGGCTC
AACGTCTTGCTCGTCTTTGTCCCCATTGGCATCGCCGTCGCAAACATTCACGGCATCAATGGCGGCATTGTCTTT
GCCATGAATTGTATTGCCGTGATTCCTCTTGCTGGCCTTCTTAGCCATGCGACTGAGTCAGTGGCGTATAACATG
GGCGATTCTCTGGGCGCTCTGCTCAATGTCACCTTTGGCAATGCTGTTGAACTCATCATCTTCATGTAA
Transcript >OphauB2|6082
ATGAAGAAAACCCATTCCGATCCCCCAGATATAGAACGCAAACGCCCCGGTGCAATCGCCAGGCTTCATGGAGCC
TTTCGTCACTCGACTCCCGACGTGTCTTCTTTGCCTACGGTAGAGGAGCCGCCCACTGCCGTTGTTGCCAACACG
ACGAGCAATGCCAGCAGCAATGTTACTGCTCTGCCCGTTATTCTCGATGAAAAGGAACTGGCTACTAATGGATCT
ACTCCATTTGACCAAGCCTTTGCTGCCAATCTTGCCGCCACGTCGAGTCTGTCCCAGGAGAGGCAGGGGTCTGTC
GTAGAAGCCAACACCACCAACGAGGAAACTACTATTGACGGCTCCAACGCCAACCACGACAATGCCACTGCCACT
GCCAAGGCCAAGAAGCGCGGCTTCGTTGCCGAGTTACGTAGGACCTTTTGGATGGTCATAACTTACAGCTGGCTC
AACGTCTTGCTCGTCTTTGTCCCCATTGGCATCGCCGTCGCAAACATTCACGGCATCAATGGCGGCATTGTCTTT
GCCATGAATTGTATTGCCGTGATTCCTCTTGCTGGCCTTCTTAGCCATGCGACTGAGTCAGTGGCGTATAACATG
GGCGATTCTCTGGGCGCTCTGCTCAATGTCACCTTTGGCAATGCTGTTGAACTCATCATCTTCATGTAA
Gene >OphauB2|6082
ATGAAGAAAACCCATTCCGATCCCCCAGATATAGAACGCAAACGCCCCGGTGCAATCGCCAGGCTTCATGGAGCC
TTTCGTCACTCGACTCCCGACGTGTCTTCTTTGCCTACGGTAGAGGAGCCGCCCACTGCCGTTGTTGCCAACACG
ACGAGCAATGCCAGCAGCAATGTTACTGCTCTGCCCGTTATTCTCGATGAAAAGGAACTGGCTACTAATGGATCT
ACTCCATTTGACCAAGCCTTTGCTGCCAATCTTGCCGCCACGTCGAGTCTGTCCCAGGAGAGGCAGGGGTCTGTC
GTAGAAGCCAACACCACCAACGAGGAAACTACTATTGACGGCTCCAACGCCAACCACGACAATGCCACTGCCACT
GCCAAGGCCAAGAAGCGCGGCTTCGTTGCCGAGTTACGTAGGACCTTTTGGATGGTCATAACTTACAGCTGGCTC
AACGTCTTGCTCGTCTTTGTCCCCATTGGCATCGCCGTCGCAAACATTCACGGCATCAATGGCGGCATTGTCTTT
GCCATGAATTGTATTGCCGTGATTCCTCTTGCTGGCCTTCTTAGCCATGCGACTGAGTCAGTGGCGTATAACATG
GGCGATTCTCTGGGCGCTCTGCTCAATGTCACCTTTGGCAATGCTGTTGAACTCATCATCTTGTAAGTTGCTGCC
TTGCTTAGCCCCCAATACTTTGCAGAATGCGTGGCTGACACTGTCTTGTCTCAATAGCATGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail