Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|6076
Gene name
LocationContig_52:5895..9876
Strand+
Gene length (bp)3981
Transcript length (bp)3663
Coding sequence length (bp)3663
Protein length (aa) 1221

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13476 AAA_23 AAA domain 7.6E-36 6 291
PF13175 AAA_15 AAA ATPase domain 1.3E-08 21 343

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P12753|RAD50_YEAST DNA repair protein RAD50 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RAD50 PE=1 SV=1 1 1211 4.0E-141
sp|Q9JIL8|RAD50_RAT DNA repair protein RAD50 OS=Rattus norvegicus GN=Rad50 PE=1 SV=1 1 1216 3.0E-110
sp|P70388|RAD50_MOUSE DNA repair protein RAD50 OS=Mus musculus GN=Rad50 PE=1 SV=1 1 1219 3.0E-110
sp|Q92878|RAD50_HUMAN DNA repair protein RAD50 OS=Homo sapiens GN=RAD50 PE=1 SV=1 1 1219 2.0E-105
sp|Q9UTJ8|RAD50_SCHPO DNA repair protein rad50 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rad50 PE=1 SV=3 1 377 1.0E-84
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P12753|RAD50_YEAST DNA repair protein RAD50 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RAD50 PE=1 SV=1 1 1211 4.0E-141
sp|Q9JIL8|RAD50_RAT DNA repair protein RAD50 OS=Rattus norvegicus GN=Rad50 PE=1 SV=1 1 1216 3.0E-110
sp|P70388|RAD50_MOUSE DNA repair protein RAD50 OS=Mus musculus GN=Rad50 PE=1 SV=1 1 1219 3.0E-110
sp|Q92878|RAD50_HUMAN DNA repair protein RAD50 OS=Homo sapiens GN=RAD50 PE=1 SV=1 1 1219 2.0E-105
sp|Q9UTJ8|RAD50_SCHPO DNA repair protein rad50 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rad50 PE=1 SV=3 1 377 1.0E-84
sp|Q9W252|RAD50_DROME DNA repair protein RAD50 OS=Drosophila melanogaster GN=rad50 PE=2 SV=4 1 1213 7.0E-83
sp|Q8SRK6|RAD50_ENCCU DNA repair protein RAD50 OS=Encephalitozoon cuniculi (strain GB-M1) GN=RAD50 PE=1 SV=1 1 195 6.0E-56
sp|Q54CS9|RAD50_DICDI DNA repair protein RAD50 OS=Dictyostelium discoideum GN=rad50 PE=3 SV=1 1 540 3.0E-54
sp|C6KSQ6|RAD50_PLAF7 Probable DNA repair protein RAD50 OS=Plasmodium falciparum (isolate 3D7) GN=PFF0285c PE=3 SV=1 1 270 3.0E-41
sp|Q9SL02|RAD50_ARATH DNA repair protein RAD50 OS=Arabidopsis thaliana GN=RAD50 PE=1 SV=2 952 1211 6.0E-39
sp|Q54CS9|RAD50_DICDI DNA repair protein RAD50 OS=Dictyostelium discoideum GN=rad50 PE=3 SV=1 762 1219 9.0E-38
sp|O44199|RAD50_CAEEL DNA repair protein rad-50 OS=Caenorhabditis elegans GN=rad-50 PE=2 SV=1 1 242 7.0E-31
sp|Q8SRK6|RAD50_ENCCU DNA repair protein RAD50 OS=Encephalitozoon cuniculi (strain GB-M1) GN=RAD50 PE=1 SV=1 1074 1216 6.0E-29
sp|C6KSQ6|RAD50_PLAF7 Probable DNA repair protein RAD50 OS=Plasmodium falciparum (isolate 3D7) GN=PFF0285c PE=3 SV=1 1078 1204 2.0E-28
[Show less]

GO

GO Term Description Terminal node
GO:0140664 ATP-dependent DNA damage sensor activity Yes
GO:0003824 catalytic activity No
GO:0140612 DNA damage sensor activity No
GO:0140657 ATP-dependent activity No
GO:0140299 small molecule sensor activity No
GO:0003674 molecular_function No
GO:0140097 catalytic activity, acting on DNA No
GO:0008094 ATP-dependent activity, acting on DNA No
GO:0140640 catalytic activity, acting on a nucleic acid No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 23 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|6076
MSRIEKLSISGVRSFSPGVREAIQFNTPLTLIVGYNGSGKTTIIECLKYATTGELPPNSKGGAFIHDPKLCGERE
VMAQVKLQFRSINNRQHVATRSLQLTVKKTSRTQKTLDCSLAVVNGGERTTTSTRQAQLDEMIPERLGVSPAILD
AVIFCHQDESLWPLSEPAALKKRFDEIFEAHKYTKVIDNLKVIRKKQMEELARLQTEEAHNKVNKDRGERAEKRM
TGLQAEIEEARSTCEALSAEMEETQQDIKQKHEQANSFLQVVQNLSNKREQLEYRQEAINELKQTIDHLDQDDAS
LERSLLQYEQGMQRQRDKAEQNKAQCNELHRQLGDSRRDLSVKLSEQGKHQSDKEKYERQLELRVEMIREAAQAH
GLRGYDGELTDHIIKGFHEKIQRLLLDKRRDVERVQKDNSVELDKLTMEITKLEGAKAAKTQDRVTAKQRIGAIE
KRSSVLQNEMGLIEVDEGAKAILDGQLQEVCERLQRAQQDFEKGDWEEQLSSDNDKLWRLESENEKLGRELVECT
RLASERAQLDYRKKELSDRKRKLEALTSTWKDKLTSMIDAEWDAKSLESEFQSVQARYTKRLQEARRKRDVAREK
QQKVEYVRRTAKESMDKKTGDGADCKAKVVKVLQSVRPVAVVDDFVEELNSVEQQVEDLRNELSLFDALVDYYSK
CKRLLESKRICLLCDRHFDDGQGASLDRMSKKIDKHLNAKGRIEVEKDLKEASATLESLKAVRASYDTYVRLSGE
VAALGEQGKTTESEYDGLERQLEELEAAVSAEEERQREVDDLGKIVGKICQTGKDVEESEAQVERIMSQQKSSAS
MGRSAEEIHELQATNAEQMRSVKGRIQTMSNERQRAKDHIKALELERSELNNKIGRAAGQLDKKSSLQGQVQALK
DDHTHQRDMMQRADAELERLEPDIAAARSARDGVGSSIKELSMVEGDIEDYLEQQQAEIDGLAKEEQRLRLELDN
ADRSKKNIGDNINYRRHERTLEVLRREIDDLERRDAHDDYQRLQHEARALENRANRLLAERGSVMGSMKTKDEEL
GRLLGEWELDYKEARQRYRESHIRCGGAVDRAVMHFHALKMADVNRIADELWRATYQGTDIDTICIRSDAEAKTG
GRRSYNYRLCMVLASIIVRLALAESFGLSCGLVALDEPTTNLDRENANFQLIVITHDEQFLRHMRCSDFCDSFYR
VKRDAQQNSIIVRESIAKVF*
Coding >OphauB2|6076
ATGTCGCGCATTGAAAAACTGTCCATCTCGGGCGTCCGGTCCTTTAGCCCCGGGGTACGGGAAGCCATCCAATTC
AACACCCCATTGACCCTGATTGTCGGCTACAACGGATCTGGAAAGACGACGATTATCGAGTGCCTCAAGTATGCC
ACCACGGGAGAGCTGCCGCCAAACAGCAAAGGCGGGGCCTTTATCCATGACCCCAAGCTGTGCGGAGAAAGAGAA
GTCATGGCACAGGTCAAACTACAGTTTCGGTCCATCAACAACCGACAGCATGTGGCGACGAGGAGTCTGCAGCTC
ACAGTCAAGAAGACGTCGCGGACGCAAAAGACGCTCGACTGCTCCTTGGCAGTTGTTAACGGTGGAGAGAGGACA
ACCACATCAACGAGGCAAGCACAGCTGGACGAGATGATTCCCGAGCGGCTGGGAGTGTCGCCTGCAATCCTTGAT
GCCGTCATATTTTGCCATCAAGACGAATCGCTATGGCCCCTGAGCGAGCCGGCTGCACTCAAGAAGCGATTCGAC
GAAATCTTTGAGGCTCACAAGTATACAAAGGTGATTGACAACCTCAAGGTTATCCGCAAAAAGCAAATGGAAGAG
CTCGCGAGGCTGCAGACTGAGGAGGCGCATAACAAGGTCAACAAGGACCGAGGCGAGCGCGCAGAAAAGCGCATG
ACGGGCCTCCAAGCCGAGATTGAAGAGGCGCGCAGCACATGCGAGGCTCTGTCTGCTGAAATGGAGGAAACGCAA
CAAGATATTAAGCAGAAGCACGAGCAGGCAAACAGTTTTTTGCAGGTGGTGCAGAACCTTAGCAACAAACGAGAG
CAGCTCGAGTATCGGCAGGAAGCCATCAATGAACTCAAACAGACGATTGATCACCTTGACCAAGACGATGCTTCT
CTTGAGCGCTCGCTGCTTCAATACGAACAAGGCATGCAAAGACAACGCGACAAGGCGGAGCAAAACAAGGCGCAA
TGCAATGAGCTGCACCGCCAACTGGGCGACTCACGCAGAGACTTGTCTGTCAAGTTGTCGGAGCAAGGCAAGCAC
CAGTCGGACAAGGAAAAGTATGAGCGCCAGCTGGAGCTGCGCGTAGAAATGATTCGAGAGGCTGCTCAGGCTCAT
GGCTTGAGAGGCTACGACGGAGAACTGACGGACCACATCATCAAAGGCTTTCATGAAAAGATACAAAGGCTGTTG
CTCGACAAGAGACGAGATGTCGAGCGAGTGCAAAAGGACAACTCGGTCGAGCTGGACAAGCTAACAATGGAGATT
ACCAAGCTCGAGGGCGCCAAGGCGGCAAAGACGCAGGACCGTGTAACTGCCAAGCAGCGGATAGGAGCCATTGAG
AAGCGAAGCAGTGTTTTACAAAATGAAATGGGCTTGATAGAGGTGGATGAAGGTGCCAAGGCGATTCTGGATGGT
CAGCTGCAGGAAGTGTGCGAAAGGCTGCAACGAGCGCAGCAAGACTTTGAAAAGGGCGACTGGGAGGAGCAGCTG
TCTAGTGACAATGACAAGCTGTGGCGGCTGGAAAGCGAAAACGAGAAGCTGGGGCGTGAGCTTGTCGAGTGTACG
CGTCTGGCGTCGGAGCGAGCCCAGCTTGACTATCGGAAAAAGGAGCTATCGGATCGCAAGCGCAAGCTCGAGGCC
CTGACTAGCACGTGGAAAGACAAGCTCACGTCCATGATTGACGCAGAGTGGGATGCCAAGTCGCTCGAGTCGGAG
TTTCAGTCGGTGCAGGCTCGCTACACCAAGAGGCTGCAGGAAGCGCGTAGGAAGCGCGACGTGGCGAGGGAAAAG
CAGCAAAAGGTGGAATATGTACGAAGAACGGCCAAGGAGTCAATGGACAAGAAGACGGGGGATGGAGCCGACTGC
AAAGCCAAGGTTGTCAAGGTGCTGCAAAGCGTGCGGCCAGTGGCGGTGGTTGACGACTTTGTCGAGGAGCTGAAC
TCGGTGGAGCAGCAGGTGGAGGATCTCCGAAACGAACTCAGCCTGTTTGACGCGCTCGTCGACTACTACAGCAAG
TGCAAGCGGCTGCTCGAGTCCAAGAGGATCTGTCTGCTGTGCGACAGGCATTTTGATGACGGCCAGGGGGCCAGT
CTGGATCGGATGAGCAAGAAGATTGACAAGCACCTCAATGCCAAGGGGAGGATTGAGGTGGAAAAGGACCTCAAG
GAAGCCTCGGCCACGCTGGAGTCGCTCAAGGCGGTGCGGGCGTCGTACGACACGTATGTGAGGCTGTCGGGCGAG
GTGGCGGCGCTCGGCGAGCAAGGCAAGACGACCGAGTCCGAGTACGATGGGCTGGAGCGGCAGCTAGAGGAGCTC
GAGGCGGCAGTGTCGGCAGAGGAGGAGAGGCAGCGCGAGGTGGACGACTTGGGCAAGATTGTGGGCAAGATTTGC
CAGACGGGCAAGGACGTGGAGGAGTCGGAGGCGCAGGTGGAGCGCATCATGTCGCAGCAAAAGTCGTCTGCGAGC
ATGGGCCGAAGCGCAGAGGAGATTCACGAGCTCCAGGCGACGAATGCAGAGCAGATGCGGAGTGTCAAGGGGCGG
ATACAAACAATGAGCAACGAGCGGCAGCGGGCCAAGGACCACATCAAGGCGCTGGAGCTGGAGCGCAGCGAGCTC
AACAACAAGATTGGGCGGGCAGCGGGACAGCTGGACAAGAAGAGCAGCCTGCAGGGCCAGGTGCAGGCGCTCAAG
GACGACCACACGCACCAGCGCGACATGATGCAGCGGGCCGACGCGGAGCTGGAGAGGCTGGAGCCGGACATTGCG
GCGGCGCGGTCGGCGCGAGACGGCGTGGGCAGCAGCATCAAGGAGCTGAGCATGGTGGAGGGCGACATTGAGGAC
TATCTGGAGCAGCAGCAGGCCGAGATTGACGGGCTGGCCAAGGAGGAGCAGCGGCTAAGACTGGAGCTGGACAAT
GCAGACCGCAGCAAGAAGAACATTGGCGACAACATCAACTACCGGCGCCATGAGCGCACGCTCGAGGTGCTGCGG
CGCGAGATTGACGACTTGGAGCGCCGCGACGCGCACGACGACTACCAGCGGCTACAGCACGAGGCGCGGGCGCTG
GAAAACCGGGCCAACCGGCTGCTGGCGGAGCGCGGGTCCGTCATGGGCAGCATGAAGACCAAGGACGAGGAGCTG
GGCCGGCTGCTGGGCGAGTGGGAGCTCGACTACAAGGAGGCGCGGCAGCGGTACCGCGAGTCGCACATTCGCTGC
GGCGGAGCGGTGGACCGGGCAGTGATGCACTTTCACGCCCTCAAAATGGCCGACGTGAACCGCATTGCCGACGAG
CTGTGGCGCGCGACATACCAGGGCACCGACATTGACACGATTTGCATCCGCTCCGACGCCGAGGCCAAGACGGGC
GGGCGGCGCAGCTACAACTACCGGCTGTGCATGGTGCTGGCCAGCATCATTGTGCGCCTGGCCCTGGCCGAGTCG
TTTGGCCTGAGCTGCGGCCTCGTGGCGCTCGACGAGCCCACCACCAACCTGGACCGCGAAAACGCTAATTTTCAA
TTGATTGTCATTACGCACGATGAGCAGTTTTTGCGCCACATGCGCTGCAGCGACTTTTGCGACAGCTTTTACCGC
GTCAAGCGCGATGCGCAGCAAAACAGCATCATTGTGCGCGAGAGCATTGCAAAGGTTTTTTGA
Transcript >OphauB2|6076
ATGTCGCGCATTGAAAAACTGTCCATCTCGGGCGTCCGGTCCTTTAGCCCCGGGGTACGGGAAGCCATCCAATTC
AACACCCCATTGACCCTGATTGTCGGCTACAACGGATCTGGAAAGACGACGATTATCGAGTGCCTCAAGTATGCC
ACCACGGGAGAGCTGCCGCCAAACAGCAAAGGCGGGGCCTTTATCCATGACCCCAAGCTGTGCGGAGAAAGAGAA
GTCATGGCACAGGTCAAACTACAGTTTCGGTCCATCAACAACCGACAGCATGTGGCGACGAGGAGTCTGCAGCTC
ACAGTCAAGAAGACGTCGCGGACGCAAAAGACGCTCGACTGCTCCTTGGCAGTTGTTAACGGTGGAGAGAGGACA
ACCACATCAACGAGGCAAGCACAGCTGGACGAGATGATTCCCGAGCGGCTGGGAGTGTCGCCTGCAATCCTTGAT
GCCGTCATATTTTGCCATCAAGACGAATCGCTATGGCCCCTGAGCGAGCCGGCTGCACTCAAGAAGCGATTCGAC
GAAATCTTTGAGGCTCACAAGTATACAAAGGTGATTGACAACCTCAAGGTTATCCGCAAAAAGCAAATGGAAGAG
CTCGCGAGGCTGCAGACTGAGGAGGCGCATAACAAGGTCAACAAGGACCGAGGCGAGCGCGCAGAAAAGCGCATG
ACGGGCCTCCAAGCCGAGATTGAAGAGGCGCGCAGCACATGCGAGGCTCTGTCTGCTGAAATGGAGGAAACGCAA
CAAGATATTAAGCAGAAGCACGAGCAGGCAAACAGTTTTTTGCAGGTGGTGCAGAACCTTAGCAACAAACGAGAG
CAGCTCGAGTATCGGCAGGAAGCCATCAATGAACTCAAACAGACGATTGATCACCTTGACCAAGACGATGCTTCT
CTTGAGCGCTCGCTGCTTCAATACGAACAAGGCATGCAAAGACAACGCGACAAGGCGGAGCAAAACAAGGCGCAA
TGCAATGAGCTGCACCGCCAACTGGGCGACTCACGCAGAGACTTGTCTGTCAAGTTGTCGGAGCAAGGCAAGCAC
CAGTCGGACAAGGAAAAGTATGAGCGCCAGCTGGAGCTGCGCGTAGAAATGATTCGAGAGGCTGCTCAGGCTCAT
GGCTTGAGAGGCTACGACGGAGAACTGACGGACCACATCATCAAAGGCTTTCATGAAAAGATACAAAGGCTGTTG
CTCGACAAGAGACGAGATGTCGAGCGAGTGCAAAAGGACAACTCGGTCGAGCTGGACAAGCTAACAATGGAGATT
ACCAAGCTCGAGGGCGCCAAGGCGGCAAAGACGCAGGACCGTGTAACTGCCAAGCAGCGGATAGGAGCCATTGAG
AAGCGAAGCAGTGTTTTACAAAATGAAATGGGCTTGATAGAGGTGGATGAAGGTGCCAAGGCGATTCTGGATGGT
CAGCTGCAGGAAGTGTGCGAAAGGCTGCAACGAGCGCAGCAAGACTTTGAAAAGGGCGACTGGGAGGAGCAGCTG
TCTAGTGACAATGACAAGCTGTGGCGGCTGGAAAGCGAAAACGAGAAGCTGGGGCGTGAGCTTGTCGAGTGTACG
CGTCTGGCGTCGGAGCGAGCCCAGCTTGACTATCGGAAAAAGGAGCTATCGGATCGCAAGCGCAAGCTCGAGGCC
CTGACTAGCACGTGGAAAGACAAGCTCACGTCCATGATTGACGCAGAGTGGGATGCCAAGTCGCTCGAGTCGGAG
TTTCAGTCGGTGCAGGCTCGCTACACCAAGAGGCTGCAGGAAGCGCGTAGGAAGCGCGACGTGGCGAGGGAAAAG
CAGCAAAAGGTGGAATATGTACGAAGAACGGCCAAGGAGTCAATGGACAAGAAGACGGGGGATGGAGCCGACTGC
AAAGCCAAGGTTGTCAAGGTGCTGCAAAGCGTGCGGCCAGTGGCGGTGGTTGACGACTTTGTCGAGGAGCTGAAC
TCGGTGGAGCAGCAGGTGGAGGATCTCCGAAACGAACTCAGCCTGTTTGACGCGCTCGTCGACTACTACAGCAAG
TGCAAGCGGCTGCTCGAGTCCAAGAGGATCTGTCTGCTGTGCGACAGGCATTTTGATGACGGCCAGGGGGCCAGT
CTGGATCGGATGAGCAAGAAGATTGACAAGCACCTCAATGCCAAGGGGAGGATTGAGGTGGAAAAGGACCTCAAG
GAAGCCTCGGCCACGCTGGAGTCGCTCAAGGCGGTGCGGGCGTCGTACGACACGTATGTGAGGCTGTCGGGCGAG
GTGGCGGCGCTCGGCGAGCAAGGCAAGACGACCGAGTCCGAGTACGATGGGCTGGAGCGGCAGCTAGAGGAGCTC
GAGGCGGCAGTGTCGGCAGAGGAGGAGAGGCAGCGCGAGGTGGACGACTTGGGCAAGATTGTGGGCAAGATTTGC
CAGACGGGCAAGGACGTGGAGGAGTCGGAGGCGCAGGTGGAGCGCATCATGTCGCAGCAAAAGTCGTCTGCGAGC
ATGGGCCGAAGCGCAGAGGAGATTCACGAGCTCCAGGCGACGAATGCAGAGCAGATGCGGAGTGTCAAGGGGCGG
ATACAAACAATGAGCAACGAGCGGCAGCGGGCCAAGGACCACATCAAGGCGCTGGAGCTGGAGCGCAGCGAGCTC
AACAACAAGATTGGGCGGGCAGCGGGACAGCTGGACAAGAAGAGCAGCCTGCAGGGCCAGGTGCAGGCGCTCAAG
GACGACCACACGCACCAGCGCGACATGATGCAGCGGGCCGACGCGGAGCTGGAGAGGCTGGAGCCGGACATTGCG
GCGGCGCGGTCGGCGCGAGACGGCGTGGGCAGCAGCATCAAGGAGCTGAGCATGGTGGAGGGCGACATTGAGGAC
TATCTGGAGCAGCAGCAGGCCGAGATTGACGGGCTGGCCAAGGAGGAGCAGCGGCTAAGACTGGAGCTGGACAAT
GCAGACCGCAGCAAGAAGAACATTGGCGACAACATCAACTACCGGCGCCATGAGCGCACGCTCGAGGTGCTGCGG
CGCGAGATTGACGACTTGGAGCGCCGCGACGCGCACGACGACTACCAGCGGCTACAGCACGAGGCGCGGGCGCTG
GAAAACCGGGCCAACCGGCTGCTGGCGGAGCGCGGGTCCGTCATGGGCAGCATGAAGACCAAGGACGAGGAGCTG
GGCCGGCTGCTGGGCGAGTGGGAGCTCGACTACAAGGAGGCGCGGCAGCGGTACCGCGAGTCGCACATTCGCTGC
GGCGGAGCGGTGGACCGGGCAGTGATGCACTTTCACGCCCTCAAAATGGCCGACGTGAACCGCATTGCCGACGAG
CTGTGGCGCGCGACATACCAGGGCACCGACATTGACACGATTTGCATCCGCTCCGACGCCGAGGCCAAGACGGGC
GGGCGGCGCAGCTACAACTACCGGCTGTGCATGGTGCTGGCCAGCATCATTGTGCGCCTGGCCCTGGCCGAGTCG
TTTGGCCTGAGCTGCGGCCTCGTGGCGCTCGACGAGCCCACCACCAACCTGGACCGCGAAAACGCTAATTTTCAA
TTGATTGTCATTACGCACGATGAGCAGTTTTTGCGCCACATGCGCTGCAGCGACTTTTGCGACAGCTTTTACCGC
GTCAAGCGCGATGCGCAGCAAAACAGCATCATTGTGCGCGAGAGCATTGCAAAGGTTTTTTGA
Gene >OphauB2|6076
ATGTCGCGCATTGAAAAACTGTCCATCTCGGGCGTCCGGTCCTTTAGCCCCGGGGTACGGGAAGCCATCCAATTC
AACACCCCATTGACCCTGATTGTCGGCTACAACGGATCTGGAAAGACGACGATTATCGAGTGCCTCAAGTATGCC
ACCACGGGAGAGCTGCCGCCAAACAGCAAAGGCGGGGCCTTTATCCATGACCCCAAGGTTGGTGGCGCCAAGCTC
GTGTCGACAAGCACGTACTAATGTAGGCAACAGCTGTGCGGAGAAAGAGAAGTCATGGCACAGGTCAAACTACAG
TTTCGGTCCATCAACAACCGACAGCATGTGGCGACGAGGAGTCTGCAGCTCACAGTCAAGAAGACGTCGCGGACG
CAAAAGACGCTCGACTGCTCCTTGGCAGTTGTTAACGGTGGAGAGAGGACAACCACATCAACGAGGCAAGCACAG
CTGGACGAGATGATTCCCGAGCGGCTGGGAGTGTCGCCTGCAATCCTTGATGCCGTCATATTTTGCCATCAAGAC
GAATCGCTATGGCCCCTGAGCGAGCCGGCTGCACTCAAGAAGCGATTCGACGAAATCTTTGAGGCTCACAAGTAT
ACAAAGGTGATTGACAACCTCAAGGTTATCCGCAAAAAGCAAATGGAAGAGCTCGCGAGGCTGCAGACTGAGGAG
GCGCATAACAAGGTCAACAAGGACCGAGGCGAGCGCGCAGAAAAGCGCATGACGGGCCTCCAAGCCGAGATTGAA
GAGGCGCGCAGCACATGCGAGGCTCTGTCTGCTGAAATGGAGGAAACGCAACAAGATATTAAGCAGAAGCACGAG
CAGGCAAACAGTTTTTTGCAGGTGGTGCAGAACCTTAGCAACAAACGAGAGCAGCTCGAGTATCGGCAGGAAGCC
ATCAATGAACTCAAACAGACGATTGATCACCTTGACCAAGACGATGCTTCTCTTGAGCGCTCGCTGCTTCAATAC
GAACAAGGCATGCAAAGACAACGCGACAAGGCGGAGCAAAACAAGGCGCAATGCAATGAGCTGCACCGCCAACTG
GGCGACTCACGCAGAGACTTGTCTGTCAAGTTGTCGGAGCAAGGCAAGCACCAGTCGGACAAGGAAAAGTATGAG
CGCCAGCTGGAGCTGCGCGTAGAAATGATTCGAGAGGCTGCTCAGGCTCATGGCTTGAGAGGCTACGACGGAGAA
CTGACGGACCACATCATCAAAGGCTTTCATGAAAAGATACAAAGGCTGTTGCTCGACAAGAGACGAGATGTCGAG
CGAGTGCAAAAGGACAACTCGGTCGAGCTGGACAAGCTAACAATGGAGATTACCAAGCTCGAGGGCGCCAAGGCG
GCAAAGACGCAGGACCGTGTAACTGCCAAGCAGCGGATAGGAGCCATTGAGAAGCGAAGCAGTGTTTTACAAAAT
GAAATGGGCTTGATAGAGGTGGATGAAGGTGCCAAGGCGATTCTGGATGGTCAGCTGCAGGAAGTGTGCGAAAGG
CTGCAACGAGCGCAGCAAGACTTTGAAAAGGGCGACTGGGAGGAGCAGCTGTCTAGTGACAATGACAAGCTGTGG
CGGCTGGAAAGCGAAAACGAGAAGCTGGGGCGTGAGCTTGTCGAGTGTACGCGTCTGGCGTCGGAGCGAGCCCAG
CTTGACTATCGGAAAAAGGAGCTATCGGATCGCAAGCGCAAGCTCGAGGCCCTGACTAGCACGTGGAAAGACAAG
CTCACGTCCATGATTGACGCAGAGTGGGATGCCAAGTCGCTCGAGTCGGAGTTTCAGTCGGTGCAGGCTCGCTAC
ACCAAGAGGCTGCAGGAAGCGCGTAGGAAGCGCGACGTGGCGAGGGAAAAGCAGCAAAAGGTGGAATATGTACGA
AGAACGGCCAAGGAGTCAATGGACAAGAAGACGGGGGATGGAGCCGACTGCAAAGCCAAGGTTGTCAAGGTGCTG
CAAAGCGTGCGGCCAGTGGCGGTGGTTGACGACTTTGTCGAGGAGCTGAACTCGGTGGAGCAGCAGGTGGAGGAT
CTCCGAAACGAACTCAGCCTGTTTGACGCGCTCGTCGACTACTACAGCAAGTGCAAGCGGCTGCTCGAGTCCAAG
AGGATCTGTCTGCTGTGCGACAGGCATTTTGATGACGGCCAGGGGGCCAGTCTGGATCGGATGAGCAAGAAGATT
GACAAGCACCTCAATGCCAAGGGGAGGATTGAGGTGGAAAAGGACCTCAAGGAAGCCTCGGCCACGCTGGAGTCG
CTCAAGGCGGTGCGGGCGTCGTACGACACGTATGTGAGGCTGTCGGGCGAGGTGGCGGCGCTCGGCGAGCAAGGC
AAGACGACCGAGTCCGAGTACGATGGGCTGGAGCGGCAGCTAGAGGAGCTCGAGGCGGCAGTGTCGGCAGAGGAG
GAGAGGCAGCGCGAGGTGGACGACTTGGGCAAGATTGTGGGCAAGATTTGCCAGACGGGCAAGGACGTGGAGGAG
TCGGAGGCGCAGGTGGAGCGCATCATGTCGCAGCAAAAGTCGTCTGCGAGCATGGGCCGAAGCGCAGAGGAGATT
CACGAGCTCCAGGCGACGAATGCAGAGCAGATGCGGAGTGTCAAGGGGCGGATACAAACAATGAGCAACGAGCGG
CAGCGGGCCAAGGACCACATCAAGGCGCTGGAGCTGGAGCGCAGCGAGCTCAACAACAAGATTGGGCGGGCAGCG
GGACAGCTGGACAAGAAGAGCAGCCTGCAGGGCCAGGTGCAGGCGCTCAAGGACGACCACACGCACCAGCGCGAC
ATGATGCAGCGGGCCGACGCGGAGCTGGAGAGGCTGGAGCCGGACATTGCGGCGGCGCGGTCGGTGCGCGACGAC
GTGGTGCGGCAGGGGCGAGAGCGGGAGCAGCGGCTGGTGGAGGCGCGAGACGGCGTGGGCAGCAGCATCAAGGAG
CTGAGCATGGTGGAGGGCGACATTGAGGACTATGTGTCGCGAGGGGCAGCGGGCCAGCTGGCAGCAAATGGACGA
GCCATTGGCGCGCTGGAGCGGCAGCTGGAGCAGCAGCAGGCCGAGATTGACGGGCTGGCCAAGGAGGAGCAGCGG
CTAAGACTGGAGCTGGACAATGCAGACCGCAGCAAGAAGAACATTGGCGACAACATCAACTACCGGCGCCATGAG
CGCACGCTCGAGGTGCTGCGGCGCGAGATTGACGACTTGGAGCGCCGCGACGCGCACGACGACTACCAGCGGCTA
CAGCACGAGGCGCGGGCGCTGGAAAACCGGGCCAACCGGCTGCTGGCGGAGCGCGGGTCCGTCATGGGCAGCATG
AAGACCAAGGACGAGGAGCTGGGCCGGCTGCTGGGCGAGTGGGAGCTCGACTACAAGGAGGCGCGGCAGCGGTAC
CGCGAGTCGCACATTCGCGTAGAAACAACACGGGCCGCCATTGACGACTTGGCGCAGTGCGGCGGAGCGGTGGAC
CGGGCAGTGATGCACTTTCACGCCCTCAAAATGGCCGACGTGAACCGCATTGCCGACGAGCTGTGGCGCGCGACA
TACCAGGGCACCGACATTGACACGATTTGCATCCGCTCCGACGCCGAGGCCAAGACGGGCGGGCGGCGCAGCTAC
AACTACCGGCTGTGCATGGTGAAGCAAGACGCCGAAATGGACATGCGCGGCCGCTGCTCTGCCGGGCAAAAGGTG
CTGGCCAGCATCATTGTGCGCCTGGCCCTGGCCGAGTCGTTTGGCCTGAGCTGCGGCCTCGTGGCGCTCGACGAG
CCCACCACCAACCTGGACCGCGAAAACGTAAAGAGTTTGGCCGAGAGTCTGCACGACATTATCCGCGCGCGGCAG
GCGCAGGCTAATTTTCAATTGATTGTCATTACGCACGATGAGCAGTTTTTGCGCCACATGCGCTGCAGCGACTTT
TGCGACAGCTTTTACCGCGTCAAGCGCGATGCGCAGCAAAACAGCATCATTGTGCGCGAGAGCATTGCAAAGGTT
TTTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail