Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|6075
Gene name
LocationContig_52:1612..3100
Strand-
Gene length (bp)1488
Transcript length (bp)1428
Coding sequence length (bp)1428
Protein length (aa) 476

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00320 GATA GATA zinc finger 1.5E-15 420 455
PF08447 PAS_3 PAS fold 1.7E-14 143 212
PF00989 PAS PAS fold 5.6E-09 123 208

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q00858|CGPB_FUSSO Cutinase gene palindrome-binding protein OS=Fusarium solani subsp. pisi PE=2 SV=1 22 475 0.0E+00
sp|P78714|WC2_NEUCR White collar 2 protein OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=wc-2 PE=1 SV=1 1 450 6.0E-173
sp|Q75JZ1|GTAC_DICDI GATA zinc finger domain-containing protein 3 OS=Dictyostelium discoideum GN=gtaC PE=3 SV=1 420 465 4.0E-11
sp|Q55C49|GTAG_DICDI GATA zinc finger domain-containing protein 7 OS=Dictyostelium discoideum GN=gtaG PE=3 SV=1 420 458 5.0E-11
sp|Q54NM5|GTAL_DICDI GATA zinc finger domain-containing protein 12 OS=Dictyostelium discoideum GN=gtaL PE=3 SV=1 408 465 2.0E-10
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q00858|CGPB_FUSSO Cutinase gene palindrome-binding protein OS=Fusarium solani subsp. pisi PE=2 SV=1 22 475 0.0E+00
sp|P78714|WC2_NEUCR White collar 2 protein OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=wc-2 PE=1 SV=1 1 450 6.0E-173
sp|Q75JZ1|GTAC_DICDI GATA zinc finger domain-containing protein 3 OS=Dictyostelium discoideum GN=gtaC PE=3 SV=1 420 465 4.0E-11
sp|Q55C49|GTAG_DICDI GATA zinc finger domain-containing protein 7 OS=Dictyostelium discoideum GN=gtaG PE=3 SV=1 420 458 5.0E-11
sp|Q54NM5|GTAL_DICDI GATA zinc finger domain-containing protein 12 OS=Dictyostelium discoideum GN=gtaL PE=3 SV=1 408 465 2.0E-10
sp|Q54HA4|GTAO_DICDI GATA zinc finger domain-containing protein 15 (Fragment) OS=Dictyostelium discoideum GN=gtaO PE=3 SV=1 401 457 2.0E-10
sp|Q54TM6|GTAI_DICDI GATA zinc finger domain-containing protein 9 OS=Dictyostelium discoideum GN=gtaI PE=3 SV=1 386 459 2.0E-10
sp|B0G188|GTAP_DICDI GATA zinc finger domain-containing protein 16 OS=Dictyostelium discoideum GN=gtaP PE=3 SV=1 404 454 2.0E-10
sp|Q54KX0|GTAN_DICDI GATA zinc finger domain-containing protein 14 OS=Dictyostelium discoideum GN=gtaN PE=3 SV=1 405 455 5.0E-10
sp|Q55GK0|GTAE_DICDI GATA zinc finger domain-containing protein 5 OS=Dictyostelium discoideum GN=gtaE PE=3 SV=1 420 454 1.0E-09
sp|Q5KSV0|GTAK_DICDI GATA zinc finger domain-containing protein 11 OS=Dictyostelium discoideum GN=gtaK PE=2 SV=1 411 471 1.0E-09
sp|Q6QPM2|GAT19_ARATH GATA transcription factor 19 OS=Arabidopsis thaliana GN=GATA19 PE=2 SV=2 420 462 2.0E-09
sp|Q75JZ0|GTAH_DICDI GATA zinc finger domain-containing protein 8 OS=Dictyostelium discoideum GN=gtaH PE=3 SV=1 400 455 3.0E-09
sp|Q8VZP4|GAT10_ARATH GATA transcription factor 10 OS=Arabidopsis thaliana GN=GATA10 PE=2 SV=1 419 449 7.0E-09
sp|Q9ZPX0|GAT20_ARATH GATA transcription factor 20 OS=Arabidopsis thaliana GN=GATA20 PE=2 SV=2 420 461 8.0E-09
sp|Q9FJ10|GAT16_ARATH GATA transcription factor 16 OS=Arabidopsis thaliana GN=GATA16 PE=2 SV=1 407 461 2.0E-08
sp|Q9LIB5|GAT17_ARATH GATA transcription factor 17 OS=Arabidopsis thaliana GN=GATA17 PE=2 SV=1 417 462 2.0E-08
sp|Q01371|WC1_NEUCR White collar 1 protein OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=wc-1 PE=1 SV=2 420 455 2.0E-08
sp|Q9LRH6|GAT25_ARATH GATA transcription factor 25 OS=Arabidopsis thaliana GN=GATA25 PE=2 SV=2 417 470 3.0E-08
sp|Q59LY1|BRG1_CANAL Biofilm regulator 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=BRG1 PE=1 SV=1 420 459 3.0E-08
sp|Q8H1G0|GAT28_ARATH GATA transcription factor 28 OS=Arabidopsis thaliana GN=GATA28 PE=2 SV=1 416 472 4.0E-08
sp|Q8LG10|GAT15_ARATH GATA transcription factor 15 OS=Arabidopsis thaliana GN=GATA15 PE=2 SV=2 414 454 4.0E-08
sp|Q6DBP8|GAT11_ARATH GATA transcription factor 11 OS=Arabidopsis thaliana GN=GATA11 PE=2 SV=1 420 449 5.0E-08
sp|P40209|GAT2_YEAST Protein GAT2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GAT2 PE=3 SV=1 420 455 6.0E-08
sp|Q8LC79|GAT18_ARATH GATA transcription factor 18 OS=Arabidopsis thaliana GN=GATA18 PE=2 SV=2 420 459 6.0E-08
sp|Q5HZ36|GAT21_ARATH GATA transcription factor 21 OS=Arabidopsis thaliana GN=GATA21 PE=1 SV=2 419 451 7.0E-08
sp|Q8LC59|GAT23_ARATH GATA transcription factor 23 OS=Arabidopsis thaliana GN=GATA23 PE=2 SV=2 407 454 1.0E-07
sp|Q10F25|GAT18_ORYSJ GATA transcription factor 18 OS=Oryza sativa subsp. japonica GN=GATA18 PE=2 SV=1 415 457 2.0E-07
sp|Q54TE3|GTAJ_DICDI GATA zinc finger domain-containing protein 10 OS=Dictyostelium discoideum GN=gtaJ PE=3 SV=1 420 455 2.0E-07
sp|Q9SZI6|GAT22_ARATH Putative GATA transcription factor 22 OS=Arabidopsis thaliana GN=GATA22 PE=3 SV=1 419 448 2.0E-07
sp|Q8L4M6|GATA3_ARATH GATA transcription factor 3 OS=Arabidopsis thaliana GN=GATA3 PE=2 SV=2 408 448 2.0E-07
sp|A2XKR7|GAT18_ORYSI GATA transcription factor 18 OS=Oryza sativa subsp. indica GN=GATA18 PE=3 SV=1 415 457 2.0E-07
sp|Q9LT45|GAT29_ARATH GATA transcription factor 29 OS=Arabidopsis thaliana GN=GATA29 PE=2 SV=1 420 460 2.0E-07
sp|P69781|GAT12_ARATH GATA transcription factor 12 OS=Arabidopsis thaliana GN=GATA12 PE=2 SV=1 416 449 3.0E-07
sp|Q8GXL7|GAT24_ARATH GATA transcription factor 24 OS=Arabidopsis thaliana GN=GATA24 PE=2 SV=2 417 465 3.0E-07
sp|Q8LAU9|GATA1_ARATH GATA transcription factor 1 OS=Arabidopsis thaliana GN=GATA1 PE=2 SV=2 420 449 8.0E-07
sp|O49741|GATA2_ARATH GATA transcription factor 2 OS=Arabidopsis thaliana GN=GATA2 PE=2 SV=1 420 449 9.0E-07
sp|Q9SKN6|GAT13_ARATH Putative GATA transcription factor 13 OS=Arabidopsis thaliana GN=GATA13 PE=3 SV=2 378 449 9.0E-07
sp|O49743|GATA4_ARATH GATA transcription factor 4 OS=Arabidopsis thaliana GN=GATA4 PE=2 SV=1 420 449 1.0E-06
sp|O82632|GATA9_ARATH GATA transcription factor 9 OS=Arabidopsis thaliana GN=GATA9 PE=2 SV=1 420 449 1.0E-06
sp|Q6Z433|GAT17_ORYSJ GATA transcription factor 17 OS=Oryza sativa subsp. japonica GN=GATA17 PE=2 SV=1 420 472 2.0E-06
sp|Q550D5|GTAA_DICDI Transcription factor stalky OS=Dictyostelium discoideum GN=stkA PE=1 SV=1 420 454 3.0E-06
sp|Q9FH57|GATA5_ARATH GATA transcription factor 5 OS=Arabidopsis thaliana GN=GATA5 PE=2 SV=1 420 449 7.0E-06
sp|Q0DNU1|GAT19_ORYSJ GATA transcription factor 19 OS=Oryza sativa subsp. japonica GN=GATA19 PE=2 SV=2 417 467 9.0E-06
sp|B8AR30|GAT19_ORYSI GATA transcription factor 19 OS=Oryza sativa subsp. indica GN=GATA19 PE=3 SV=1 417 467 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0043565 sequence-specific DNA binding Yes
GO:0006355 regulation of transcription, DNA-templated Yes
GO:0097159 organic cyclic compound binding No
GO:0010468 regulation of gene expression No
GO:0008150 biological_process No
GO:0005488 binding No
GO:0003674 molecular_function No
GO:0009889 regulation of biosynthetic process No
GO:0010556 regulation of macromolecule biosynthetic process No
GO:0060255 regulation of macromolecule metabolic process No
GO:0050789 regulation of biological process No
GO:0031323 regulation of cellular metabolic process No
GO:0003677 DNA binding No
GO:0065007 biological regulation No
GO:0051171 regulation of nitrogen compound metabolic process No
GO:2001141 regulation of RNA biosynthetic process No
GO:1901363 heterocyclic compound binding No
GO:0050794 regulation of cellular process No
GO:0051252 regulation of RNA metabolic process No
GO:0031326 regulation of cellular biosynthetic process No
GO:0019222 regulation of metabolic process No
GO:0003676 nucleic acid binding No
GO:0080090 regulation of primary metabolic process No
GO:0019219 regulation of nucleobase-containing compound metabolic process No
GO:1903506 regulation of nucleic acid-templated transcription No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
GATA type zinc finger

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|6075
MSHGPPPPPGHFFGFHNLDLSGQDANDVMAMLDSSIMAQFDDVPLNMDLSDFNPNPDPADCSMPHDSGLVSEDCI
VRAENQFNTAANNVPGAGPLPAGAFNQMSLSNSSVLTEFTKRKNWAAKIIEEVKDFLHILDANGRIKYASPSVLA
ISGYSCEEIVDKFLKDLIHPDDQGVFVSEYNESIASGNTLRMFYRFKKKDGSYIMFESVGHAHIAAAKFAPNPNN
QTPFCQAVFIMSRLYPTKNAGLLDSFLEHKIENERLRRRIAELRREEEAEADEAQRQWMQGQEARSDVTPSEFTG
MSSSAPLYHARLSQDFISPLDRSAVDGALTRENLEGAVAGSRPDSLRDKMARYEGSSHTDTIEMLTGLRYLEGER
SHGITTGNASPTLIRGDAGIAIPMDRDFRPGDKKKKLKTTEEYVCTDCGTLDSPEWRKGPSGPKTLCNACGLRWA
KKEKKRNTANNAPQQQVPLMDNAMV*
Coding >OphauB2|6075
ATGTCCCACGGACCACCTCCGCCTCCGGGCCACTTCTTTGGGTTTCACAACCTCGATCTCAGTGGACAAGACGCC
AACGATGTCATGGCCATGCTCGACTCGAGCATCATGGCCCAGTTTGACGATGTACCCCTCAACATGGACCTGAGC
GACTTTAACCCTAACCCGGACCCCGCCGACTGCTCGATGCCCCACGACAGCGGCCTCGTTAGCGAAGATTGCATT
GTCCGCGCCGAAAACCAGTTCAACACTGCCGCAAACAATGTCCCCGGTGCTGGTCCCTTGCCTGCTGGCGCCTTT
AACCAGATGAGTCTCTCCAACAGCAGTGTCTTGACCGAGTTTACCAAGCGCAAAAATTGGGCCGCCAAGATTATT
GAAGAGGTCAAGGATTTTTTGCATATTCTCGACGCCAACGGCCGCATCAAGTATGCGTCGCCCAGCGTGCTTGCC
ATTAGCGGCTACTCGTGCGAAGAAATCGTGGACAAGTTTCTCAAGGACCTTATTCACCCCGACGACCAGGGCGTC
TTTGTATCCGAGTACAACGAGTCGATAGCGTCGGGCAACACGCTACGCATGTTTTACCGCTTCAAGAAGAAGGAT
GGCTCCTACATCATGTTTGAGTCGGTCGGCCACGCCCATATTGCCGCTGCCAAGTTTGCGCCCAACCCCAACAAC
CAGACCCCCTTTTGCCAGGCCGTCTTCATCATGTCGCGCCTCTACCCCACCAAGAATGCCGGTCTGCTTGATTCC
TTTCTCGAGCACAAGATTGAGAATGAGCGGCTGCGGCGCCGAATCGCTGAGCTGCGTCGCGAGGAGGAAGCCGAG
GCGGACGAAGCCCAGCGACAGTGGATGCAGGGCCAAGAGGCCCGCTCAGACGTGACGCCCTCTGAGTTCACGGGC
ATGTCGTCGTCGGCACCGCTGTACCACGCGCGCCTCAGCCAAGACTTTATAAGCCCCTTGGATCGAAGCGCCGTC
GACGGCGCACTGACTAGAGAGAACCTCGAGGGCGCCGTGGCAGGCAGTCGGCCCGACTCGTTGCGAGACAAGATG
GCACGCTACGAAGGCTCTTCGCATACCGACACGATTGAAATGCTGACTGGTTTGCGCTATCTCGAGGGAGAGCGC
AGCCACGGCATTACTACGGGGAATGCCAGTCCGACACTTATTAGAGGCGACGCAGGCATTGCCATTCCCATGGAC
CGCGACTTTAGGCCGGGAGACAAGAAGAAGAAGCTCAAGACGACTGAAGAGTATGTGTGCACAGACTGTGGCACG
CTCGACTCTCCCGAATGGAGAAAGGGTCCCAGCGGCCCCAAGACGTTGTGCAACGCGTGCGGGCTGCGGTGGGCG
AAGAAGGAGAAGAAGCGAAACACTGCCAACAATGCGCCACAGCAACAGGTGCCTTTGATGGACAACGCTATGGTT
TGA
Transcript >OphauB2|6075
ATGTCCCACGGACCACCTCCGCCTCCGGGCCACTTCTTTGGGTTTCACAACCTCGATCTCAGTGGACAAGACGCC
AACGATGTCATGGCCATGCTCGACTCGAGCATCATGGCCCAGTTTGACGATGTACCCCTCAACATGGACCTGAGC
GACTTTAACCCTAACCCGGACCCCGCCGACTGCTCGATGCCCCACGACAGCGGCCTCGTTAGCGAAGATTGCATT
GTCCGCGCCGAAAACCAGTTCAACACTGCCGCAAACAATGTCCCCGGTGCTGGTCCCTTGCCTGCTGGCGCCTTT
AACCAGATGAGTCTCTCCAACAGCAGTGTCTTGACCGAGTTTACCAAGCGCAAAAATTGGGCCGCCAAGATTATT
GAAGAGGTCAAGGATTTTTTGCATATTCTCGACGCCAACGGCCGCATCAAGTATGCGTCGCCCAGCGTGCTTGCC
ATTAGCGGCTACTCGTGCGAAGAAATCGTGGACAAGTTTCTCAAGGACCTTATTCACCCCGACGACCAGGGCGTC
TTTGTATCCGAGTACAACGAGTCGATAGCGTCGGGCAACACGCTACGCATGTTTTACCGCTTCAAGAAGAAGGAT
GGCTCCTACATCATGTTTGAGTCGGTCGGCCACGCCCATATTGCCGCTGCCAAGTTTGCGCCCAACCCCAACAAC
CAGACCCCCTTTTGCCAGGCCGTCTTCATCATGTCGCGCCTCTACCCCACCAAGAATGCCGGTCTGCTTGATTCC
TTTCTCGAGCACAAGATTGAGAATGAGCGGCTGCGGCGCCGAATCGCTGAGCTGCGTCGCGAGGAGGAAGCCGAG
GCGGACGAAGCCCAGCGACAGTGGATGCAGGGCCAAGAGGCCCGCTCAGACGTGACGCCCTCTGAGTTCACGGGC
ATGTCGTCGTCGGCACCGCTGTACCACGCGCGCCTCAGCCAAGACTTTATAAGCCCCTTGGATCGAAGCGCCGTC
GACGGCGCACTGACTAGAGAGAACCTCGAGGGCGCCGTGGCAGGCAGTCGGCCCGACTCGTTGCGAGACAAGATG
GCACGCTACGAAGGCTCTTCGCATACCGACACGATTGAAATGCTGACTGGTTTGCGCTATCTCGAGGGAGAGCGC
AGCCACGGCATTACTACGGGGAATGCCAGTCCGACACTTATTAGAGGCGACGCAGGCATTGCCATTCCCATGGAC
CGCGACTTTAGGCCGGGAGACAAGAAGAAGAAGCTCAAGACGACTGAAGAGTATGTGTGCACAGACTGTGGCACG
CTCGACTCTCCCGAATGGAGAAAGGGTCCCAGCGGCCCCAAGACGTTGTGCAACGCGTGCGGGCTGCGGTGGGCG
AAGAAGGAGAAGAAGCGAAACACTGCCAACAATGCGCCACAGCAACAGGTGCCTTTGATGGACAACGCTATGGTT
TGA
Gene >OphauB2|6075
ATGTCCCACGGACCACCTCCGCCTCCGGGCCACTTCTTTGGGTTTCACAACCTCGATCTCAGTGGACAAGACGCC
AACGATGTCATGGCCATGCTCGACTCGAGCATCATGGCCCAGTTTGACGATGTACCCCTCAACATGGACCTGAGC
GACTTTAACCCTAACCCGGACCCCGCCGACTGCTCGATGCCCCACGACAGCGGCCTCGTTAGCGAAGATTGCATT
GTCCGCGCCGAAAACCAGTTCAACACTGCCGCAAACAATGTCCCCGGTGCTGGTCCCTTGCCTGCTGGCGCCTTT
AACCAGATGAGTCTCTCCAACAGCAGTGTCTTGACCGAGTTTACCAAGCGCAAAAATTGGGCCGCCAAGATTATT
GAAGAGGTCAAGGATTTTTTGCATATTCTCGACGCCAACGGCCGCATCAAGTATGCGTCGCCCAGCGTGCTTGCC
ATTAGCGGCTACTCGTGCGAAGAAATCGTGGACAAGTTTCTCAAGGACCTTATTCACCCCGACGACCAGGGCGTC
TTTGTATCCGAGTACAACGAGTCGATAGCGTCGGGCAACACGCTACGCATGTTTTACCGCTTCAAGAAGAAGGAT
GGCTCCTACATCATGTTTGAGTCGGTCGGCCACGCCCATATTGCCGCTGCCAAGTTTGCGCCCAACCCCAACAAC
CAGACCCCCTTTTGCCAGGCCGTCTTCATCATGTCGCGCCTCTACCCCACCAAGAATGCCGGTCTGCTTGATTCC
TTTCTCGAGCACAAGATTGAGAATGAGCGGCTGCGGCGCCGAATCGCTGAGCTGCGTCGCGAGGAGGAAGCCGAG
GCGGACGAAGCCCAGCGACAGTGGATGCAGGGCCAAGAGGCCCGCTCAGACGTGACGCCCTCTGAGTTCACGGGC
ATGTCGTCGTCGGCACCGCTGTACCACGCGCGCCTCAGCCAAGACTTTATAAGCCCCTTGGATCGAAGCGCCGTC
GACGGCGCACTGACTAGAGAGAACCTCGAGGGCGCCGTGGCAGGCAGTCGGCCCGACTCGTTGCGAGACAAGATG
GCACGCTACGAAGGCTCTTCGCATACCGACACGATTGAAATGCTGACTGGTTTGCGCTATCTCGAGGGAGAGCGC
AGCCACGGCATTACTACGGGGAATGCCAGTCCGACACTTATTAGAGGCGACGCAGGCATTGCCATTCCCATGGAC
CGCGACTTTAGGCCGGGAGACAAGAAGAAGAAGCTCAAGACGACTGAAGAGTATGTGTGCACAGACTGTGGTAAG
TGGACAACAAGGCCAAGAGTGCACTGCCGGTGGACTAACGTTTTTTCTCTGCAAGGCACGCTCGACTCTCCCGAA
TGGAGAAAGGGTCCCAGCGGCCCCAAGACGTTGTGCAACGCGTGCGGGCTGCGGTGGGCGAAGAAGGAGAAGAAG
CGAAACACTGCCAACAATGCGCCACAGCAACAGGTGCCTTTGATGGACAACGCTATGGTTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail