Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|6065
Gene name
LocationContig_51:88333..92134
Strand+
Gene length (bp)3801
Transcript length (bp)3801
Coding sequence length (bp)3801
Protein length (aa) 1267

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P97347|RPTN_MOUSE Repetin OS=Mus musculus GN=Rptn PE=2 SV=2 149 293 3.0E-11
sp|P19246|NFH_MOUSE Neurofilament heavy polypeptide OS=Mus musculus GN=Nefh PE=1 SV=3 84 291 4.0E-11
sp|P19246|NFH_MOUSE Neurofilament heavy polypeptide OS=Mus musculus GN=Nefh PE=1 SV=3 137 293 8.0E-11
sp|P16884|NFH_RAT Neurofilament heavy polypeptide OS=Rattus norvegicus GN=Nefh PE=1 SV=4 140 294 1.0E-10
sp|P97347|RPTN_MOUSE Repetin OS=Mus musculus GN=Rptn PE=2 SV=2 88 297 4.0E-10
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P97347|RPTN_MOUSE Repetin OS=Mus musculus GN=Rptn PE=2 SV=2 149 293 3.0E-11
sp|P19246|NFH_MOUSE Neurofilament heavy polypeptide OS=Mus musculus GN=Nefh PE=1 SV=3 84 291 4.0E-11
sp|P19246|NFH_MOUSE Neurofilament heavy polypeptide OS=Mus musculus GN=Nefh PE=1 SV=3 137 293 8.0E-11
sp|P16884|NFH_RAT Neurofilament heavy polypeptide OS=Rattus norvegicus GN=Nefh PE=1 SV=4 140 294 1.0E-10
sp|P97347|RPTN_MOUSE Repetin OS=Mus musculus GN=Rptn PE=2 SV=2 88 297 4.0E-10
sp|Q6XPR3|RPTN_HUMAN Repetin OS=Homo sapiens GN=RPTN PE=1 SV=1 73 293 5.0E-10
sp|P97347|RPTN_MOUSE Repetin OS=Mus musculus GN=Rptn PE=2 SV=2 83 259 2.0E-08
sp|P19246|NFH_MOUSE Neurofilament heavy polypeptide OS=Mus musculus GN=Nefh PE=1 SV=3 127 308 5.0E-08
sp|Q6XPR3|RPTN_HUMAN Repetin OS=Homo sapiens GN=RPTN PE=1 SV=1 94 306 6.0E-08
sp|P23253|TCNA_TRYCR Sialidase OS=Trypanosoma cruzi GN=TCNA PE=2 SV=1 135 337 7.0E-08
sp|Q6XPR3|RPTN_HUMAN Repetin OS=Homo sapiens GN=RPTN PE=1 SV=1 130 297 2.0E-07
sp|P23253|TCNA_TRYCR Sialidase OS=Trypanosoma cruzi GN=TCNA PE=2 SV=1 135 337 2.0E-07
sp|Q6XPR3|RPTN_HUMAN Repetin OS=Homo sapiens GN=RPTN PE=1 SV=1 94 268 4.0E-07
sp|P32334|MSB2_YEAST Signaling mucin MSB2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MSB2 PE=1 SV=1 880 1108 6.0E-07
sp|P97347|RPTN_MOUSE Repetin OS=Mus musculus GN=Rptn PE=2 SV=2 131 293 1.0E-06
sp|Q7Z2Y5|NRK_HUMAN Nik-related protein kinase OS=Homo sapiens GN=NRK PE=1 SV=2 140 311 8.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 21 0.45

Transmembrane Domains

Domain # Start End Length
1 1159 1181 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|6065
MHLKSIALASTLALAATVAADVEPERPRIYFPREVKRDVVNSTLAAPETAVTPSTDLVSSTGHGSSSKRGIVSDL
LSPILAILPTGPFGAASSSAPAAQTPPAAQTPPVAAFTPQQPAGASSNVLVRPTQGAVNTPAQPPAQVQPSAPAQ
PPVQPQSPAPVQSSAQAKPPVQAQSSAQAQPPAQVQSSAQVQPPAQVQSSAQVQPPAQVQSSAQAQPPAQVQSSA
QAQPPAQVQSSAQVQPPAQVQSSAQAQPPAQAQSSAQAQPPAQQPQSSAQTQPPAQVQTSASANVPSQSVPSVAQ
PSEPAQPATTAIQSSTEDKPSSQIAPVQTSSTPVQSSVVPSEAPVSSQAPPAQAQSSSLVSPSTSLAQASSDTAA
SSQATSAQAQTTPNLPSAAPSPVSTESKAPSQAPSVQPSGTGKMPDVIVPPNPAKTTATPQSAVPTSSVVSESKI
ESGIVIAPTGIVESSTKSSVVSVPTSADVPKPLTSKFSSSSVASVPTSVEAPVSSSKSILTPSDKPAPVTSNSKP
VETGSTVPSIVPSDKIPESSQVVNNTLVDSTAVPITQATPAPPSSGGLLDPIESLLTSIISGTIAFNSTQAPVET
AAPTSNSVPATEAPSKGLSSDVVPTPSKSLASSSAQGSSVASSVPVAPTAGTPSDILPIPDVNLTSSNVLPSLTA
VPTLSSGISSAAPITNLPTPSLDVPVVNGTSVEVPPIGAPTSVDISSSSKATPIIPITSVLSSAVQSPIVPTETP
VTNSTAPVDPTGLISSLSSGLPTTNAPVTSSTAVVEPPVVVTNSTNPVPTSVETSVPSSLSSVPSSEAPSASVAP
STGSSVSGSSSVSLPTSSAVETSVVPSSVATSASPSSDASTPASSGVVSSEAPSSAPSSAPSSAPSSAPSSVAST
RVSSVVGSSEAPSSAPAPTTALEPVTSIRPTGTLPGTENWLPSTIVISPSSTSSDDYTPPSSTTGRMSLPTGVPK
VLIPNQPPADPPKGDTETIQIGFLQPYDYVSVAGNVQAAGQIFGYLPMALACATGLQENQTQVFKIVPYQKTGQK
YLTALAKVHLPKMFVQTLSAALRSGNSDLYECRKPELRAPSEFTKLIDPNIPLTGSIETGDMSSGSTDLSGGAVP
SDVGSGSGSGGRQNGDPFSSNDKGDQSPMQKGQLVGIVSGAAAGAALYGVAMFLVARRYKRKKQSHRRSNSIAHS
QGSSEMRYNGTGSPALMGGALMSRDNVGYGAGGRDSRGSGRSGMGNSGRTANISAPVAAENSLGWN*
Coding >OphauB2|6065
ATGCATCTCAAGTCGATTGCTTTGGCTTCGACTTTGGCTCTGGCCGCCACTGTGGCTGCTGATGTTGAGCCCGAG
CGACCTCGAATTTACTTTCCACGAGAGGTCAAGCGCGATGTCGTCAACTCTACTCTGGCGGCACCCGAGACCGCT
GTGACGCCGTCCACCGATCTAGTCTCAAGCACAGGGCATGGATCTTCGTCCAAGAGAGGCATCGTTAGCGATCTT
CTTTCTCCCATCTTGGCCATATTGCCTACGGGCCCCTTCGGTGCTGCCTCGAGTAGTGCTCCTGCGGCCCAGACA
CCCCCAGCAGCCCAGACGCCACCAGTGGCCGCTTTTACGCCCCAACAGCCCGCCGGCGCATCGAGCAACGTTTTG
GTAAGGCCTACACAAGGCGCCGTCAACACTCCAGCCCAACCACCGGCTCAGGTTCAGCCCTCGGCTCCCGCCCAG
CCGCCAGTTCAGCCTCAGTCACCAGCACCGGTTCAGTCGTCGGCGCAAGCTAAGCCACCAGTCCAGGCTCAGTCT
TCGGCACAAGCTCAACCACCGGCTCAGGTCCAGTCTTCGGCTCAGGTTCAACCACCAGCTCAGGTTCAGTCTTCG
GCTCAGGTTCAACCACCAGCTCAGGTCCAGTCTTCGGCGCAAGCTCAGCCACCAGCGCAGGTTCAGTCTTCGGCA
CAAGCTCAGCCACCGGCTCAGGTTCAGTCTTCGGCCCAGGTTCAACCGCCGGCTCAGGTTCAGTCTTCTGCACAA
GCTCAACCACCAGCGCAGGCTCAATCTTCGGCACAAGCTCAACCACCGGCGCAGCAGCCTCAGTCATCAGCCCAG
ACTCAACCACCAGCACAGGTTCAGACATCTGCGTCGGCAAATGTGCCCTCTCAGAGCGTTCCATCTGTGGCTCAG
CCCTCGGAGCCTGCCCAGCCTGCTACGACAGCGATTCAGTCGTCTACTGAGGATAAACCTTCTAGCCAAATTGCT
CCGGTCCAGACTTCATCGACACCAGTCCAGTCCTCGGTGGTGCCCTCTGAGGCGCCTGTCAGCAGTCAGGCTCCT
CCAGCTCAAGCTCAGTCTTCGTCATTGGTTTCGCCGTCAACATCGCTGGCTCAGGCGTCATCTGATACTGCGGCC
TCTAGTCAAGCCACCTCGGCCCAAGCTCAAACGACACCAAACTTGCCTTCAGCAGCACCGTCTCCGGTCTCGACC
GAAAGCAAAGCCCCCAGCCAAGCTCCTTCGGTCCAGCCCTCGGGAACGGGCAAAATGCCAGACGTCATTGTTCCG
CCAAACCCTGCCAAAACGACTGCGACGCCCCAGTCTGCTGTTCCGACTTCGAGCGTCGTATCCGAGTCCAAAATT
GAGAGCGGCATAGTCATTGCTCCAACTGGCATTGTGGAGTCTAGCACCAAATCTAGTGTCGTCTCAGTCCCGACC
TCGGCTGATGTGCCCAAGCCATTGACAAGCAAATTTTCCTCGTCGAGCGTCGCTTCAGTGCCAACCTCTGTTGAA
GCTCCGGTGTCGAGCTCCAAGTCCATCTTGACGCCCTCGGACAAGCCCGCTCCCGTCACTTCCAACTCGAAACCT
GTTGAGACTGGCTCCACCGTACCTTCTATTGTCCCCTCTGATAAAATTCCTGAGTCCAGTCAGGTTGTCAACAAC
ACCTTGGTGGACTCGACGGCTGTTCCAATTACTCAAGCTACACCAGCTCCTCCTTCGAGCGGCGGACTTCTTGAC
CCTATTGAATCTCTATTGACAAGCATCATATCGGGCACAATTGCCTTCAACTCCACACAGGCCCCAGTTGAGACT
GCTGCGCCGACAAGCAACTCAGTTCCTGCAACTGAAGCGCCCAGCAAGGGCCTGTCGTCGGATGTCGTTCCCACA
CCATCCAAGTCTTTGGCCAGTAGCTCGGCCCAAGGCTCGTCGGTGGCGTCTTCGGTGCCAGTGGCACCAACCGCA
GGAACTCCTTCGGATATCCTTCCCATTCCCGATGTCAACTTGACTTCGTCGAATGTGTTGCCTTCCTTGACCGCT
GTGCCAACTCTTTCGAGCGGCATCAGCAGCGCGGCCCCCATTACCAACCTCCCTACACCAAGCTTGGACGTGCCA
GTCGTCAATGGGACAAGCGTTGAGGTGCCGCCTATTGGCGCTCCGACGTCTGTTGACATTAGCAGCAGCAGCAAA
GCTACCCCCATCATCCCCATCACTTCAGTCCTCAGCAGCGCTGTGCAATCCCCCATTGTGCCTACCGAGACTCCA
GTTACCAATAGCACTGCTCCTGTGGACCCCACTGGATTGATTTCGAGCTTGTCCAGTGGCTTGCCAACGACGAAT
GCTCCGGTGACGTCGTCGACTGCTGTCGTCGAACCGCCAGTGGTTGTCACCAACTCGACAAACCCTGTTCCGACG
TCGGTGGAGACTTCTGTGCCGTCGTCTCTCAGCTCTGTTCCATCATCAGAGGCACCATCTGCGTCTGTTGCCCCG
TCGACTGGCAGCTCGGTGAGTGGTTCGAGCAGCGTTTCTCTTCCAACGTCCAGTGCGGTCGAGACTAGTGTCGTG
CCGTCTTCGGTCGCTACATCTGCCTCGCCCAGCTCGGACGCTTCAACGCCGGCTTCGTCAGGCGTGGTCTCGTCG
GAAGCACCCAGTTCTGCACCCAGTTCAGCACCCAGTTCGGCACCCAGCTCGGCACCCAGTTCAGTGGCCTCAACA
CGTGTCTCGTCAGTCGTTGGCTCTTCGGAAGCACCCAGCTCTGCTCCTGCCCCAACAACAGCATTGGAGCCTGTC
ACGAGCATCCGCCCCACGGGAACTCTTCCGGGCACAGAAAACTGGCTTCCGTCGACGATTGTAATTTCACCAAGT
AGCACATCTTCGGACGACTACACTCCTCCGTCGTCTACGACAGGCCGCATGTCACTGCCAACCGGAGTACCCAAG
GTTCTGATTCCCAACCAGCCTCCTGCGGACCCTCCCAAGGGAGATACCGAAACTATCCAGATTGGATTCTTGCAA
CCCTATGACTATGTGTCAGTGGCTGGCAACGTCCAAGCTGCCGGACAAATCTTTGGCTATCTCCCCATGGCTCTT
GCCTGTGCCACGGGCCTGCAGGAGAACCAGACGCAGGTGTTCAAGATTGTGCCTTACCAAAAGACGGGGCAAAAG
TATCTCACTGCTCTTGCCAAGGTACACTTGCCCAAGATGTTTGTCCAAACACTCTCGGCTGCTCTTCGGTCGGGC
AACTCGGACTTGTATGAGTGCCGAAAGCCCGAGCTCAGGGCACCATCAGAGTTCACCAAGCTCATTGACCCGAAT
ATCCCACTGACGGGAAGCATTGAGACTGGTGACATGTCTAGCGGCTCCACTGATCTCTCTGGCGGTGCTGTTCCC
TCTGACGTGGGCTCGGGCTCGGGCTCTGGCGGACGTCAGAATGGCGACCCCTTTAGCTCCAATGACAAGGGCGAC
CAATCGCCCATGCAAAAGGGCCAGCTAGTGGGTATCGTGTCTGGTGCCGCCGCTGGTGCAGCATTGTATGGCGTT
GCCATGTTTCTTGTGGCACGGCGTTACAAGCGCAAGAAGCAGTCGCACCGTCGCTCCAATTCCATTGCGCACAGC
CAAGGATCTTCAGAGATGCGGTACAATGGGACGGGTAGCCCTGCTCTCATGGGAGGTGCCCTGATGAGCCGCGAC
AATGTCGGATACGGCGCCGGGGGACGAGACAGCCGCGGCAGTGGACGGAGCGGCATGGGCAACTCGGGCCGCACC
GCCAACATCTCGGCTCCTGTTGCAGCAGAGAACTCGCTGGGCTGGAACTAA
Transcript >OphauB2|6065
ATGCATCTCAAGTCGATTGCTTTGGCTTCGACTTTGGCTCTGGCCGCCACTGTGGCTGCTGATGTTGAGCCCGAG
CGACCTCGAATTTACTTTCCACGAGAGGTCAAGCGCGATGTCGTCAACTCTACTCTGGCGGCACCCGAGACCGCT
GTGACGCCGTCCACCGATCTAGTCTCAAGCACAGGGCATGGATCTTCGTCCAAGAGAGGCATCGTTAGCGATCTT
CTTTCTCCCATCTTGGCCATATTGCCTACGGGCCCCTTCGGTGCTGCCTCGAGTAGTGCTCCTGCGGCCCAGACA
CCCCCAGCAGCCCAGACGCCACCAGTGGCCGCTTTTACGCCCCAACAGCCCGCCGGCGCATCGAGCAACGTTTTG
GTAAGGCCTACACAAGGCGCCGTCAACACTCCAGCCCAACCACCGGCTCAGGTTCAGCCCTCGGCTCCCGCCCAG
CCGCCAGTTCAGCCTCAGTCACCAGCACCGGTTCAGTCGTCGGCGCAAGCTAAGCCACCAGTCCAGGCTCAGTCT
TCGGCACAAGCTCAACCACCGGCTCAGGTCCAGTCTTCGGCTCAGGTTCAACCACCAGCTCAGGTTCAGTCTTCG
GCTCAGGTTCAACCACCAGCTCAGGTCCAGTCTTCGGCGCAAGCTCAGCCACCAGCGCAGGTTCAGTCTTCGGCA
CAAGCTCAGCCACCGGCTCAGGTTCAGTCTTCGGCCCAGGTTCAACCGCCGGCTCAGGTTCAGTCTTCTGCACAA
GCTCAACCACCAGCGCAGGCTCAATCTTCGGCACAAGCTCAACCACCGGCGCAGCAGCCTCAGTCATCAGCCCAG
ACTCAACCACCAGCACAGGTTCAGACATCTGCGTCGGCAAATGTGCCCTCTCAGAGCGTTCCATCTGTGGCTCAG
CCCTCGGAGCCTGCCCAGCCTGCTACGACAGCGATTCAGTCGTCTACTGAGGATAAACCTTCTAGCCAAATTGCT
CCGGTCCAGACTTCATCGACACCAGTCCAGTCCTCGGTGGTGCCCTCTGAGGCGCCTGTCAGCAGTCAGGCTCCT
CCAGCTCAAGCTCAGTCTTCGTCATTGGTTTCGCCGTCAACATCGCTGGCTCAGGCGTCATCTGATACTGCGGCC
TCTAGTCAAGCCACCTCGGCCCAAGCTCAAACGACACCAAACTTGCCTTCAGCAGCACCGTCTCCGGTCTCGACC
GAAAGCAAAGCCCCCAGCCAAGCTCCTTCGGTCCAGCCCTCGGGAACGGGCAAAATGCCAGACGTCATTGTTCCG
CCAAACCCTGCCAAAACGACTGCGACGCCCCAGTCTGCTGTTCCGACTTCGAGCGTCGTATCCGAGTCCAAAATT
GAGAGCGGCATAGTCATTGCTCCAACTGGCATTGTGGAGTCTAGCACCAAATCTAGTGTCGTCTCAGTCCCGACC
TCGGCTGATGTGCCCAAGCCATTGACAAGCAAATTTTCCTCGTCGAGCGTCGCTTCAGTGCCAACCTCTGTTGAA
GCTCCGGTGTCGAGCTCCAAGTCCATCTTGACGCCCTCGGACAAGCCCGCTCCCGTCACTTCCAACTCGAAACCT
GTTGAGACTGGCTCCACCGTACCTTCTATTGTCCCCTCTGATAAAATTCCTGAGTCCAGTCAGGTTGTCAACAAC
ACCTTGGTGGACTCGACGGCTGTTCCAATTACTCAAGCTACACCAGCTCCTCCTTCGAGCGGCGGACTTCTTGAC
CCTATTGAATCTCTATTGACAAGCATCATATCGGGCACAATTGCCTTCAACTCCACACAGGCCCCAGTTGAGACT
GCTGCGCCGACAAGCAACTCAGTTCCTGCAACTGAAGCGCCCAGCAAGGGCCTGTCGTCGGATGTCGTTCCCACA
CCATCCAAGTCTTTGGCCAGTAGCTCGGCCCAAGGCTCGTCGGTGGCGTCTTCGGTGCCAGTGGCACCAACCGCA
GGAACTCCTTCGGATATCCTTCCCATTCCCGATGTCAACTTGACTTCGTCGAATGTGTTGCCTTCCTTGACCGCT
GTGCCAACTCTTTCGAGCGGCATCAGCAGCGCGGCCCCCATTACCAACCTCCCTACACCAAGCTTGGACGTGCCA
GTCGTCAATGGGACAAGCGTTGAGGTGCCGCCTATTGGCGCTCCGACGTCTGTTGACATTAGCAGCAGCAGCAAA
GCTACCCCCATCATCCCCATCACTTCAGTCCTCAGCAGCGCTGTGCAATCCCCCATTGTGCCTACCGAGACTCCA
GTTACCAATAGCACTGCTCCTGTGGACCCCACTGGATTGATTTCGAGCTTGTCCAGTGGCTTGCCAACGACGAAT
GCTCCGGTGACGTCGTCGACTGCTGTCGTCGAACCGCCAGTGGTTGTCACCAACTCGACAAACCCTGTTCCGACG
TCGGTGGAGACTTCTGTGCCGTCGTCTCTCAGCTCTGTTCCATCATCAGAGGCACCATCTGCGTCTGTTGCCCCG
TCGACTGGCAGCTCGGTGAGTGGTTCGAGCAGCGTTTCTCTTCCAACGTCCAGTGCGGTCGAGACTAGTGTCGTG
CCGTCTTCGGTCGCTACATCTGCCTCGCCCAGCTCGGACGCTTCAACGCCGGCTTCGTCAGGCGTGGTCTCGTCG
GAAGCACCCAGTTCTGCACCCAGTTCAGCACCCAGTTCGGCACCCAGCTCGGCACCCAGTTCAGTGGCCTCAACA
CGTGTCTCGTCAGTCGTTGGCTCTTCGGAAGCACCCAGCTCTGCTCCTGCCCCAACAACAGCATTGGAGCCTGTC
ACGAGCATCCGCCCCACGGGAACTCTTCCGGGCACAGAAAACTGGCTTCCGTCGACGATTGTAATTTCACCAAGT
AGCACATCTTCGGACGACTACACTCCTCCGTCGTCTACGACAGGCCGCATGTCACTGCCAACCGGAGTACCCAAG
GTTCTGATTCCCAACCAGCCTCCTGCGGACCCTCCCAAGGGAGATACCGAAACTATCCAGATTGGATTCTTGCAA
CCCTATGACTATGTGTCAGTGGCTGGCAACGTCCAAGCTGCCGGACAAATCTTTGGCTATCTCCCCATGGCTCTT
GCCTGTGCCACGGGCCTGCAGGAGAACCAGACGCAGGTGTTCAAGATTGTGCCTTACCAAAAGACGGGGCAAAAG
TATCTCACTGCTCTTGCCAAGGTACACTTGCCCAAGATGTTTGTCCAAACACTCTCGGCTGCTCTTCGGTCGGGC
AACTCGGACTTGTATGAGTGCCGAAAGCCCGAGCTCAGGGCACCATCAGAGTTCACCAAGCTCATTGACCCGAAT
ATCCCACTGACGGGAAGCATTGAGACTGGTGACATGTCTAGCGGCTCCACTGATCTCTCTGGCGGTGCTGTTCCC
TCTGACGTGGGCTCGGGCTCGGGCTCTGGCGGACGTCAGAATGGCGACCCCTTTAGCTCCAATGACAAGGGCGAC
CAATCGCCCATGCAAAAGGGCCAGCTAGTGGGTATCGTGTCTGGTGCCGCCGCTGGTGCAGCATTGTATGGCGTT
GCCATGTTTCTTGTGGCACGGCGTTACAAGCGCAAGAAGCAGTCGCACCGTCGCTCCAATTCCATTGCGCACAGC
CAAGGATCTTCAGAGATGCGGTACAATGGGACGGGTAGCCCTGCTCTCATGGGAGGTGCCCTGATGAGCCGCGAC
AATGTCGGATACGGCGCCGGGGGACGAGACAGCCGCGGCAGTGGACGGAGCGGCATGGGCAACTCGGGCCGCACC
GCCAACATCTCGGCTCCTGTTGCAGCAGAGAACTCGCTGGGCTGGAACTAA
Gene >OphauB2|6065
ATGCATCTCAAGTCGATTGCTTTGGCTTCGACTTTGGCTCTGGCCGCCACTGTGGCTGCTGATGTTGAGCCCGAG
CGACCTCGAATTTACTTTCCACGAGAGGTCAAGCGCGATGTCGTCAACTCTACTCTGGCGGCACCCGAGACCGCT
GTGACGCCGTCCACCGATCTAGTCTCAAGCACAGGGCATGGATCTTCGTCCAAGAGAGGCATCGTTAGCGATCTT
CTTTCTCCCATCTTGGCCATATTGCCTACGGGCCCCTTCGGTGCTGCCTCGAGTAGTGCTCCTGCGGCCCAGACA
CCCCCAGCAGCCCAGACGCCACCAGTGGCCGCTTTTACGCCCCAACAGCCCGCCGGCGCATCGAGCAACGTTTTG
GTAAGGCCTACACAAGGCGCCGTCAACACTCCAGCCCAACCACCGGCTCAGGTTCAGCCCTCGGCTCCCGCCCAG
CCGCCAGTTCAGCCTCAGTCACCAGCACCGGTTCAGTCGTCGGCGCAAGCTAAGCCACCAGTCCAGGCTCAGTCT
TCGGCACAAGCTCAACCACCGGCTCAGGTCCAGTCTTCGGCTCAGGTTCAACCACCAGCTCAGGTTCAGTCTTCG
GCTCAGGTTCAACCACCAGCTCAGGTCCAGTCTTCGGCGCAAGCTCAGCCACCAGCGCAGGTTCAGTCTTCGGCA
CAAGCTCAGCCACCGGCTCAGGTTCAGTCTTCGGCCCAGGTTCAACCGCCGGCTCAGGTTCAGTCTTCTGCACAA
GCTCAACCACCAGCGCAGGCTCAATCTTCGGCACAAGCTCAACCACCGGCGCAGCAGCCTCAGTCATCAGCCCAG
ACTCAACCACCAGCACAGGTTCAGACATCTGCGTCGGCAAATGTGCCCTCTCAGAGCGTTCCATCTGTGGCTCAG
CCCTCGGAGCCTGCCCAGCCTGCTACGACAGCGATTCAGTCGTCTACTGAGGATAAACCTTCTAGCCAAATTGCT
CCGGTCCAGACTTCATCGACACCAGTCCAGTCCTCGGTGGTGCCCTCTGAGGCGCCTGTCAGCAGTCAGGCTCCT
CCAGCTCAAGCTCAGTCTTCGTCATTGGTTTCGCCGTCAACATCGCTGGCTCAGGCGTCATCTGATACTGCGGCC
TCTAGTCAAGCCACCTCGGCCCAAGCTCAAACGACACCAAACTTGCCTTCAGCAGCACCGTCTCCGGTCTCGACC
GAAAGCAAAGCCCCCAGCCAAGCTCCTTCGGTCCAGCCCTCGGGAACGGGCAAAATGCCAGACGTCATTGTTCCG
CCAAACCCTGCCAAAACGACTGCGACGCCCCAGTCTGCTGTTCCGACTTCGAGCGTCGTATCCGAGTCCAAAATT
GAGAGCGGCATAGTCATTGCTCCAACTGGCATTGTGGAGTCTAGCACCAAATCTAGTGTCGTCTCAGTCCCGACC
TCGGCTGATGTGCCCAAGCCATTGACAAGCAAATTTTCCTCGTCGAGCGTCGCTTCAGTGCCAACCTCTGTTGAA
GCTCCGGTGTCGAGCTCCAAGTCCATCTTGACGCCCTCGGACAAGCCCGCTCCCGTCACTTCCAACTCGAAACCT
GTTGAGACTGGCTCCACCGTACCTTCTATTGTCCCCTCTGATAAAATTCCTGAGTCCAGTCAGGTTGTCAACAAC
ACCTTGGTGGACTCGACGGCTGTTCCAATTACTCAAGCTACACCAGCTCCTCCTTCGAGCGGCGGACTTCTTGAC
CCTATTGAATCTCTATTGACAAGCATCATATCGGGCACAATTGCCTTCAACTCCACACAGGCCCCAGTTGAGACT
GCTGCGCCGACAAGCAACTCAGTTCCTGCAACTGAAGCGCCCAGCAAGGGCCTGTCGTCGGATGTCGTTCCCACA
CCATCCAAGTCTTTGGCCAGTAGCTCGGCCCAAGGCTCGTCGGTGGCGTCTTCGGTGCCAGTGGCACCAACCGCA
GGAACTCCTTCGGATATCCTTCCCATTCCCGATGTCAACTTGACTTCGTCGAATGTGTTGCCTTCCTTGACCGCT
GTGCCAACTCTTTCGAGCGGCATCAGCAGCGCGGCCCCCATTACCAACCTCCCTACACCAAGCTTGGACGTGCCA
GTCGTCAATGGGACAAGCGTTGAGGTGCCGCCTATTGGCGCTCCGACGTCTGTTGACATTAGCAGCAGCAGCAAA
GCTACCCCCATCATCCCCATCACTTCAGTCCTCAGCAGCGCTGTGCAATCCCCCATTGTGCCTACCGAGACTCCA
GTTACCAATAGCACTGCTCCTGTGGACCCCACTGGATTGATTTCGAGCTTGTCCAGTGGCTTGCCAACGACGAAT
GCTCCGGTGACGTCGTCGACTGCTGTCGTCGAACCGCCAGTGGTTGTCACCAACTCGACAAACCCTGTTCCGACG
TCGGTGGAGACTTCTGTGCCGTCGTCTCTCAGCTCTGTTCCATCATCAGAGGCACCATCTGCGTCTGTTGCCCCG
TCGACTGGCAGCTCGGTGAGTGGTTCGAGCAGCGTTTCTCTTCCAACGTCCAGTGCGGTCGAGACTAGTGTCGTG
CCGTCTTCGGTCGCTACATCTGCCTCGCCCAGCTCGGACGCTTCAACGCCGGCTTCGTCAGGCGTGGTCTCGTCG
GAAGCACCCAGTTCTGCACCCAGTTCAGCACCCAGTTCGGCACCCAGCTCGGCACCCAGTTCAGTGGCCTCAACA
CGTGTCTCGTCAGTCGTTGGCTCTTCGGAAGCACCCAGCTCTGCTCCTGCCCCAACAACAGCATTGGAGCCTGTC
ACGAGCATCCGCCCCACGGGAACTCTTCCGGGCACAGAAAACTGGCTTCCGTCGACGATTGTAATTTCACCAAGT
AGCACATCTTCGGACGACTACACTCCTCCGTCGTCTACGACAGGCCGCATGTCACTGCCAACCGGAGTACCCAAG
GTTCTGATTCCCAACCAGCCTCCTGCGGACCCTCCCAAGGGAGATACCGAAACTATCCAGATTGGATTCTTGCAA
CCCTATGACTATGTGTCAGTGGCTGGCAACGTCCAAGCTGCCGGACAAATCTTTGGCTATCTCCCCATGGCTCTT
GCCTGTGCCACGGGCCTGCAGGAGAACCAGACGCAGGTGTTCAAGATTGTGCCTTACCAAAAGACGGGGCAAAAG
TATCTCACTGCTCTTGCCAAGGTACACTTGCCCAAGATGTTTGTCCAAACACTCTCGGCTGCTCTTCGGTCGGGC
AACTCGGACTTGTATGAGTGCCGAAAGCCCGAGCTCAGGGCACCATCAGAGTTCACCAAGCTCATTGACCCGAAT
ATCCCACTGACGGGAAGCATTGAGACTGGTGACATGTCTAGCGGCTCCACTGATCTCTCTGGCGGTGCTGTTCCC
TCTGACGTGGGCTCGGGCTCGGGCTCTGGCGGACGTCAGAATGGCGACCCCTTTAGCTCCAATGACAAGGGCGAC
CAATCGCCCATGCAAAAGGGCCAGCTAGTGGGTATCGTGTCTGGTGCCGCCGCTGGTGCAGCATTGTATGGCGTT
GCCATGTTTCTTGTGGCACGGCGTTACAAGCGCAAGAAGCAGTCGCACCGTCGCTCCAATTCCATTGCGCACAGC
CAAGGATCTTCAGAGATGCGGTACAATGGGACGGGTAGCCCTGCTCTCATGGGAGGTGCCCTGATGAGCCGCGAC
AATGTCGGATACGGCGCCGGGGGACGAGACAGCCGCGGCAGTGGACGGAGCGGCATGGGCAACTCGGGCCGCACC
GCCAACATCTCGGCTCCTGTTGCAGCAGAGAACTCGCTGGGCTGGAACTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail