Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|6060
Gene name
LocationContig_51:70204..72260
Strand+
Gene length (bp)2056
Transcript length (bp)1878
Coding sequence length (bp)1878
Protein length (aa) 626

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00264 Tyrosinase Common central domain of tyrosinase 1.2E-48 94 349
PF18132 Tyosinase_C Tyosinase C-terminal domain 1.9E-29 481 597

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q92396|TYRO_PODAS Tyrosinase OS=Podospora anserina GN=TYR PE=2 SV=1 56 561 2.0E-88
sp|P00440|TYRO_NEUCR Tyrosinase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=T PE=1 SV=5 52 486 3.0E-78
sp|A7BHQ9|TYRO_PHONA Tyrosinase OS=Pholiota nameko GN=tyr1 PE=1 SV=1 44 615 7.0E-76
sp|Q00024|PPO1_AGABI Polyphenol oxidase 1 OS=Agaricus bisporus GN=PPO1 PE=2 SV=1 57 597 1.0E-68
sp|O42713|PPO2_AGABI Polyphenol oxidase 2 OS=Agaricus bisporus GN=PPO2 PE=2 SV=1 57 570 3.0E-61
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q92396|TYRO_PODAS Tyrosinase OS=Podospora anserina GN=TYR PE=2 SV=1 56 561 2.0E-88
sp|P00440|TYRO_NEUCR Tyrosinase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=T PE=1 SV=5 52 486 3.0E-78
sp|A7BHQ9|TYRO_PHONA Tyrosinase OS=Pholiota nameko GN=tyr1 PE=1 SV=1 44 615 7.0E-76
sp|Q00024|PPO1_AGABI Polyphenol oxidase 1 OS=Agaricus bisporus GN=PPO1 PE=2 SV=1 57 597 1.0E-68
sp|O42713|PPO2_AGABI Polyphenol oxidase 2 OS=Agaricus bisporus GN=PPO2 PE=2 SV=1 57 570 3.0E-61
sp|C7FF05|PPO4_AGABI Polyphenol oxidase 4 OS=Agaricus bisporus GN=PPO4 PE=2 SV=1 57 622 4.0E-55
sp|C7FF04|PPO3_AGABI Polyphenol oxidase 3 OS=Agaricus bisporus GN=PPO3 PE=1 SV=1 57 609 6.0E-53
sp|Q8J130|TYRO_ASPFU Tyrosinase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=tyr1 PE=3 SV=2 47 566 1.0E-47
sp|Q00234|TYRO_ASPOR Tyrosinase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=melO PE=1 SV=1 62 418 2.0E-16
sp|P00440|TYRO_NEUCR Tyrosinase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=T PE=1 SV=5 450 604 7.0E-10
[Show less]

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0003824 catalytic activity No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 25 0.45

Transmembrane Domains

Domain # Start End Length
1 5 27 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|6060
MLNRIASVVLFGCTLNLVVAFAHAQGYNFGIDISRLTRRQDAASRVIVGKLPLASNGSIPLRVEIRQLRADQLKW
DLFILALSMFQSMDQDDPLSWYQIAGIHGVPFQPWNGVEAVAGANRSGYCTHNSVLFPMWHRPYMALFEQRLFKM
ANAIAGMFGNETQRWQYQQAASDFRMPYWDWSRSAPKGQTHFPDVFWNAVIEQNGPNGVQKIRNPLYSYQFHPLD
QDALIWKPIKEWNETKRAPQTEISKIAPPSDNDKVNAALLAKLPEIQQRLYILFSSYHDFNSFSNKGWAASQGLK
TLDSIESVHDVIHLYGGSKGHLTYVPLSSFDPLFWLHHTMTDRLIAMWQILNPTAWVAPMRAGETSYTAVNGTLQ
TSDTPLTPFFASDDGIFWTSNSARSTETFGYTYPETNPSLGSLEDIRKSLVQLISDWYGPASPVGLLKQGQNDGL
TASPLSHVSSMKLSAANGHGSHTSKGAMYTEWIANVQVKSGALDGSYGVHLFVGEPPVDTADWLKASNLAGSVAI
FSMKHMEGSSSKISGAVPLTRALMKLAAAEGLGDLSPATVTPFLRGSLQVRVLAGDEKQVDPADIEGLHVEIRSA
RVMVPDGKAELPVWGPSVMRLEPWV*
Coding >OphauB2|6060
ATGCTTAATAGGATAGCCAGCGTTGTGCTCTTTGGCTGCACACTTAATCTTGTCGTTGCCTTTGCCCACGCTCAG
GGCTACAATTTCGGCATTGACATTTCTAGACTGACGCGCAGGCAGGATGCCGCGTCGCGCGTCATTGTCGGCAAG
CTGCCGCTGGCCAGCAATGGCAGCATTCCGCTTAGAGTCGAGATTCGCCAATTGCGAGCCGACCAACTCAAGTGG
GATCTCTTCATCCTGGCACTGAGCATGTTTCAATCCATGGACCAAGACGATCCGCTTTCGTGGTATCAGATTGCT
GGTATTCACGGCGTGCCATTTCAACCCTGGAACGGGGTCGAGGCAGTGGCAGGGGCTAACAGGTCGGGCTACTGT
ACACACAATTCGGTTCTCTTTCCCATGTGGCACCGGCCCTACATGGCCCTGTTCGAGCAACGACTGTTCAAGATG
GCAAACGCAATTGCCGGCATGTTTGGCAACGAGACACAGAGGTGGCAATACCAGCAGGCAGCTTCCGACTTTCGC
ATGCCCTATTGGGACTGGTCCAGGAGCGCTCCCAAGGGTCAGACGCATTTCCCCGATGTCTTTTGGAACGCCGTC
ATTGAGCAAAATGGCCCCAATGGAGTGCAAAAGATTCGAAACCCACTCTACTCGTATCAGTTTCATCCGTTGGAC
CAAGACGCCCTCATATGGAAACCGATCAAGGAGTGGAATGAGACCAAGAGGGCGCCGCAGACAGAAATTAGCAAG
ATCGCACCACCTTCAGATAATGACAAGGTCAATGCAGCATTGCTTGCAAAGCTTCCAGAAATTCAACAGAGACTC
TACATTCTCTTTTCCAGTTACCATGATTTCAACTCATTTAGCAACAAGGGATGGGCAGCCTCGCAGGGCCTCAAG
ACCCTCGACTCGATTGAATCGGTTCACGACGTCATTCACCTCTATGGTGGCTCTAAGGGACACTTGACCTACGTT
CCGCTCTCATCGTTTGACCCCCTCTTTTGGCTCCACCACACCATGACGGATCGCCTTATTGCCATGTGGCAGATT
CTCAACCCAACAGCCTGGGTCGCGCCCATGAGGGCGGGGGAGACTAGCTACACTGCTGTAAATGGCACTCTGCAG
ACGTCTGACACACCCCTCACACCCTTTTTCGCATCCGACGACGGCATCTTCTGGACCTCCAACTCGGCCAGGAGC
ACAGAAACGTTTGGATACACGTATCCCGAGACGAATCCGTCGCTCGGGTCTCTGGAGGACATTCGCAAGTCACTG
GTGCAGCTGATTTCCGATTGGTACGGGCCAGCGAGTCCCGTCGGACTGTTGAAGCAAGGGCAAAATGATGGCCTG
ACCGCTTCCCCTCTGTCACATGTGTCCAGCATGAAGCTGAGCGCAGCCAATGGACATGGCTCTCACACGTCCAAG
GGCGCCATGTATACGGAGTGGATCGCCAACGTGCAGGTCAAGTCGGGGGCGCTCGACGGCTCGTACGGAGTCCAT
CTTTTTGTTGGAGAGCCACCGGTCGACACGGCAGACTGGCTCAAGGCGTCGAACCTGGCAGGATCAGTGGCCATC
TTCTCCATGAAGCACATGGAGGGCTCGTCTTCCAAGATATCGGGCGCAGTGCCCTTGACGCGGGCCCTGATGAAG
CTAGCAGCGGCTGAGGGGCTTGGGGACCTGTCACCGGCCACTGTGACACCCTTCCTCCGCGGATCGTTGCAGGTC
CGGGTGCTGGCAGGTGACGAGAAGCAGGTGGACCCGGCCGACATCGAGGGGCTACACGTGGAGATCCGCAGCGCC
CGAGTCATGGTTCCCGATGGCAAGGCGGAGCTGCCGGTTTGGGGACCGTCAGTCATGAGGCTGGAGCCGTGGGTG
TGA
Transcript >OphauB2|6060
ATGCTTAATAGGATAGCCAGCGTTGTGCTCTTTGGCTGCACACTTAATCTTGTCGTTGCCTTTGCCCACGCTCAG
GGCTACAATTTCGGCATTGACATTTCTAGACTGACGCGCAGGCAGGATGCCGCGTCGCGCGTCATTGTCGGCAAG
CTGCCGCTGGCCAGCAATGGCAGCATTCCGCTTAGAGTCGAGATTCGCCAATTGCGAGCCGACCAACTCAAGTGG
GATCTCTTCATCCTGGCACTGAGCATGTTTCAATCCATGGACCAAGACGATCCGCTTTCGTGGTATCAGATTGCT
GGTATTCACGGCGTGCCATTTCAACCCTGGAACGGGGTCGAGGCAGTGGCAGGGGCTAACAGGTCGGGCTACTGT
ACACACAATTCGGTTCTCTTTCCCATGTGGCACCGGCCCTACATGGCCCTGTTCGAGCAACGACTGTTCAAGATG
GCAAACGCAATTGCCGGCATGTTTGGCAACGAGACACAGAGGTGGCAATACCAGCAGGCAGCTTCCGACTTTCGC
ATGCCCTATTGGGACTGGTCCAGGAGCGCTCCCAAGGGTCAGACGCATTTCCCCGATGTCTTTTGGAACGCCGTC
ATTGAGCAAAATGGCCCCAATGGAGTGCAAAAGATTCGAAACCCACTCTACTCGTATCAGTTTCATCCGTTGGAC
CAAGACGCCCTCATATGGAAACCGATCAAGGAGTGGAATGAGACCAAGAGGGCGCCGCAGACAGAAATTAGCAAG
ATCGCACCACCTTCAGATAATGACAAGGTCAATGCAGCATTGCTTGCAAAGCTTCCAGAAATTCAACAGAGACTC
TACATTCTCTTTTCCAGTTACCATGATTTCAACTCATTTAGCAACAAGGGATGGGCAGCCTCGCAGGGCCTCAAG
ACCCTCGACTCGATTGAATCGGTTCACGACGTCATTCACCTCTATGGTGGCTCTAAGGGACACTTGACCTACGTT
CCGCTCTCATCGTTTGACCCCCTCTTTTGGCTCCACCACACCATGACGGATCGCCTTATTGCCATGTGGCAGATT
CTCAACCCAACAGCCTGGGTCGCGCCCATGAGGGCGGGGGAGACTAGCTACACTGCTGTAAATGGCACTCTGCAG
ACGTCTGACACACCCCTCACACCCTTTTTCGCATCCGACGACGGCATCTTCTGGACCTCCAACTCGGCCAGGAGC
ACAGAAACGTTTGGATACACGTATCCCGAGACGAATCCGTCGCTCGGGTCTCTGGAGGACATTCGCAAGTCACTG
GTGCAGCTGATTTCCGATTGGTACGGGCCAGCGAGTCCCGTCGGACTGTTGAAGCAAGGGCAAAATGATGGCCTG
ACCGCTTCCCCTCTGTCACATGTGTCCAGCATGAAGCTGAGCGCAGCCAATGGACATGGCTCTCACACGTCCAAG
GGCGCCATGTATACGGAGTGGATCGCCAACGTGCAGGTCAAGTCGGGGGCGCTCGACGGCTCGTACGGAGTCCAT
CTTTTTGTTGGAGAGCCACCGGTCGACACGGCAGACTGGCTCAAGGCGTCGAACCTGGCAGGATCAGTGGCCATC
TTCTCCATGAAGCACATGGAGGGCTCGTCTTCCAAGATATCGGGCGCAGTGCCCTTGACGCGGGCCCTGATGAAG
CTAGCAGCGGCTGAGGGGCTTGGGGACCTGTCACCGGCCACTGTGACACCCTTCCTCCGCGGATCGTTGCAGGTC
CGGGTGCTGGCAGGTGACGAGAAGCAGGTGGACCCGGCCGACATCGAGGGGCTACACGTGGAGATCCGCAGCGCC
CGAGTCATGGTTCCCGATGGCAAGGCGGAGCTGCCGGTTTGGGGACCGTCAGTCATGAGGCTGGAGCCGTGGGTG
TGA
Gene >OphauB2|6060
ATGCTTAATAGGATAGCCAGCGTTGTGCTCTTTGGCTGCACACTTAATCTTGTCGTTGCCTTTGCCCACGCTCAG
GGCTACAATTTCGGCATTGACATTTCTAGACTGACGCGCAGGCAGGATGCCGCGTCGCGCGTCATTGTCGGCAAG
CTGCCGCTGGCCAGCAATGGCAGCATTCCGCTTAGAGTCGAGATTCGCCAATTGCGAGCCGACCAACTCAAGTGG
GATCTCTTCATCCTGGCACTGAGCATGTTTCAATCCATGGACCAAGACGATCCGCTTTCGTGGTATCAGATTGCT
GGTGAGGAGCAACATGGGGGTCCTGTTGCACTCTGGGGCGCTGACGCATCTCGACTGAATAGGTATTCACGGCGT
GCCATTTCAACCCTGGAACGGGGTCGAGGCAGTGGCAGGGGCTAACAGGTCGGGCTACTGTACACACAATTCGGT
TCTCTTTCCCATGTGGCACCGGCCCTACATGGCCCTGTTCGAGGTGAATCTTGTTCAACGGTCGCTTAGGCAGAC
TGGGGTGCAACGCTGACTGGCCATTATGTAGCAACGACTGTTCAAGATGGCAAACGCAATTGCCGGCATGTTTGG
CAACGAGACACAGAGGTGGCAATACCAGCAGGCAGCTTCCGACTTTCGCATGCCCTATTGGGACTGGTCCAGGAG
CGCTCCCAAGGGTCAGACGCATTTCCCCGATGTCTTTTGGAACGCCGTCATTGAGCAAAATGGCCCCAATGGAGT
GCAAAAGATTCGAAACCCACTCTACTCGTATCAGTTTCATCCGTTGGACCAAGACGCCCTCATATGGAAACCGGT
AGGCGGTGCCGGCCCTGGGTTCGGATGATGCGGCTACTGACTCTTTGAGTAGATCAAGGAGTGGAATGAGACCAA
GAGGGCGCCGCAGACAGAAATTAGCAAGATCGCACCACCTTCAGATAATGACAAGGTCAATGCAGCATTGCTTGC
AAAGCTTCCAGAAATTCAACAGAGACTCTACATTCTCTTTTCCAGTTACCATGATTTCAACTCATTTAGCAACAA
GGGATGGGCAGCCTCGCAGGGCCTCAAGACCCTCGACTCGATTGAATCGGTTCACGACGTCATTCACCTCTATGG
TGGCTCTAAGGGACACTTGACCTACGTTCCGCTCTCATCGTTTGACCCCCTCTTTTGGCTCCACCACACCATGAC
GGATCGCCTTATTGCCATGTGGCAGATTCTCAACCCAACAGCCTGGGTCGCGCCCATGAGGGCGGGGGAGACTAG
CTACACTGCTGTAAATGGCACTCTGCAGACGTCTGACACACCCCTCACACCCTTTTTCGCATCCGACGACGGCAT
CTTCTGGACCTCCAACTCGGCCAGGAGCACAGAAACGTTTGGATACACGTATCCCGAGACGAATCCGTCGCTCGG
GTCTCTGGAGGACATTCGCAAGTCACTGGTGCAGCTGATTTCCGATTGGTACGGGCCAGCGAGTCCCGTCGGACT
GTTGAAGCAAGGGCAAAATGATGGCCTGACCGCTTCCCCTCTGTCACATGTGTCCAGCATGAAGCTGAGCGCAGC
CAATGGACATGGCTCTCACACGTCCAAGGGCGCCATGTATACGGAGTGGATCGCCAACGTGCAGGTCAAGTCGGG
GGCGCTCGACGGCTCGTACGGAGTCCATCTTTTTGTTGGAGAGCCACCGGTCGACACGGCAGACTGGCTCAAGGC
GTCGAACCTGGCAGGATCAGTGGCCATCTTCTCCATGAAGCACATGGAGGGCTCGTCTTCCAAGATATCGGGCGC
AGTGCCCTTGACGCGGGCCCTGATGAAGCTAGCAGCGGCTGAGGGGCTTGGGGACCTGTCACCGGCCACTGTGAC
ACCCTTCCTCCGCGGATCGTTGCAGGTCCGGGTGCTGGCAGGTGACGAGAAGCAGGTGGACCCGGCCGACATCGA
GGGGCTACACGTGGAGATCCGCAGCGCCCGAGTCATGGTTCCCGATGGCAAGGCGGAGCTGCCGGTTTGGGGACC
GTCAGTCATGAGGCTGGAGCCGTGGGTGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail