Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|6049
Gene name
LocationContig_51:37027..39908
Strand-
Gene length (bp)2881
Transcript length (bp)2373
Coding sequence length (bp)2373
Protein length (aa) 791

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00930 DPPIV_N Dipeptidyl peptidase IV (DPP IV) N-terminal region 1.6E-40 153 279
PF00930 DPPIV_N Dipeptidyl peptidase IV (DPP IV) N-terminal region 6.9E-38 289 467
PF00326 Peptidase_S9 Prolyl oligopeptidase family 6.2E-53 554 758

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|C1GT79|DAPB_PARBA Probable dipeptidyl-aminopeptidase B OS=Paracoccidioides lutzii (strain ATCC MYA-826 / Pb01) GN=DAPB PE=3 SV=1 27 775 0.0E+00
sp|B8N076|DAPB_ASPFN Probable dipeptidyl-aminopeptidase B OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=dapB PE=3 SV=1 76 772 0.0E+00
sp|B6QVW4|DAPB_TALMQ Probable dipeptidyl-aminopeptidase B OS=Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) GN=dapB PE=3 SV=1 27 760 0.0E+00
sp|D5GM60|DAPB_TUBMM Probable dipeptidyl-aminopeptidase B OS=Tuber melanosporum (strain Mel28) GN=DAPB PE=3 SV=1 50 775 0.0E+00
sp|B8MTH6|DAPB_TALSN Probable dipeptidyl-aminopeptidase B OS=Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) GN=dapB PE=3 SV=1 75 760 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|C1GT79|DAPB_PARBA Probable dipeptidyl-aminopeptidase B OS=Paracoccidioides lutzii (strain ATCC MYA-826 / Pb01) GN=DAPB PE=3 SV=1 27 775 0.0E+00
sp|B8N076|DAPB_ASPFN Probable dipeptidyl-aminopeptidase B OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=dapB PE=3 SV=1 76 772 0.0E+00
sp|B6QVW4|DAPB_TALMQ Probable dipeptidyl-aminopeptidase B OS=Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) GN=dapB PE=3 SV=1 27 760 0.0E+00
sp|D5GM60|DAPB_TUBMM Probable dipeptidyl-aminopeptidase B OS=Tuber melanosporum (strain Mel28) GN=DAPB PE=3 SV=1 50 775 0.0E+00
sp|B8MTH6|DAPB_TALSN Probable dipeptidyl-aminopeptidase B OS=Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) GN=dapB PE=3 SV=1 75 760 0.0E+00
sp|C1FZL3|DAPB_PARBD Probable dipeptidyl-aminopeptidase B OS=Paracoccidioides brasiliensis (strain Pb18) GN=DAPB PE=3 SV=1 27 775 0.0E+00
sp|C0S7H1|DAPB_PARBP Probable dipeptidyl-aminopeptidase B OS=Paracoccidioides brasiliensis (strain Pb03) GN=DAPB PE=3 SV=2 27 775 0.0E+00
sp|C5FYZ3|DAPB_ARTOC Probable dipeptidyl-aminopeptidase B OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=DAPB PE=3 SV=1 87 776 0.0E+00
sp|A1CJQ1|DAPB_ASPCL Probable dipeptidyl-aminopeptidase B OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=dapB PE=3 SV=1 68 776 0.0E+00
sp|B2WC36|DAPB_PYRTR Probable dipeptidyl-aminopeptidase B OS=Pyrenophora tritici-repentis (strain Pt-1C-BFP) GN=dapB PE=3 SV=1 64 776 0.0E+00
sp|E9CUF4|DAPB_COCPS Probable dipeptidyl-aminopeptidase B OS=Coccidioides posadasii (strain RMSCC 757 / Silveira) GN=DAPB PE=3 SV=1 87 775 0.0E+00
sp|C5P334|DAPB_COCP7 Probable dipeptidyl-aminopeptidase B OS=Coccidioides posadasii (strain C735) GN=DAPB PE=3 SV=1 87 775 0.0E+00
sp|Q2UPW4|DAPB_ASPOR Probable dipeptidyl-aminopeptidase B OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=dapB PE=3 SV=1 76 772 0.0E+00
sp|E4UYL6|DAPB_ARTGP Probable dipeptidyl-aminopeptidase B OS=Arthroderma gypseum (strain ATCC MYA-4604 / CBS 118893) GN=DAPB PE=3 SV=1 78 776 0.0E+00
sp|C0NUQ8|DAPB_AJECG Probable dipeptidyl-aminopeptidase B OS=Ajellomyces capsulatus (strain G186AR / H82 / ATCC MYA-2454 / RMSCC 2432) GN=DAPB PE=3 SV=1 87 775 0.0E+00
sp|C6HRC7|DAPB_AJECH Probable dipeptidyl-aminopeptidase B OS=Ajellomyces capsulatus (strain H143) GN=DAPB PE=3 SV=1 87 775 0.0E+00
sp|F0U7H7|DAPB_AJEC8 Probable dipeptidyl-aminopeptidase B OS=Ajellomyces capsulatus (strain H88) GN=DAPB PE=3 SV=1 87 775 0.0E+00
sp|C5JC30|DAPB_AJEDS Probable dipeptidyl-aminopeptidase B OS=Ajellomyces dermatitidis (strain SLH14081) GN=DAPB PE=3 SV=1 27 775 0.0E+00
sp|C5GVF3|DAPB_AJEDR Probable dipeptidyl-aminopeptidase B OS=Ajellomyces dermatitidis (strain ER-3 / ATCC MYA-2586) GN=DAPB PE=3 SV=1 27 775 0.0E+00
sp|A6RBI0|DAPB_AJECN Probable dipeptidyl-aminopeptidase B OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=DAPB PE=3 SV=1 87 776 0.0E+00
sp|D4AQT0|DAPB_ARTBC Probable dipeptidyl-aminopeptidase B OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=DAPB PE=3 SV=1 86 747 0.0E+00
sp|D4DCG0|DAPB_TRIVH Probable dipeptidyl-aminopeptidase B OS=Trichophyton verrucosum (strain HKI 0517) GN=DAPB PE=3 SV=1 86 747 0.0E+00
sp|E9ETL5|DAPB_METRA Probable dipeptidyl-aminopeptidase B OS=Metarhizium robertsii (strain ARSEF 23 / ATCC MYA-3075) GN=DAPB PE=3 SV=2 26 775 0.0E+00
sp|A6SL49|DAPB_BOTFB Probable dipeptidyl-aminopeptidase B OS=Botryotinia fuckeliana (strain B05.10) GN=dapB PE=3 SV=1 1 770 0.0E+00
sp|E9ED72|DAPB_METAQ Probable dipeptidyl-aminopeptidase B OS=Metarhizium acridum (strain CQMa 102) GN=DAPB PE=3 SV=1 3 775 0.0E+00
sp|C7YYG9|DAPB_NECH7 Probable dipeptidyl-aminopeptidase B OS=Nectria haematococca (strain 77-13-4 / ATCC MYA-4622 / FGSC 9596 / MPVI) GN=DAPB PE=3 SV=1 8 768 0.0E+00
sp|Q7SHU8|DAPB_NEUCR Probable dipeptidyl-aminopeptidase B OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=dapB PE=3 SV=2 34 778 0.0E+00
sp|E3QKD2|DAPB_COLGM Probable dipeptidyl-aminopeptidase B OS=Colletotrichum graminicola (strain M1.001 / M2 / FGSC 10212) GN=DAPB PE=3 SV=1 25 776 0.0E+00
sp|D1Z9B4|DAPB_SORMK Probable dipeptidyl-aminopeptidase B OS=Sordaria macrospora (strain ATCC MYA-333 / DSM 997 / K(L3346) / K-hell) GN=DAPB PE=3 SV=1 34 775 0.0E+00
sp|A4QYQ5|DAPB_MAGO7 Probable dipeptidyl-aminopeptidase B OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=DAPB PE=3 SV=1 30 775 0.0E+00
sp|Q2HF90|DAPB_CHAGB Probable dipeptidyl-aminopeptidase B OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=DAPB PE=3 SV=1 34 773 0.0E+00
sp|B2A951|DAPB_PODAN Probable dipeptidyl-aminopeptidase B OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=DAPB PE=3 SV=1 29 782 0.0E+00
sp|F0XS04|DAPB_GROCL Probable dipeptidyl-aminopeptidase B OS=Grosmannia clavigera (strain kw1407 / UAMH 11150) GN=DAPB PE=3 SV=1 16 771 0.0E+00
sp|A7EQZ1|DAPB_SCLS1 Probable dipeptidyl-aminopeptidase B OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=dapB PE=3 SV=1 1 769 0.0E+00
sp|B6HFS8|DAPB_PENRW Probable dipeptidyl-aminopeptidase B OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=dapB PE=3 SV=1 77 768 0.0E+00
sp|Q0UVK7|DAPB_PHANO Probable dipeptidyl-aminopeptidase B OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=DAPB PE=3 SV=1 60 768 0.0E+00
sp|Q5B934|DAPB_EMENI Probable dipeptidyl-aminopeptidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=dapB PE=3 SV=2 69 776 0.0E+00
sp|A2QEK7|DAPB_ASPNC Probable dipeptidyl-aminopeptidase B OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=dapB PE=3 SV=1 88 777 0.0E+00
sp|Q96VT7|DAPB_ASPNG Dipeptidyl-aminopeptidase B OS=Aspergillus niger GN=dapB PE=3 SV=1 88 777 0.0E+00
sp|C4JHY5|DAPB_UNCRE Probable dipeptidyl-aminopeptidase B OS=Uncinocarpus reesii (strain UAMH 1704) GN=DAPB PE=3 SV=1 25 775 0.0E+00
sp|E3S9K3|DAPB_PYRTT Probable dipeptidyl-aminopeptidase B OS=Pyrenophora teres f. teres (strain 0-1) GN=dapB PE=3 SV=1 64 776 0.0E+00
sp|C9SJ15|DAPB_VERA1 Probable dipeptidyl-aminopeptidase B OS=Verticillium alfalfae (strain VaMs.102 / ATCC MYA-4576 / FGSC 10136) GN=DAPB PE=3 SV=1 26 768 0.0E+00
sp|A1D7R6|DAPB_NEOFI Probable dipeptidyl-aminopeptidase B OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=dapB PE=3 SV=1 29 776 0.0E+00
sp|Q4WX13|DAPB_ASPFU Probable dipeptidyl-aminopeptidase B OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=dapB PE=3 SV=2 20 776 0.0E+00
sp|Q0CXB1|DAPB_ASPTN Probable dipeptidyl-aminopeptidase B OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=dapB PE=3 SV=1 76 776 0.0E+00
sp|B0XYK8|DAPB_ASPFC Probable dipeptidyl-aminopeptidase B OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=dapB PE=3 SV=1 20 776 0.0E+00
sp|P18962|DAP2_YEAST Dipeptidyl aminopeptidase B OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DAP2 PE=1 SV=2 63 762 6.0E-165
sp|O14073|YEA8_SCHPO Putative dipeptidyl aminopeptidase C2E11.08 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC2E11.08 PE=3 SV=1 90 756 2.0E-143
sp|Q2UH35|DPP4_ASPOR Dipeptidyl peptidase 4 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=dpp4 PE=1 SV=1 68 748 1.0E-140
sp|B8N970|DPP4_ASPFN Probable dipeptidyl peptidase 4 OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=dpp4 PE=3 SV=1 68 748 1.0E-140
sp|Q4WPH9|DPP4_ASPFU Probable dipeptidyl peptidase 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=dpp4 PE=3 SV=1 63 748 4.0E-140
sp|B0Y6C5|DPP4_ASPFC Probable dipeptidyl peptidase 4 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=dpp4 PE=1 SV=1 63 748 9.0E-140
sp|A1CX29|DPP4_NEOFI Probable dipeptidyl peptidase 4 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=dpp4 PE=3 SV=1 63 748 2.0E-138
sp|B6V868|DPP4_TRITO Dipeptidyl peptidase 4 OS=Trichophyton tonsurans GN=DPP4 PE=3 SV=1 60 748 1.0E-134
sp|A0S5V9|DPP4_ARTOT Dipeptidyl peptidase 4 OS=Arthroderma otae GN=DPP4 PE=3 SV=1 85 748 8.0E-134
sp|C5FJE3|DPP4_ARTOC Dipeptidyl peptidase 4 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=DPP4 PE=3 SV=2 85 748 8.0E-134
sp|D4APE2|DPP4_ARTBC Probable dipeptidyl peptidase 4 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=DPP4 PE=1 SV=1 78 748 3.0E-133
sp|A7UKV8|DPP4_TRIEQ Dipeptidyl peptidase 4 OS=Trichophyton equinum GN=DPP4 PE=3 SV=1 78 748 3.0E-133
sp|Q5J6J3|DPP4_TRIRU Dipeptidyl peptidase 4 OS=Trichophyton rubrum GN=DPP4 PE=1 SV=1 60 748 6.0E-132
sp|Q5AZ42|DPP4_EMENI Probable dipeptidyl peptidase 4 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=dpp4 PE=3 SV=1 85 748 1.0E-128
sp|D4CZ59|DPP4_TRIVH Probable dipeptidyl peptidase 4 OS=Trichophyton verrucosum (strain HKI 0517) GN=DPP4 PE=3 SV=1 77 748 8.0E-126
sp|A1CHP1|DPP4_ASPCL Probable dipeptidyl peptidase 4 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=dpp4 PE=3 SV=1 56 748 1.0E-124
sp|P33894|STE13_YEAST Dipeptidyl aminopeptidase A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=STE13 PE=1 SV=1 156 756 5.0E-112
sp|P27487|DPP4_HUMAN Dipeptidyl peptidase 4 OS=Homo sapiens GN=DPP4 PE=1 SV=2 153 757 2.0E-82
sp|P22411|DPP4_PIG Dipeptidyl peptidase 4 OS=Sus scrofa GN=DPP4 PE=1 SV=3 106 757 3.0E-82
sp|P28843|DPP4_MOUSE Dipeptidyl peptidase 4 OS=Mus musculus GN=Dpp4 PE=1 SV=3 103 757 1.0E-79
sp|Q9N2I7|DPP4_FELCA Dipeptidyl peptidase 4 OS=Felis catus GN=DPP4 PE=2 SV=1 153 757 3.0E-78
sp|P81425|DPP4_BOVIN Dipeptidyl peptidase 4 OS=Bos taurus GN=DPP4 PE=1 SV=3 153 757 8.0E-78
sp|Q12884|SEPR_HUMAN Prolyl endopeptidase FAP OS=Homo sapiens GN=FAP PE=1 SV=5 153 741 2.0E-72
sp|A5D7B7|SEPR_BOVIN Prolyl endopeptidase FAP OS=Bos taurus GN=FAP PE=1 SV=1 153 736 3.0E-69
sp|Q6Q629|DPP10_RAT Inactive dipeptidyl peptidase 10 OS=Rattus norvegicus GN=Dpp10 PE=1 SV=1 48 736 4.0E-64
sp|Q6NXK7|DPP10_MOUSE Inactive dipeptidyl peptidase 10 OS=Mus musculus GN=Dpp10 PE=1 SV=1 48 736 1.0E-63
sp|Q8N608|DPP10_HUMAN Inactive dipeptidyl peptidase 10 OS=Homo sapiens GN=DPP10 PE=1 SV=2 48 744 4.0E-63
sp|Q9Z218|DPP6_MOUSE Dipeptidyl aminopeptidase-like protein 6 OS=Mus musculus GN=Dpp6 PE=1 SV=1 153 768 2.0E-61
sp|P46101|DPP6_RAT Dipeptidyl aminopeptidase-like protein 6 OS=Rattus norvegicus GN=Dpp6 PE=1 SV=1 153 768 5.0E-61
sp|P42658|DPP6_HUMAN Dipeptidyl aminopeptidase-like protein 6 OS=Homo sapiens GN=DPP6 PE=1 SV=2 153 756 7.0E-60
sp|B1A4F7|VDDP4_VESVU Venom dipeptidyl peptidase 4 OS=Vespula vulgaris PE=1 SV=1 153 735 8.0E-60
sp|Q5IS50|DPP6_PANTR Dipeptidyl aminopeptidase-like protein 6 OS=Pan troglodytes GN=DPP6 PE=2 SV=1 153 756 3.0E-59
sp|P42659|DPP6_BOVIN Dipeptidyl aminopeptidase-like protein 6 OS=Bos taurus GN=DPP6 PE=1 SV=1 153 756 2.0E-57
sp|P14740|DPP4_RAT Dipeptidyl peptidase 4 OS=Rattus norvegicus GN=Dpp4 PE=1 SV=2 370 757 8.0E-57
sp|Q9P7E9|YDZF_SCHPO Putative dipeptidyl aminopeptidase C14C4.15c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC14C4.15c PE=3 SV=2 90 748 8.0E-56
sp|B2D0J4|VDPP4_APIME Venom dipeptidyl peptidase 4 OS=Apis mellifera PE=1 SV=1 159 735 3.0E-52
sp|Q6F3I7|DAP4_PSEMX Dipeptidyl aminopeptidase 4 OS=Pseudoxanthomonas mexicana GN=dap4 PE=1 SV=1 205 735 5.0E-52
sp|P97321|SEPR_MOUSE Prolyl endopeptidase FAP OS=Mus musculus GN=Fap PE=1 SV=1 370 757 3.0E-51
sp|B2RJX3|PTP_PORG3 Prolyl tripeptidyl peptidase OS=Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / JCM 12257) GN=ptpA PE=3 SV=1 204 735 1.0E-47
sp|Q7MUW6|PTP_PORGI Prolyl tripeptidyl peptidase OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) GN=ptpA PE=1 SV=1 86 735 1.0E-47
sp|Q7JKY3|DPF1_CAEEL Dipeptidyl peptidase family member 1 OS=Caenorhabditis elegans GN=dpf-1 PE=1 SV=1 199 743 2.0E-42
sp|Q6V1X1|DPP8_HUMAN Dipeptidyl peptidase 8 OS=Homo sapiens GN=DPP8 PE=1 SV=1 384 735 1.0E-41
sp|Q18253|DPF2_CAEEL Dipeptidyl peptidase family member 2 OS=Caenorhabditis elegans GN=dpf-2 PE=1 SV=1 88 754 1.0E-41
sp|Q80YA7|DPP8_MOUSE Dipeptidyl peptidase 8 OS=Mus musculus GN=Dpp8 PE=1 SV=1 384 735 1.0E-40
sp|Q86TI2|DPP9_HUMAN Dipeptidyl peptidase 9 OS=Homo sapiens GN=DPP9 PE=1 SV=3 384 735 2.0E-36
sp|Q8BVG4|DPP9_MOUSE Dipeptidyl peptidase 9 OS=Mus musculus GN=Dpp9 PE=1 SV=2 384 735 7.0E-36
sp|P97321|SEPR_MOUSE Prolyl endopeptidase FAP OS=Mus musculus GN=Fap PE=1 SV=1 153 278 9.0E-17
sp|P14740|DPP4_RAT Dipeptidyl peptidase 4 OS=Rattus norvegicus GN=Dpp4 PE=1 SV=2 78 279 4.0E-16
sp|A2QZF1|DPP5_ASPNC Probable dipeptidyl-peptidase 5 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=dpp5 PE=3 SV=1 512 758 5.0E-08
sp|Q3LS63|DPP5_ASPNG Probable dipeptidyl-peptidase 5 OS=Aspergillus niger GN=dpp5 PE=3 SV=1 512 758 6.0E-08
[Show less]

GO

GO Term Description Terminal node
GO:0008236 serine-type peptidase activity Yes
GO:0006508 proteolysis Yes
GO:0003824 catalytic activity No
GO:0044238 primary metabolic process No
GO:0017171 serine hydrolase activity No
GO:0006807 nitrogen compound metabolic process No
GO:0003674 molecular_function No
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:0008233 peptidase activity No
GO:0016787 hydrolase activity No
GO:0071704 organic substance metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0019538 protein metabolic process No
GO:0140096 catalytic activity, acting on a protein No
GO:0043170 macromolecule metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|6049
MAIPKTPDNGSEGSRASLDSLSSVQAYRDDSAMDSERGPFLASTTPPPPAATRKAMDRGLRRCLVVGSYRHASDA
EHDPDAMTRGSGKQITMEQVQSGYWQPRSRSIEWIADPDGNDGLLLEQGAPNKDYLRAQLAATLGSALTYMPEWT
RPSPNLEKVLLGVEKKQNWRHSFTASYFVLDVASGAVEPLVPGNAAARVQLATWSPLSSCIAFTMDNNLYLRHLN
DSAAAVQITADGGPEYFYGVPDWVYEEEVFGAAAATWWSADGTHLAFLRTNESGEAYPERRLINQQTFSISLDND
FADSDRIINNVLWASHHVLLKQTNRVGDHVRVVLLDGGWYEVSHKMAFVPADASRGRPHDGYVDTIVHHGFNHLA
YFAPLDNPEPLMLTSGPWEVEDGALAVDAPHGLVYFVAAKHSSITRHVYSVRLDGSHLTPLTDDEQDAYYSASFS
SHAGYALVSYSGPRVPTQQVISTPSNPAPTPYNRTIEDNAQLAQRARTHQLPLLVHGQLDIGNGTLLNYMERRPP
HFDPERAHPVLFQQYSGPESQSVSRRFRVDFHSYLAASLGYLVITVDPRGTGFRGRAHRVPVRRQLGLLEAADHI
AAARLLSQRPYVDADRLAIWGWSYGAFQTLKTLELDAGHTFSYGMAVAPVTDWHFYDSVYTERYMDTPQANPDGY
AASRIANASALAQSCRFLVMHGLADDNVHLQNTAALIDALDLASVTNYDLHVFPDSDHSISFHNANTIVYEKLRT
WLINAFNGEWLKIADPKPIDKLRKRLPSPHAPDTPQTIPL*
Coding >OphauB2|6049
ATGGCGATACCCAAGACCCCCGACAATGGCTCAGAGGGCTCGCGCGCGTCGCTCGACTCCTTGTCATCCGTCCAA
GCCTACAGGGACGACTCAGCCATGGACTCGGAACGCGGACCCTTTCTCGCCTCGACGACGCCGCCTCCTCCCGCT
GCCACGCGCAAAGCCATGGACCGAGGCCTGCGGCGCTGCTTGGTGGTTGGCTCGTACCGGCACGCCAGCGACGCG
GAACACGACCCCGACGCCATGACGCGCGGCTCAGGCAAGCAAATCACCATGGAGCAGGTGCAGAGCGGGTACTGG
CAGCCGCGCTCGCGCTCCATTGAGTGGATTGCCGACCCGGACGGCAACGACGGCTTGCTGCTGGAGCAGGGCGCG
CCCAACAAGGACTACCTGCGGGCGCAGCTGGCGGCGACGCTGGGCTCGGCGCTGACGTATATGCCCGAGTGGACA
CGGCCGAGCCCCAACCTCGAAAAGGTGCTGCTGGGCGTGGAAAAGAAGCAGAATTGGCGCCACTCCTTTACCGCC
AGCTACTTTGTCCTCGACGTGGCCTCGGGCGCCGTGGAGCCGCTGGTGCCCGGCAACGCGGCCGCTCGCGTGCAG
CTGGCCACGTGGAGTCCGCTGAGCAGCTGCATTGCCTTTACCATGGACAACAACCTCTACCTGCGCCACCTCAAC
GACTCGGCCGCCGCGGTGCAAATCACGGCTGACGGCGGGCCCGAGTACTTTTACGGCGTGCCCGACTGGGTCTAC
GAGGAGGAAGTCTTTGGCGCCGCCGCCGCCACTTGGTGGTCCGCCGACGGCACCCACCTGGCCTTTTTGCGCACA
AATGAATCCGGCGAAGCATACCCTGAGCGGCGCCTCATCAACCAGCAAACCTTTTCCATCTCCCTCGACAACGAC
TTTGCCGACAGCGACCGCATCATCAACAATGTCCTCTGGGCCAGCCACCACGTCTTGCTCAAGCAGACGAACCGC
GTGGGCGACCATGTCCGCGTCGTGCTCCTCGACGGCGGCTGGTACGAAGTCTCCCACAAAATGGCCTTTGTGCCC
GCCGATGCGTCGCGCGGCCGCCCCCACGACGGCTACGTCGACACCATTGTCCACCACGGCTTCAACCACTTGGCC
TACTTTGCCCCGCTCGACAACCCCGAGCCCCTCATGCTCACCTCGGGCCCCTGGGAGGTTGAAGACGGCGCGCTG
GCCGTGGACGCGCCCCATGGCCTCGTCTACTTTGTCGCTGCCAAGCACTCCTCCATTACCCGCCACGTCTACTCT
GTCCGCCTCGACGGCTCCCACCTCACTCCCCTCACCGACGACGAGCAAGACGCCTACTACTCGGCCTCGTTTTCC
TCCCACGCCGGCTACGCCCTTGTTTCCTACTCGGGCCCCCGCGTGCCCACCCAGCAAGTCATTTCCACCCCTTCC
AACCCTGCCCCCACGCCCTACAACCGCACCATTGAAGATAATGCCCAGCTCGCCCAACGCGCCCGCACCCACCAA
CTGCCCCTCCTCGTCCACGGCCAACTCGACATTGGCAACGGCACCCTGCTCAACTACATGGAACGCCGTCCCCCG
CACTTTGACCCCGAGCGCGCCCACCCCGTCCTCTTTCAACAATACTCGGGCCCCGAATCCCAGTCCGTCTCGCGC
CGCTTCCGCGTCGACTTCCACTCCTACCTCGCCGCCTCGCTCGGCTACCTCGTCATCACCGTCGACCCCCGCGGC
ACCGGCTTCCGCGGCCGCGCCCACCGCGTCCCCGTCCGCCGCCAGCTCGGCCTCCTCGAGGCGGCTGACCACATC
GCCGCCGCCCGCCTCCTCTCCCAGCGGCCCTATGTCGACGCCGACCGCCTCGCCATTTGGGGCTGGTCCTATGGC
GCCTTTCAGACCCTAAAGACGCTCGAGCTTGACGCCGGACATACCTTTTCCTATGGCATGGCCGTCGCCCCCGTT
ACAGACTGGCACTTTTACGACTCGGTCTACACGGAGCGCTACATGGATACGCCCCAGGCTAATCCCGATGGCTAT
GCTGCCTCGCGCATCGCAAATGCCTCGGCCCTCGCCCAGTCGTGCCGCTTCCTCGTCATGCACGGCCTTGCCGAC
GATAATGTCCACTTGCAGAATACGGCCGCCTTGATTGACGCCCTCGACCTCGCCAGCGTCACCAATTACGACTTG
CACGTCTTTCCCGATAGCGACCACTCCATTTCCTTTCACAATGCAAACACTATAGTCTACGAAAAATTACGCACC
TGGCTCATCAATGCTTTTAATGGCGAGTGGCTCAAAATTGCCGACCCAAAGCCCATTGACAAACTGCGTAAACGA
CTCCCAAGCCCCCACGCTCCAGATACCCCCCAAACTATTCCTCTCTAA
Transcript >OphauB2|6049
ATGGCGATACCCAAGACCCCCGACAATGGCTCAGAGGGCTCGCGCGCGTCGCTCGACTCCTTGTCATCCGTCCAA
GCCTACAGGGACGACTCAGCCATGGACTCGGAACGCGGACCCTTTCTCGCCTCGACGACGCCGCCTCCTCCCGCT
GCCACGCGCAAAGCCATGGACCGAGGCCTGCGGCGCTGCTTGGTGGTTGGCTCGTACCGGCACGCCAGCGACGCG
GAACACGACCCCGACGCCATGACGCGCGGCTCAGGCAAGCAAATCACCATGGAGCAGGTGCAGAGCGGGTACTGG
CAGCCGCGCTCGCGCTCCATTGAGTGGATTGCCGACCCGGACGGCAACGACGGCTTGCTGCTGGAGCAGGGCGCG
CCCAACAAGGACTACCTGCGGGCGCAGCTGGCGGCGACGCTGGGCTCGGCGCTGACGTATATGCCCGAGTGGACA
CGGCCGAGCCCCAACCTCGAAAAGGTGCTGCTGGGCGTGGAAAAGAAGCAGAATTGGCGCCACTCCTTTACCGCC
AGCTACTTTGTCCTCGACGTGGCCTCGGGCGCCGTGGAGCCGCTGGTGCCCGGCAACGCGGCCGCTCGCGTGCAG
CTGGCCACGTGGAGTCCGCTGAGCAGCTGCATTGCCTTTACCATGGACAACAACCTCTACCTGCGCCACCTCAAC
GACTCGGCCGCCGCGGTGCAAATCACGGCTGACGGCGGGCCCGAGTACTTTTACGGCGTGCCCGACTGGGTCTAC
GAGGAGGAAGTCTTTGGCGCCGCCGCCGCCACTTGGTGGTCCGCCGACGGCACCCACCTGGCCTTTTTGCGCACA
AATGAATCCGGCGAAGCATACCCTGAGCGGCGCCTCATCAACCAGCAAACCTTTTCCATCTCCCTCGACAACGAC
TTTGCCGACAGCGACCGCATCATCAACAATGTCCTCTGGGCCAGCCACCACGTCTTGCTCAAGCAGACGAACCGC
GTGGGCGACCATGTCCGCGTCGTGCTCCTCGACGGCGGCTGGTACGAAGTCTCCCACAAAATGGCCTTTGTGCCC
GCCGATGCGTCGCGCGGCCGCCCCCACGACGGCTACGTCGACACCATTGTCCACCACGGCTTCAACCACTTGGCC
TACTTTGCCCCGCTCGACAACCCCGAGCCCCTCATGCTCACCTCGGGCCCCTGGGAGGTTGAAGACGGCGCGCTG
GCCGTGGACGCGCCCCATGGCCTCGTCTACTTTGTCGCTGCCAAGCACTCCTCCATTACCCGCCACGTCTACTCT
GTCCGCCTCGACGGCTCCCACCTCACTCCCCTCACCGACGACGAGCAAGACGCCTACTACTCGGCCTCGTTTTCC
TCCCACGCCGGCTACGCCCTTGTTTCCTACTCGGGCCCCCGCGTGCCCACCCAGCAAGTCATTTCCACCCCTTCC
AACCCTGCCCCCACGCCCTACAACCGCACCATTGAAGATAATGCCCAGCTCGCCCAACGCGCCCGCACCCACCAA
CTGCCCCTCCTCGTCCACGGCCAACTCGACATTGGCAACGGCACCCTGCTCAACTACATGGAACGCCGTCCCCCG
CACTTTGACCCCGAGCGCGCCCACCCCGTCCTCTTTCAACAATACTCGGGCCCCGAATCCCAGTCCGTCTCGCGC
CGCTTCCGCGTCGACTTCCACTCCTACCTCGCCGCCTCGCTCGGCTACCTCGTCATCACCGTCGACCCCCGCGGC
ACCGGCTTCCGCGGCCGCGCCCACCGCGTCCCCGTCCGCCGCCAGCTCGGCCTCCTCGAGGCGGCTGACCACATC
GCCGCCGCCCGCCTCCTCTCCCAGCGGCCCTATGTCGACGCCGACCGCCTCGCCATTTGGGGCTGGTCCTATGGC
GCCTTTCAGACCCTAAAGACGCTCGAGCTTGACGCCGGACATACCTTTTCCTATGGCATGGCCGTCGCCCCCGTT
ACAGACTGGCACTTTTACGACTCGGTCTACACGGAGCGCTACATGGATACGCCCCAGGCTAATCCCGATGGCTAT
GCTGCCTCGCGCATCGCAAATGCCTCGGCCCTCGCCCAGTCGTGCCGCTTCCTCGTCATGCACGGCCTTGCCGAC
GATAATGTCCACTTGCAGAATACGGCCGCCTTGATTGACGCCCTCGACCTCGCCAGCGTCACCAATTACGACTTG
CACGTCTTTCCCGATAGCGACCACTCCATTTCCTTTCACAATGCAAACACTATAGTCTACGAAAAATTACGCACC
TGGCTCATCAATGCTTTTAATGGCGAGTGGCTCAAAATTGCCGACCCAAAGCCCATTGACAAACTGCGTAAACGA
CTCCCAAGCCCCCACGCTCCAGATACCCCCCAAACTATTCCTCTCTAA
Gene >OphauB2|6049
ATGGCGATACCCAAGACCCCCGACAATGGCTCAGAGGGCTCGCGCGCGTCGCTCGACTCCTTGTCATCCGTGTCC
ACGACGAGCATCGTCTTTGAGCGGCTGCACGACGAGGCAGAAAAGGGCATGCGCATAGCGACGCGCGAGCCCAAA
CACGTACCCGGCAGCCAAGCCTACAGGGACGACTCAGCCATGGACTCGGAACGCGGACCCTTTCTCGCCTCGACG
ACGCCGCCTCCTCCCGCTGCCACGCGCAAAGCCATGGACCGAGGCCTGCGGCGCTGCTTGGTGGTTGGTGCAGGG
GCCTTTTTGGTGGGCTGGCTGGTTGCCCTGGGCCTCTTTGTGGCGCGAGGCTCGTACCGGCACGCCAGCGACGCG
GAACACGACCCCGACGCCATGACGCGCGGCTCAGGCAAGCAAATCACCATGGAGCAGGTGCAGAGCGGGTACTGG
CAGCCGCGCTCGCGCTCCATTGAGTGGATTGCCGACCCGGACGGCAACGACGGCTTGCTGCTGGAGCAGGGCGCG
CCCAACAAGGACTACCTGGTGGTGCAAGACGTGCGCTCGTGGGAGACGGATGCGGCGCAGCGGGCGCAGCTGGCG
GCGACGCTGGGCTCGGCGCTGGTGCATCCGCGCACCTTGATCAAGGAGCCCATTTTCCGCTTCAATGGCCAGACG
TATATGCCCGAGTGGACACGGCCGAGCCCCAACCTCGAAAAGGTGCTGCTGGGCGTGGAAAAGAAGCAGAATTGG
CGCCACTCCTTTACCGCCAGCTACTTTGTCCTCGACGTGGCCTCGGGCGCCGTGGAGCCGCTGGTGCCCGGCAAC
GCGGCCGCTCGCGTGCAGCTGGCCACGTGGAGTCCGCTGAGCAGCTGCATTGCCTTTACCATGGACAACAACCTC
TACCTGCGCCACCTCAACGACTCGGCCGCCGCGGTGCAAATCACGGCTGACGGCGGGCCCGAGTACTTTTACGGC
GTGCCCGACTGGGTCTACGAGGAGGAAGTCTTTGGCGCCGCCGCCGCCACTTGGTGGTCCGCCGACGGCACCCAC
CTGGCCTTTTTGCGCACAAATGAATCCGGCGTCGAGGACTTTGCTATAGACTACTATCTCTCACGGCCCAGCGGC
ACCGCGCCCGCCGCCGGCCAGGAAGCATACCCTGAGCGGCGCCTCATCAAGTACCCCAAGTCGGGCTCCCGCAAC
CCCGTGGTGCACGTGCAGTACTACAAGCTCGCCAGCCAGCAAACCTTTTCCATCTCCCTCGACAACGACTTTGCC
GACAGCGACCGCATCATCAACAATGTCCTCTGGGCCAGCCACCACGTCTTGCTCAAGCAGACGAACCGCGTGGGC
GACCATGTCCGCGTCGTGCTCGTCGACATCGACGCCCGCTCCGCCAAGACTGTCACCGACGTCGACTTGGCCCAG
CTCGACGGCGGCTGGTACGAAGTCTCCCACAAAATGGCCTTTGTGCCCGCCGATGCGTCGCGCGGCCGCCCCCAC
GACGGCTACGTCGACACCATTGTCCACCACGGCTTCAACCACTTGGCCTACTTTGCCCCGCTCGACAACCCCGAG
CCCCTCATGCTCACCTCGGGCCCCTGGGAGGTTGAAGACGGCGCGCTGGCCGTGGACGCGCCCCATGGCCTCGTC
TACTTTGTCGCTGCCAAGCACTCCTCCATTACCCGCCACGTCTACTCTGTCCGCCTCGACGGCTCCCACCTCACT
CCCCTCACCGACGACGAGCAAGACGCCTACTACTCGGCCTCGTTTTCCTCCCACGCCGGCTACGCCCTTGTTTCC
TACTCGGGCCCCCGCGTGCCCACCCAGCAAGTCATTTCCACCCCTTCCAACCCTGCCCCCACGCCCTACAACCGC
ACCATTGAAGATAATGCCCAGCTCGCCCAACGCGCCCGCACCCACCAACTGCCCCTCCTCGTCCACGGCCAACTC
GACATTGGCAACGGCACCCTGCTCAACTACATGGAACGCCGTCCCCCGCACTTTGACCCCGAGCGCGCCCACCCC
GTCCTCTTTCAACAATACTCGGGCCCCGAATCCCAGTCCGTCTCGCGCCGCTTCCGCGTCGACTTCCACTCCTAC
CTCGCCGCCTCGCTCGGCTACCTCGTCATCACCGTCGACCCCCGCGGCACCGGCTTCCGCGGCCGCGCCCACCGC
GTCCCCGTCCGCCGCCAGCTCGGCCTCCTCGAGGCGGCTGACCACATCGCCGCCGCCCGCCTCCTCTCCCAGCGG
CCCTATGTCGACGCCGACCGCCTCGCCATTTGGGGCTGGTCCTATGGCGCCTTTCAGACCCTAAAGACGCTCGAG
CTTGACGCCGGACATACCTTTTCCTATGGCATGGCCGTCGCCCCCGTTACAGACTGGCACTTTTACGACTCGGTC
TACACGGAGCGCTACATGGATACGCCCCAGGCTAATCCCGATGGCTATGCTGCCTCGCGCATCGCAAATGCCTCG
GCCCTCGCCCAGTCGTGCCGCTTCCTCGTCATGCACGGCCTTGCCGACGATAATGTCCACTTGCAGAATACGGCC
GCCTTGATTGACGCCCTCGACCTCGCCAGCGTCACCAATTACGACTTGCACGTCTTTCCCGATAGCGACCACTCC
ATTTCCTTTCACAATGCAAACACTATAGTCTACGAAAGTGAGCCCATCCTCCTTGTCCTTCTCTCCACCCCTCGA
GTTCCTTGCCCATCTCGTTTGCTGACCCCCCTCTGCCCACTCTGCAGAATTACGCACCTGGCTCATCAATGCTTT
TAATGGCGAGTGGCTCAAAATTGCCGACCCAAAGCCCATTGACAAACTGCGTAAACGACTCCCAAGCCCCCACGC
TCCAGATACCCCCCAAACTATTCCTCTCTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail