Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|6045
Gene name
LocationContig_51:21287..22078
Strand-
Gene length (bp)791
Transcript length (bp)699
Coding sequence length (bp)699
Protein length (aa) 233

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07798 CCDC90-like Coiled-coil domain-containing protein 90-like 1.7E-56 57 231

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P43557|FMP32_YEAST Protein FMP32, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FMP32 PE=1 SV=1 66 231 4.0E-45
sp|O14042|FMP32_SCHPO Protein fmp32, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fmp32 PE=3 SV=1 19 232 2.0E-32
sp|Q10073|YAN8_SCHPO Uncharacterized CCDC90 family protein C3H1.08c, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC3H1.08c PE=3 SV=1 64 213 6.0E-18
sp|Q9CXD6|MCUR1_MOUSE Mitochondrial calcium uniporter regulator 1 OS=Mus musculus GN=Mcur1 PE=1 SV=1 53 230 4.0E-15
sp|Q8C3X2|CC90B_MOUSE Coiled-coil domain-containing protein 90B, mitochondrial OS=Mus musculus GN=Ccdc90b PE=1 SV=1 6 230 7.0E-14
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P43557|FMP32_YEAST Protein FMP32, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FMP32 PE=1 SV=1 66 231 4.0E-45
sp|O14042|FMP32_SCHPO Protein fmp32, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fmp32 PE=3 SV=1 19 232 2.0E-32
sp|Q10073|YAN8_SCHPO Uncharacterized CCDC90 family protein C3H1.08c, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC3H1.08c PE=3 SV=1 64 213 6.0E-18
sp|Q9CXD6|MCUR1_MOUSE Mitochondrial calcium uniporter regulator 1 OS=Mus musculus GN=Mcur1 PE=1 SV=1 53 230 4.0E-15
sp|Q8C3X2|CC90B_MOUSE Coiled-coil domain-containing protein 90B, mitochondrial OS=Mus musculus GN=Ccdc90b PE=1 SV=1 6 230 7.0E-14
sp|Q4V897|CC90B_RAT Coiled-coil domain-containing protein 90B, mitochondrial OS=Rattus norvegicus GN=Ccdc90b PE=2 SV=1 6 230 7.0E-14
sp|Q96AQ8|MCUR1_HUMAN Mitochondrial calcium uniporter regulator 1 OS=Homo sapiens GN=MCUR1 PE=1 SV=1 53 232 8.0E-14
sp|Q0P4J6|MCUR1_XENTR Mitochondrial calcium uniporter regulator 1 OS=Xenopus tropicalis GN=mcur1 PE=2 SV=1 53 230 2.0E-13
sp|Q6DJ87|CC90B_XENTR Coiled-coil domain-containing protein 90B, mitochondrial OS=Xenopus tropicalis GN=ccdc90b PE=2 SV=2 37 230 3.0E-13
sp|Q9GZT6|CC90B_HUMAN Coiled-coil domain-containing protein 90B, mitochondrial OS=Homo sapiens GN=CCDC90B PE=1 SV=2 6 230 2.0E-11
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 27 0.45

Transmembrane Domains

Domain # Start End Length
1 209 231 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|6045
MPARLPAPNLAPRLRCPLLPLAAVGATPLPLSLPRRPSRTASRALHASPVRLRDHHFDTLKFVRKLQSDGFTEEQ
SVAMMKVLNDVIEESIQNLTRTMVLREDAAKATYTQKVDFAKLRSELLSADSTESNTTRAAHERLTNDIAKLSSR
LRDEIGRTQASVRLDLNLEKGRIREEAVSQELKIKETETKIEQEVAALREKLEQVKFQTLQWLMGVCTGFAALML
GAWRLLM*
Coding >OphauB2|6045
ATGCCCGCCCGTCTGCCTGCACCCAACCTGGCGCCCCGGCTGCGCTGCCCGCTGCTGCCCCTCGCCGCCGTGGGA
GCCACGCCATTGCCGCTGTCGCTGCCTCGTCGGCCCTCTCGGACAGCCAGCCGAGCCCTACACGCCTCGCCCGTG
CGCCTCCGCGACCACCACTTTGACACGCTCAAGTTTGTCAGGAAGCTGCAGAGCGATGGCTTCACTGAAGAGCAG
TCGGTCGCCATGATGAAGGTGCTCAACGACGTGATTGAGGAGAGCATCCAGAACCTCACCCGCACCATGGTGCTG
CGCGAAGACGCCGCCAAAGCCACGTATACCCAAAAAGTAGACTTTGCCAAACTCCGCTCCGAGCTGCTCTCGGCC
GACAGCACCGAGTCCAACACGACGCGCGCCGCCCACGAACGCCTCACAAACGACATTGCCAAGCTGAGCAGCCGC
CTGCGCGACGAAATCGGCCGCACCCAGGCCAGCGTGCGCCTCGACCTCAACCTCGAAAAGGGCCGCATCCGCGAA
GAGGCCGTCAGCCAGGAACTCAAAATCAAGGAGACGGAAACAAAAATCGAGCAAGAGGTGGCGGCCCTGCGCGAG
AAGCTTGAGCAAGTCAAGTTTCAGACCCTGCAGTGGCTCATGGGCGTCTGTACCGGCTTTGCGGCCTTGATGCTG
GGTGCTTGGCGACTCCTCATGTAG
Transcript >OphauB2|6045
ATGCCCGCCCGTCTGCCTGCACCCAACCTGGCGCCCCGGCTGCGCTGCCCGCTGCTGCCCCTCGCCGCCGTGGGA
GCCACGCCATTGCCGCTGTCGCTGCCTCGTCGGCCCTCTCGGACAGCCAGCCGAGCCCTACACGCCTCGCCCGTG
CGCCTCCGCGACCACCACTTTGACACGCTCAAGTTTGTCAGGAAGCTGCAGAGCGATGGCTTCACTGAAGAGCAG
TCGGTCGCCATGATGAAGGTGCTCAACGACGTGATTGAGGAGAGCATCCAGAACCTCACCCGCACCATGGTGCTG
CGCGAAGACGCCGCCAAAGCCACGTATACCCAAAAAGTAGACTTTGCCAAACTCCGCTCCGAGCTGCTCTCGGCC
GACAGCACCGAGTCCAACACGACGCGCGCCGCCCACGAACGCCTCACAAACGACATTGCCAAGCTGAGCAGCCGC
CTGCGCGACGAAATCGGCCGCACCCAGGCCAGCGTGCGCCTCGACCTCAACCTCGAAAAGGGCCGCATCCGCGAA
GAGGCCGTCAGCCAGGAACTCAAAATCAAGGAGACGGAAACAAAAATCGAGCAAGAGGTGGCGGCCCTGCGCGAG
AAGCTTGAGCAAGTCAAGTTTCAGACCCTGCAGTGGCTCATGGGCGTCTGTACCGGCTTTGCGGCCTTGATGCTG
GGTGCTTGGCGACTCCTCATGTAG
Gene >OphauB2|6045
ATGCCCGCCCGTCTGCCTGCACCCAACCTGGCGCCCCGGCTGCGCTGCCCGCTGCTGCCCCTCGCCGCCGTGGGA
GCCACGCCATTGCCGCTGTCGCTGCCTCGTCGGCCCTCTCGGACAGCCAGCCGAGCCCTACACGCCTCGCCCGTG
CGCCTCCGCGACCACCACTTTGACACGCTCAAGTTTGTCAGGAAGCTGCAGAGCGATGGCTTCACTGAAGAGCAG
TCGGTCGCCATGATGAAGGTGCTCAACGACGTGATTGAGGAGAGGTGAGAGCAACGCCCCCTCCCTTTGGTTTGT
CGACAAGCCACACTTGACTACGGCCTTGACTCTAGCTCACCACTCTCCGCCTTGTCTCCAGCATCCAGAACCTCA
CCCGCACCATGGTGCTGCGCGAAGACGCCGCCAAAGCCACGTATACCCAAAAAGTAGACTTTGCCAAACTCCGCT
CCGAGCTGCTCTCGGCCGACAGCACCGAGTCCAACACGACGCGCGCCGCCCACGAACGCCTCACAAACGACATTG
CCAAGCTGAGCAGCCGCCTGCGCGACGAAATCGGCCGCACCCAGGCCAGCGTGCGCCTCGACCTCAACCTCGAAA
AGGGCCGCATCCGCGAAGAGGCCGTCAGCCAGGAACTCAAAATCAAGGAGACGGAAACAAAAATCGAGCAAGAGG
TGGCGGCCCTGCGCGAGAAGCTTGAGCAAGTCAAGTTTCAGACCCTGCAGTGGCTCATGGGCGTCTGTACCGGCT
TTGCGGCCTTGATGCTGGGTGCTTGGCGACTCCTCATGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail