Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|6044
Gene name
LocationContig_51:18941..20283
Strand-
Gene length (bp)1342
Transcript length (bp)1035
Coding sequence length (bp)1035
Protein length (aa) 345

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02826 2-Hacid_dh_C D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain 4.8E-50 121 297
PF00389 2-Hacid_dh D-isomer specific 2-hydroxyacid dehydrogenase, catalytic domain 4.9E-18 16 328

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O14075|YEAA_SCHPO Putative 2-hydroxyacid dehydrogenase UNK4.10 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC2E11.10 PE=2 SV=1 1 332 1.0E-99
sp|P53839|GOR1_YEAST Glyoxylate reductase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GOR1 PE=1 SV=1 1 338 1.0E-87
sp|O94574|YGDH_SCHPO Putative 2-hydroxyacid dehydrogenase C1773.17c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1773.17c PE=3 SV=3 6 315 2.0E-53
sp|Q9C4M5|GYAR_THELN Glyoxylate reductase OS=Thermococcus litoralis (strain ATCC 51850 / DSM 5473 / JCM 8560 / NS-C) GN=gyaR PE=1 SV=1 4 315 3.0E-53
sp|B6YWH0|GYAR_THEON Glyoxylate reductase OS=Thermococcus onnurineus (strain NA1) GN=gyaR PE=3 SV=1 68 315 5.0E-50
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O14075|YEAA_SCHPO Putative 2-hydroxyacid dehydrogenase UNK4.10 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC2E11.10 PE=2 SV=1 1 332 1.0E-99
sp|P53839|GOR1_YEAST Glyoxylate reductase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GOR1 PE=1 SV=1 1 338 1.0E-87
sp|O94574|YGDH_SCHPO Putative 2-hydroxyacid dehydrogenase C1773.17c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1773.17c PE=3 SV=3 6 315 2.0E-53
sp|Q9C4M5|GYAR_THELN Glyoxylate reductase OS=Thermococcus litoralis (strain ATCC 51850 / DSM 5473 / JCM 8560 / NS-C) GN=gyaR PE=1 SV=1 4 315 3.0E-53
sp|B6YWH0|GYAR_THEON Glyoxylate reductase OS=Thermococcus onnurineus (strain NA1) GN=gyaR PE=3 SV=1 68 315 5.0E-50
sp|Q9YAW4|GYAR_AERPE Glyoxylate reductase OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=gyaR PE=3 SV=2 65 324 8.0E-50
sp|Q8U3Y2|GYAR_PYRFU Glyoxylate reductase OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=gyaR PE=3 SV=1 68 315 1.0E-47
sp|B2VCD1|GHRB_ERWT9 Glyoxylate/hydroxypyruvate reductase B OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=ghrB PE=3 SV=1 64 328 2.0E-47
sp|A9MUT4|GHRB_SALPB Glyoxylate/hydroxypyruvate reductase B OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=ghrB PE=3 SV=1 64 331 3.0E-46
sp|Q5JEZ2|GYAR_THEKO Glyoxylate reductase OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=gyaR PE=3 SV=1 68 315 5.0E-46
sp|A8G7S7|GHRB_SERP5 Glyoxylate/hydroxypyruvate reductase B OS=Serratia proteamaculans (strain 568) GN=ghrB PE=3 SV=1 66 319 6.0E-46
sp|C0Q1A7|GHRB_SALPC Glyoxylate/hydroxypyruvate reductase B OS=Salmonella paratyphi C (strain RKS4594) GN=ghrB PE=3 SV=1 68 331 2.0E-45
sp|Q57IH8|GHRB_SALCH Glyoxylate/hydroxypyruvate reductase B OS=Salmonella choleraesuis (strain SC-B67) GN=ghrB PE=3 SV=1 68 331 2.0E-45
sp|Q54DP1|TKRA_DICDI Probable 2-ketogluconate reductase OS=Dictyostelium discoideum GN=tkrA PE=3 SV=1 68 319 3.0E-45
sp|B5BHT3|GHRB_SALPK Glyoxylate/hydroxypyruvate reductase B OS=Salmonella paratyphi A (strain AKU_12601) GN=ghrB PE=3 SV=1 68 331 3.0E-45
sp|Q5PLL9|GHRB_SALPA Glyoxylate/hydroxypyruvate reductase B OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=ghrB PE=3 SV=1 68 331 3.0E-45
sp|B1IZP1|GHRB_ECOLC Glyoxylate/hydroxypyruvate reductase B OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=ghrB PE=3 SV=1 68 328 5.0E-45
sp|B1L765|GYAR_KORCO Glyoxylate reductase OS=Korarchaeum cryptofilum (strain OPF8) GN=gyaR PE=3 SV=1 65 315 6.0E-45
sp|Q8Z2A8|GHRB_SALTI Glyoxylate/hydroxypyruvate reductase B OS=Salmonella typhi GN=ghrB PE=3 SV=1 64 331 6.0E-45
sp|B5XMZ4|GHRB_KLEP3 Glyoxylate/hydroxypyruvate reductase B OS=Klebsiella pneumoniae (strain 342) GN=ghrB PE=3 SV=1 68 315 7.0E-45
sp|A6TFG7|GHRB_KLEP7 Glyoxylate/hydroxypyruvate reductase B OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=ghrB PE=3 SV=1 68 315 7.0E-45
sp|B1LJB3|GHRB_ECOSM Glyoxylate/hydroxypyruvate reductase B OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=ghrB PE=3 SV=1 68 328 8.0E-45
sp|B7LTG7|GHRB_ESCF3 Glyoxylate/hydroxypyruvate reductase B OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=ghrB PE=3 SV=1 68 319 9.0E-45
sp|B4SWJ5|GHRB_SALNS Glyoxylate/hydroxypyruvate reductase B OS=Salmonella newport (strain SL254) GN=ghrB PE=3 SV=1 68 331 1.0E-44
sp|B5R4N3|GHRB_SALEP Glyoxylate/hydroxypyruvate reductase B OS=Salmonella enteritidis PT4 (strain P125109) GN=ghrB PE=3 SV=1 68 331 1.0E-44
sp|B5FLC2|GHRB_SALDC Glyoxylate/hydroxypyruvate reductase B OS=Salmonella dublin (strain CT_02021853) GN=ghrB PE=3 SV=1 68 331 1.0E-44
sp|Q8ZLA1|GHRB_SALTY Glyoxylate/hydroxypyruvate reductase B OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=ghrB PE=3 SV=1 68 331 1.0E-44
sp|B4T938|GHRB_SALHS Glyoxylate/hydroxypyruvate reductase B OS=Salmonella heidelberg (strain SL476) GN=ghrB PE=3 SV=1 68 331 1.0E-44
sp|B2U573|GHRB_SHIB3 Glyoxylate/hydroxypyruvate reductase B OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=ghrB PE=3 SV=1 68 328 1.0E-44
sp|Q1R543|GHRB_ECOUT Glyoxylate/hydroxypyruvate reductase B OS=Escherichia coli (strain UTI89 / UPEC) GN=ghrB PE=3 SV=2 68 328 1.0E-44
sp|B6I3C3|GHRB_ECOSE Glyoxylate/hydroxypyruvate reductase B OS=Escherichia coli (strain SE11) GN=ghrB PE=3 SV=1 68 328 1.0E-44
sp|A1AH96|GHRB_ECOK1 Glyoxylate/hydroxypyruvate reductase B OS=Escherichia coli O1:K1 / APEC GN=ghrB PE=3 SV=2 68 328 1.0E-44
sp|B7M3H6|GHRB_ECO8A Glyoxylate/hydroxypyruvate reductase B OS=Escherichia coli O8 (strain IAI1) GN=ghrB PE=3 SV=1 68 328 1.0E-44
sp|B7N1K7|GHRB_ECO81 Glyoxylate/hydroxypyruvate reductase B OS=Escherichia coli O81 (strain ED1a) GN=ghrB PE=3 SV=1 68 328 1.0E-44
sp|B5YVK6|GHRB_ECO5E Glyoxylate/hydroxypyruvate reductase B OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=ghrB PE=3 SV=1 68 328 1.0E-44
sp|P58220|GHRB_ECO57 Glyoxylate/hydroxypyruvate reductase B OS=Escherichia coli O157:H7 GN=tkrA PE=3 SV=1 68 328 1.0E-44
sp|B7L6W9|GHRB_ECO55 Glyoxylate/hydroxypyruvate reductase B OS=Escherichia coli (strain 55989 / EAEC) GN=ghrB PE=3 SV=1 68 328 1.0E-44
sp|B7MER0|GHRB_ECO45 Glyoxylate/hydroxypyruvate reductase B OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=ghrB PE=3 SV=1 68 328 1.0E-44
sp|B7ULB4|GHRB_ECO27 Glyoxylate/hydroxypyruvate reductase B OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=ghrB PE=3 SV=1 68 328 1.0E-44
sp|A7ZTA0|GHRB_ECO24 Glyoxylate/hydroxypyruvate reductase B OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=ghrB PE=3 SV=1 68 328 1.0E-44
sp|B5EX58|GHRB_SALA4 Glyoxylate/hydroxypyruvate reductase B OS=Salmonella agona (strain SL483) GN=ghrB PE=3 SV=1 68 331 2.0E-44
sp|B7NP49|GHRB_ECO7I Glyoxylate/hydroxypyruvate reductase B OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=ghrB PE=3 SV=1 68 328 2.0E-44
sp|Q31V71|GHRB_SHIBS Glyoxylate/hydroxypyruvate reductase B OS=Shigella boydii serotype 4 (strain Sb227) GN=ghrB PE=3 SV=2 68 328 2.0E-44
sp|Q0SZE5|GHRB_SHIF8 Glyoxylate/hydroxypyruvate reductase B OS=Shigella flexneri serotype 5b (strain 8401) GN=ghrB PE=3 SV=1 68 328 3.0E-44
sp|Q328L4|GHRB_SHIDS Glyoxylate/hydroxypyruvate reductase B OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=ghrB PE=3 SV=2 68 328 4.0E-44
sp|B5RGN1|GHRB_SALG2 Glyoxylate/hydroxypyruvate reductase B OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=ghrB PE=3 SV=1 68 331 4.0E-44
sp|A8ARD9|GHRB_CITK8 Glyoxylate/hydroxypyruvate reductase B OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=ghrB PE=3 SV=1 68 331 4.0E-44
sp|Q83PR3|GHRB_SHIFL Glyoxylate/hydroxypyruvate reductase B OS=Shigella flexneri GN=ghrB PE=3 SV=4 68 328 5.0E-44
sp|A8A609|GHRB_ECOHS Glyoxylate/hydroxypyruvate reductase B OS=Escherichia coli O9:H4 (strain HS) GN=ghrB PE=3 SV=1 68 328 5.0E-44
sp|Q0TBP9|GHRB_ECOL5 Glyoxylate/hydroxypyruvate reductase B OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=ghrB PE=3 SV=1 68 328 7.0E-44
sp|P37666|GHRB_ECOLI Glyoxylate/hydroxypyruvate reductase B OS=Escherichia coli (strain K12) GN=ghrB PE=1 SV=3 68 328 7.0E-44
sp|Q8FCF1|GHRB_ECOL6 Glyoxylate/hydroxypyruvate reductase B OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=ghrB PE=3 SV=2 68 328 7.0E-44
sp|B1X8G8|GHRB_ECODH Glyoxylate/hydroxypyruvate reductase B OS=Escherichia coli (strain K12 / DH10B) GN=ghrB PE=3 SV=1 68 328 7.0E-44
sp|C4ZXE2|GHRB_ECOBW Glyoxylate/hydroxypyruvate reductase B OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=ghrB PE=3 SV=1 68 328 7.0E-44
sp|B4TZ41|GHRB_SALSV Glyoxylate/hydroxypyruvate reductase B OS=Salmonella schwarzengrund (strain CVM19633) GN=ghrB PE=3 SV=1 68 331 8.0E-44
sp|C5A1V0|GYAR_THEGJ Glyoxylate reductase OS=Thermococcus gammatolerans (strain DSM 15229 / JCM 11827 / EJ3) GN=gyaR PE=3 SV=1 68 315 9.0E-44
sp|Q3YVT5|GHRB_SHISS Glyoxylate/hydroxypyruvate reductase B OS=Shigella sonnei (strain Ss046) GN=ghrB PE=3 SV=2 68 328 1.0E-43
sp|Q9X1C1|HPR_THEMA Hydroxypyruvate reductase OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=TM_1401 PE=1 SV=1 79 307 2.0E-43
sp|O32264|TKRA_BACSU Probable 2-ketogluconate reductase OS=Bacillus subtilis (strain 168) GN=yvcT PE=3 SV=1 68 330 3.0E-43
sp|B7NEK6|GHRB_ECOLU Glyoxylate/hydroxypyruvate reductase B OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=ghrB PE=3 SV=1 68 328 5.0E-43
sp|P58000|GHRB_ENTAG Glyoxylate/hydroxypyruvate reductase B OS=Enterobacter agglomerans GN=tkrA PE=1 SV=1 89 331 3.0E-42
sp|A7MKR1|GHRB_CROS8 Glyoxylate/hydroxypyruvate reductase B OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=ghrB PE=3 SV=1 68 319 4.0E-42
sp|A4W577|GHRB_ENT38 Glyoxylate/hydroxypyruvate reductase B OS=Enterobacter sp. (strain 638) GN=ghrB PE=3 SV=1 68 319 2.0E-41
sp|O27051|SERA_METTH D-3-phosphoglycerate dehydrogenase OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=serA PE=3 SV=1 49 304 3.0E-41
sp|C6DJ88|GHRB_PECCP Glyoxylate/hydroxypyruvate reductase B OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=ghrB PE=3 SV=1 66 331 5.0E-41
sp|Q6DB24|GHRB_PECAS Glyoxylate/hydroxypyruvate reductase B OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=ghrB PE=3 SV=2 66 330 8.0E-40
sp|Q663W4|GHRB_YERPS Glyoxylate/hydroxypyruvate reductase B OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=ghrB PE=3 SV=1 66 319 6.0E-39
sp|A4TGN1|GHRB_YERPP Glyoxylate/hydroxypyruvate reductase B OS=Yersinia pestis (strain Pestoides F) GN=ghrB PE=3 SV=1 66 319 6.0E-39
sp|A9R4G6|GHRB_YERPG Glyoxylate/hydroxypyruvate reductase B OS=Yersinia pestis bv. Antiqua (strain Angola) GN=ghrB PE=3 SV=1 66 319 6.0E-39
sp|Q0W9V5|GHRB_YERPE Glyoxylate/hydroxypyruvate reductase B OS=Yersinia pestis GN=ghrB PE=3 SV=1 66 319 6.0E-39
sp|B2K7F1|GHRB_YERPB Glyoxylate/hydroxypyruvate reductase B OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=ghrB PE=3 SV=1 66 319 6.0E-39
sp|Q1C3K4|GHRB_YERPA Glyoxylate/hydroxypyruvate reductase B OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=ghrB PE=3 SV=1 66 319 6.0E-39
sp|A7FPA2|GHRB_YERP3 Glyoxylate/hydroxypyruvate reductase B OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=ghrB PE=3 SV=1 66 319 6.0E-39
sp|Q1CD80|GHRB_YERPN Glyoxylate/hydroxypyruvate reductase B OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=ghrB PE=3 SV=1 66 319 2.0E-38
sp|B1JH01|GHRB_YERPY Glyoxylate/hydroxypyruvate reductase B OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=ghrB PE=3 SV=1 66 319 3.0E-38
sp|A1RYE4|GYAR_THEPD Glyoxylate reductase OS=Thermofilum pendens (strain Hrk 5) GN=gyaR PE=3 SV=1 65 315 3.0E-37
sp|Q58424|SERA_METJA D-3-phosphoglycerate dehydrogenase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=serA PE=3 SV=1 79 304 4.0E-37
sp|A1JT62|GHRB_YERE8 Glyoxylate/hydroxypyruvate reductase B OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=ghrB PE=3 SV=1 66 319 1.0E-36
sp|O58320|GYAR_PYRHO Glyoxylate reductase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=gyaR PE=1 SV=2 68 315 7.0E-36
sp|Q49ZM5|Y606_STAS1 Putative 2-hydroxyacid dehydrogenase SSP0606 OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=SSP0606 PE=3 SV=1 68 309 1.0E-35
sp|P36234|DHGY_HYPME Glycerate dehydrogenase OS=Hyphomicrobium methylovorum PE=1 SV=2 71 307 3.0E-35
sp|A5GFY8|SERA_PIG D-3-phosphoglycerate dehydrogenase OS=Sus scrofa GN=PHGDH PE=3 SV=1 80 317 1.0E-34
sp|Q99RW8|Y2305_STAAM Putative 2-hydroxyacid dehydrogenase SAV2305 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=SAV2305 PE=3 SV=1 68 328 7.0E-34
sp|Q7A417|Y2098_STAAN Putative 2-hydroxyacid dehydrogenase SA2098 OS=Staphylococcus aureus (strain N315) GN=SA2098 PE=1 SV=1 68 328 7.0E-34
sp|Q6GEC9|Y2389_STAAR Putative 2-hydroxyacid dehydrogenase SAR2389 OS=Staphylococcus aureus (strain MRSA252) GN=SAR2389 PE=3 SV=1 68 328 2.0E-33
sp|Q9LT69|SERA3_ARATH D-3-phosphoglycerate dehydrogenase 3, chloroplastic OS=Arabidopsis thaliana GN=PGDH3 PE=1 SV=1 80 304 3.0E-33
sp|Q5EAD2|SERA_BOVIN D-3-phosphoglycerate dehydrogenase OS=Bos taurus GN=PHGDH PE=2 SV=3 80 331 3.0E-33
sp|Q2FVW4|Y2577_STAA8 Putative 2-hydroxyacid dehydrogenase SAOUHSC_02577 OS=Staphylococcus aureus (strain NCTC 8325) GN=SAOUHSC_02577 PE=3 SV=1 68 328 3.0E-33
sp|Q5HDQ4|Y2296_STAAC Putative 2-hydroxyacid dehydrogenase SACOL2296 OS=Staphylococcus aureus (strain COL) GN=SACOL2296 PE=3 SV=1 68 328 3.0E-33
sp|Q2FEI9|Y2254_STAA3 Putative 2-hydroxyacid dehydrogenase SAUSA300_2254 OS=Staphylococcus aureus (strain USA300) GN=SAUSA300_2254 PE=3 SV=1 68 328 3.0E-33
sp|Q8NV80|Y2224_STAAW Putative 2-hydroxyacid dehydrogenase MW2224 OS=Staphylococcus aureus (strain MW2) GN=MW2224 PE=3 SV=1 68 328 3.0E-33
sp|Q6G716|Y2196_STAAS Putative 2-hydroxyacid dehydrogenase SAS2196 OS=Staphylococcus aureus (strain MSSA476) GN=SAS2196 PE=3 SV=1 68 328 3.0E-33
sp|Q65CJ7|HPPR_PLESU Hydroxyphenylpyruvate reductase OS=Plectranthus scutellarioides GN=HPPR PE=1 SV=2 69 328 4.0E-33
sp|Q2YYT9|Y2178_STAAB Putative 2-hydroxyacid dehydrogenase SAB2178 OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=SAB2178 PE=3 SV=1 68 328 5.0E-33
sp|Q5HLU4|Y1888_STAEQ Putative 2-hydroxyacid dehydrogenase SERP1888 OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=SERP1888 PE=3 SV=1 68 307 1.0E-32
sp|Q9LE33|HPR3_ARATH Glyoxylate/hydroxypyruvate reductase HPR3 OS=Arabidopsis thaliana GN=HPR3 PE=2 SV=1 71 328 1.0E-32
sp|Q60HD7|SERA_MACFA D-3-phosphoglycerate dehydrogenase OS=Macaca fascicularis GN=PHGDH PE=2 SV=4 80 331 1.0E-32
sp|Q8CNB8|Y1879_STAES Putative 2-hydroxyacid dehydrogenase SE_1879 OS=Staphylococcus epidermidis (strain ATCC 12228) GN=SE_1879 PE=3 SV=1 68 307 2.0E-32
sp|A5A6P1|SERA_PANTR D-3-phosphoglycerate dehydrogenase OS=Pan troglodytes GN=PHGDH PE=2 SV=1 80 331 2.0E-32
sp|O43175|SERA_HUMAN D-3-phosphoglycerate dehydrogenase OS=Homo sapiens GN=PHGDH PE=1 SV=4 80 331 2.0E-32
sp|O49485|SERA1_ARATH D-3-phosphoglycerate dehydrogenase 1, chloroplastic OS=Arabidopsis thaliana GN=PGDH1 PE=1 SV=1 71 304 2.0E-32
sp|O08651|SERA_RAT D-3-phosphoglycerate dehydrogenase OS=Rattus norvegicus GN=Phgdh PE=1 SV=3 80 331 2.0E-32
sp|O69054|PTXD_PSEST Phosphonate dehydrogenase OS=Pseudomonas stutzeri GN=ptxD PE=1 SV=1 68 323 2.0E-32
sp|Q9UYR1|GYAR_PYRAB Glyoxylate reductase OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=gyaR PE=3 SV=1 68 315 3.0E-32
sp|P35136|SERA_BACSU D-3-phosphoglycerate dehydrogenase OS=Bacillus subtilis (strain 168) GN=serA PE=3 SV=3 71 304 3.0E-32
sp|O29445|SERA_ARCFU D-3-phosphoglycerate dehydrogenase OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=serA PE=3 SV=1 68 321 3.0E-32
sp|Q61753|SERA_MOUSE D-3-phosphoglycerate dehydrogenase OS=Mus musculus GN=Phgdh PE=1 SV=3 80 331 3.0E-32
sp|Q5FTU6|2KGR_GLUOX 2-ketogluconate reductase OS=Gluconobacter oxydans (strain 621H) GN=GOX0417 PE=1 SV=1 68 328 7.0E-32
sp|Q4L8G4|Y752_STAHJ Putative 2-hydroxyacid dehydrogenase SH0752 OS=Staphylococcus haemolyticus (strain JCSC1435) GN=SH0752 PE=3 SV=1 68 307 3.0E-31
sp|O04130|SERA2_ARATH D-3-phosphoglycerate dehydrogenase 2, chloroplastic OS=Arabidopsis thaliana GN=PGDH2 PE=1 SV=2 71 304 4.0E-31
sp|P9WNX3|SERA_MYCTU D-3-phosphoglycerate dehydrogenase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=serA PE=1 SV=1 68 336 5.0E-31
sp|P9WNX2|SERA_MYCTO D-3-phosphoglycerate dehydrogenase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=serA PE=3 SV=1 68 336 5.0E-31
sp|P0A545|SERA_MYCBO D-3-phosphoglycerate dehydrogenase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=serA PE=3 SV=1 68 336 5.0E-31
sp|Q5R7M2|SERA_PONAB D-3-phosphoglycerate dehydrogenase OS=Pongo abelii GN=PHGDH PE=2 SV=3 80 331 8.0E-31
sp|O33116|SERA_MYCLE D-3-phosphoglycerate dehydrogenase OS=Mycobacterium leprae (strain TN) GN=serA PE=3 SV=1 68 336 2.0E-30
sp|Q9CA90|HPR2_ARATH Glyoxylate/hydroxypyruvate reductase A HPR2 OS=Arabidopsis thaliana GN=HPR2 PE=1 SV=1 69 328 3.0E-30
sp|Q91Z53|GRHPR_MOUSE Glyoxylate reductase/hydroxypyruvate reductase OS=Mus musculus GN=Grhpr PE=1 SV=1 68 315 9.0E-29
sp|Q1QWN6|SLCC_CHRSD (S)-sulfolactate dehydrogenase OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=slcC PE=1 SV=1 68 322 2.0E-27
sp|Q9UBQ7|GRHPR_HUMAN Glyoxylate reductase/hydroxypyruvate reductase OS=Homo sapiens GN=GRHPR PE=1 SV=1 68 315 9.0E-27
sp|P52643|LDHD_ECOLI D-lactate dehydrogenase OS=Escherichia coli (strain K12) GN=ldhA PE=1 SV=1 80 315 7.0E-26
sp|Q47748|VANH_ENTFA D-specific alpha-keto acid dehydrogenase OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=vanHB PE=3 SV=2 114 315 3.0E-25
sp|P13443|DHGY_CUCSA Glycerate dehydrogenase OS=Cucumis sativus GN=HPR-A PE=2 SV=1 89 315 4.0E-25
sp|Q9SXP2|FDH1_ORYSJ Formate dehydrogenase 1, mitochondrial OS=Oryza sativa subsp. japonica GN=Os06g0486800 PE=1 SV=2 79 306 4.0E-25
sp|Q05709|VANH_ENTFC D-specific alpha-keto acid dehydrogenase OS=Enterococcus faecium GN=vanH PE=1 SV=1 72 314 4.0E-25
sp|Q9P7Q1|DDH2_SCHPO 2-hydroxyacid dehydrogenase homolog 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC186.02c PE=3 SV=1 88 302 6.0E-25
sp|Q9C9W5|HPR1_ARATH Glycerate dehydrogenase HPR, peroxisomal OS=Arabidopsis thaliana GN=HPR PE=1 SV=1 89 315 1.0E-24
sp|Q67U69|FDH2_ORYSJ Formate dehydrogenase 2, mitochondrial OS=Oryza sativa subsp. japonica GN=Os06g0486900 PE=2 SV=1 79 306 1.0E-24
sp|P17584|DHD2_LACPA D-2-hydroxyisocaproate dehydrogenase OS=Lactobacillus paracasei PE=1 SV=2 48 300 2.0E-24
sp|P73821|SERA_SYNY3 D-3-phosphoglycerate dehydrogenase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=serA PE=3 SV=1 65 307 3.0E-24
sp|Q9W758|CTBP2_XENLA C-terminal-binding protein 2 OS=Xenopus laevis GN=ctbp2 PE=1 SV=1 23 320 3.0E-24
sp|Q59516|DHGY_METEA Glycerate dehydrogenase OS=Methylobacterium extorquens (strain ATCC 14718 / DSM 1338 / AM1) GN=hprA PE=1 SV=3 73 322 4.0E-24
sp|Q0VCQ1|CTBP2_BOVIN C-terminal-binding protein 2 OS=Bos taurus GN=CTBP2 PE=1 SV=1 79 319 5.0E-24
sp|Q9P7P8|DDH1_SCHPO 2-hydroxyacid dehydrogenase homolog 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC186.07c PE=3 SV=1 68 315 6.0E-24
sp|Q59642|LDHD_PEDAC D-lactate dehydrogenase OS=Pediococcus acidilactici GN=ldhD PE=3 SV=1 89 328 7.0E-24
sp|P56545|CTBP2_HUMAN C-terminal-binding protein 2 OS=Homo sapiens GN=CTBP2 PE=1 SV=1 79 319 8.0E-24
sp|Q9EQH5|CTBP2_RAT C-terminal-binding protein 2 OS=Rattus norvegicus GN=Ctbp2 PE=1 SV=2 79 319 1.0E-23
sp|Q9S7E4|FDH_ARATH Formate dehydrogenase, chloroplastic/mitochondrial OS=Arabidopsis thaliana GN=FDH1 PE=1 SV=1 87 306 1.0E-23
sp|P56546|CTBP2_MOUSE C-terminal-binding protein 2 OS=Mus musculus GN=Ctbp2 PE=1 SV=2 79 319 1.0E-23
sp|P43885|SERA_HAEIN D-3-phosphoglycerate dehydrogenase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=serA PE=3 SV=1 71 307 1.0E-23
sp|Q9ZRI8|FDH_HORVU Formate dehydrogenase, mitochondrial OS=Hordeum vulgare PE=2 SV=1 87 306 2.0E-23
sp|Q13363|CTBP1_HUMAN C-terminal-binding protein 1 OS=Homo sapiens GN=CTBP1 PE=1 SV=2 23 322 4.0E-23
sp|Q9Z2F5|CTBP1_RAT C-terminal-binding protein 1 OS=Rattus norvegicus GN=Ctbp1 PE=1 SV=3 79 319 5.0E-23
sp|O88712|CTBP1_MOUSE C-terminal-binding protein 1 OS=Mus musculus GN=Ctbp1 PE=1 SV=2 23 322 5.0E-23
sp|G9EZR6|FLDH_CLOS3 Phenyllactate dehydrogenase OS=Clostridium sporogenes (strain ATCC 7955 / DSM 767 / NBRC 16411 / NCIMB 8053 / NCTC 8594 / PA 3679) GN=fldH PE=1 SV=1 80 316 7.0E-23
sp|O83080|LDHD_TREPA D-lactate dehydrogenase OS=Treponema pallidum (strain Nichols) GN=ldhD PE=3 SV=1 68 300 2.0E-22
sp|Q88VJ2|LDHD_LACPL D-lactate dehydrogenase OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=ldhD PE=3 SV=1 49 300 2.0E-22
sp|Q9YHU0|CTBP1_XENLA C-terminal-binding protein 1 OS=Xenopus laevis GN=ctbp1 PE=2 SV=1 23 319 5.0E-22
sp|P44501|DDH_HAEIN 2-hydroxyacid dehydrogenase homolog OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=ddh PE=3 SV=1 88 328 1.0E-21
sp|P26298|LDHD_LACPE D-lactate dehydrogenase OS=Lactobacillus pentosus PE=1 SV=1 49 300 8.0E-21
sp|Q07511|FDH_SOLTU Formate dehydrogenase, mitochondrial OS=Solanum tuberosum GN=FDH1 PE=1 SV=2 79 306 1.0E-20
sp|Q8E0N5|LDHD_STRA5 D-lactate dehydrogenase OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=ldhD PE=3 SV=1 48 313 1.0E-20
sp|P87228|SERA_SCHPO Putative D-3-phosphoglycerate dehydrogenase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC364.07 PE=1 SV=1 89 307 3.0E-20
sp|P0A9T3|SERA_SHIFL D-3-phosphoglycerate dehydrogenase OS=Shigella flexneri GN=serA PE=3 SV=2 89 307 3.0E-20
sp|P0A9T0|SERA_ECOLI D-3-phosphoglycerate dehydrogenase OS=Escherichia coli (strain K12) GN=serA PE=1 SV=2 89 307 3.0E-20
sp|P0A9T1|SERA_ECOL6 D-3-phosphoglycerate dehydrogenase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=serA PE=3 SV=2 89 307 3.0E-20
sp|P0A9T2|SERA_ECO57 D-3-phosphoglycerate dehydrogenase OS=Escherichia coli O157:H7 GN=serA PE=3 SV=2 89 307 3.0E-20
sp|O46036|CTBP_DROME C-terminal-binding protein OS=Drosophila melanogaster GN=CtBP PE=1 SV=3 79 319 4.0E-20
sp|P26297|LDHD_LACDA D-lactate dehydrogenase OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / JCM 1002 / NBRC 13953 / NCIMB 11778) GN=ldhA PE=1 SV=3 42 314 9.0E-20
sp|Q8E6A9|LDHD_STRA3 D-lactate dehydrogenase OS=Streptococcus agalactiae serotype III (strain NEM316) GN=ldhD PE=3 SV=1 80 313 1.0E-19
sp|P51011|LDHD_LEUMC D-lactate dehydrogenase OS=Leuconostoc mesenteroides subsp. cremoris PE=3 SV=1 89 307 1.0E-19
sp|Q03134|FDH_EMENI Formate dehydrogenase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=aciA PE=2 SV=3 66 306 2.0E-19
sp|P40054|SERA_YEAST D-3-phosphoglycerate dehydrogenase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SER3 PE=1 SV=1 89 307 2.0E-19
sp|Q02961|YP113_YEAST Putative 2-hydroxyacid dehydrogenase YPL113C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPL113C PE=2 SV=1 155 316 2.0E-19
sp|P53100|YGT5_YEAST Putative 2-hydroxyacid dehydrogenase YGL185C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YGL185C PE=1 SV=1 2 320 3.0E-19
sp|P40510|SER33_YEAST D-3-phosphoglycerate dehydrogenase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SER33 PE=1 SV=1 89 307 4.0E-19
sp|Q54UF7|LDHD_DICDI Putative D-lactate dehydrogenase OS=Dictyostelium discoideum GN=ldhA PE=1 SV=1 71 277 5.0E-19
sp|Q8CN22|LDHD_STAES D-lactate dehydrogenase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=ldhD PE=3 SV=1 80 313 6.0E-19
sp|Q5HLA0|LDHD_STAEQ D-lactate dehydrogenase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=ldhD PE=3 SV=1 80 313 6.0E-19
sp|P30901|LDHD_LACHE D-lactate dehydrogenase OS=Lactobacillus helveticus PE=1 SV=2 50 314 7.0E-19
sp|Q54UH8|SERA_DICDI D-3-phosphoglycerate dehydrogenase OS=Dictyostelium discoideum GN=serA PE=1 SV=1 89 304 9.0E-19
sp|P30799|DDH_ZYMMO 2-hydroxyacid dehydrogenase homolog OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=ddh PE=3 SV=3 69 321 6.0E-18
sp|Q6F943|PDXB_ACIAD Erythronate-4-phosphate dehydrogenase OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=pdxB PE=3 SV=1 78 329 8.0E-18
sp|Q6GDS2|LDHD_STAAR D-lactate dehydrogenase OS=Staphylococcus aureus (strain MRSA252) GN=ldhD PE=3 SV=1 80 309 1.0E-17
sp|Q2S0U3|PDXB_SALRD Erythronate-4-phosphate dehydrogenase OS=Salinibacter ruber (strain DSM 13855 / M31) GN=pdxB PE=3 SV=1 72 309 6.0E-17
sp|Q8A2E4|PDXB_BACTN Erythronate-4-phosphate dehydrogenase OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=pdxB PE=3 SV=1 6 315 9.0E-17
sp|O34815|YOAD_BACSU Putative 2-hydroxyacid dehydrogenase YoaD OS=Bacillus subtilis (strain 168) GN=yoaD PE=2 SV=1 92 304 1.0E-16
sp|P99116|LDHD_STAAN D-lactate dehydrogenase OS=Staphylococcus aureus (strain N315) GN=ldhD PE=1 SV=1 80 309 2.0E-16
sp|P63940|LDHD_STAAM D-lactate dehydrogenase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=ldhD PE=3 SV=1 80 309 2.0E-16
sp|P72357|LDHD_STAAU D-lactate dehydrogenase OS=Staphylococcus aureus GN=ldhD PE=1 SV=1 80 309 2.0E-16
sp|Q5HD29|LDHD_STAAC D-lactate dehydrogenase OS=Staphylococcus aureus (strain COL) GN=ldhD PE=3 SV=1 80 309 2.0E-16
sp|Q8NUT2|LDHD_STAAW D-lactate dehydrogenase OS=Staphylococcus aureus (strain MW2) GN=ldhD PE=3 SV=2 80 309 2.0E-16
sp|Q6G6F1|LDHD_STAAS D-lactate dehydrogenase OS=Staphylococcus aureus (strain MSSA476) GN=ldhD PE=3 SV=1 80 309 2.0E-16
sp|P33160|FDH_PSESR Formate dehydrogenase OS=Pseudomonas sp. (strain 101) PE=1 SV=3 79 306 4.0E-16
sp|P45250|Y1556_HAEIN Putative 2-hydroxyacid dehydrogenase HI_1556 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=HI_1556 PE=1 SV=1 67 297 8.0E-16
sp|Q02JM2|PDXB_PSEAB Erythronate-4-phosphate dehydrogenase OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=pdxB PE=3 SV=1 197 306 1.0E-15
sp|P0C1E9|YPRB2_CORML Uncharacterized protein in proB 3'region OS=Corynebacterium melassecola PE=3 SV=1 76 328 6.0E-15
sp|Q9I3W9|PDXB_PSEAE Erythronate-4-phosphate dehydrogenase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=pdxB PE=1 SV=1 197 306 9.0E-15
sp|A6V8H9|PDXB_PSEA7 Erythronate-4-phosphate dehydrogenase OS=Pseudomonas aeruginosa (strain PA7) GN=pdxB PE=3 SV=1 197 306 9.0E-15
sp|B7UVK4|PDXB_PSEA8 Erythronate-4-phosphate dehydrogenase OS=Pseudomonas aeruginosa (strain LESB58) GN=pdxB PE=3 SV=1 197 306 1.0E-14
sp|Q64ZV5|PDXB_BACFR Erythronate-4-phosphate dehydrogenase OS=Bacteroides fragilis (strain YCH46) GN=pdxB PE=3 SV=1 6 333 1.0E-14
sp|Q5LIR8|PDXB_BACFN Erythronate-4-phosphate dehydrogenase OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343) GN=pdxB PE=3 SV=1 6 333 1.0E-14
sp|P0C1E8|Y2355_CORGL Uncharacterized protein Cgl2355/cg2587 OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=Cgl2355 PE=3 SV=1 76 328 2.0E-14
sp|A1JL55|PDXB_YERE8 Erythronate-4-phosphate dehydrogenase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=pdxB PE=3 SV=1 152 343 2.0E-14
sp|B1JGI0|PDXB_YERPY Erythronate-4-phosphate dehydrogenase OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=pdxB PE=3 SV=1 152 334 3.0E-14
sp|Q668W7|PDXB_YERPS Erythronate-4-phosphate dehydrogenase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=pdxB PE=3 SV=2 152 334 3.0E-14
sp|A4TM66|PDXB_YERPP Erythronate-4-phosphate dehydrogenase OS=Yersinia pestis (strain Pestoides F) GN=pdxB PE=3 SV=2 152 334 3.0E-14
sp|Q1CHL8|PDXB_YERPN Erythronate-4-phosphate dehydrogenase OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=pdxB PE=3 SV=2 152 334 3.0E-14
sp|A9R7V0|PDXB_YERPG Erythronate-4-phosphate dehydrogenase OS=Yersinia pestis bv. Antiqua (strain Angola) GN=pdxB PE=3 SV=1 152 334 3.0E-14
sp|Q8D0U3|PDXB_YERPE Erythronate-4-phosphate dehydrogenase OS=Yersinia pestis GN=pdxB PE=3 SV=2 152 334 3.0E-14
sp|B2K8H7|PDXB_YERPB Erythronate-4-phosphate dehydrogenase OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=pdxB PE=3 SV=1 152 334 3.0E-14
sp|Q1C676|PDXB_YERPA Erythronate-4-phosphate dehydrogenase OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=pdxB PE=3 SV=2 152 334 3.0E-14
sp|A7FGL9|PDXB_YERP3 Erythronate-4-phosphate dehydrogenase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=pdxB PE=3 SV=1 152 334 3.0E-14
sp|Q99ZM2|LDHD_STRP1 D-lactate dehydrogenase OS=Streptococcus pyogenes serotype M1 GN=ldhD PE=3 SV=1 80 313 4.0E-14
sp|A5WHK7|PDXB_PSYWF Erythronate-4-phosphate dehydrogenase OS=Psychrobacter sp. (strain PRwf-1) GN=pdxB PE=3 SV=1 68 306 4.0E-14
sp|Q20595|CTBP1_CAEEL C-terminal-binding protein 1 OS=Caenorhabditis elegans GN=ctbp-1 PE=1 SV=3 80 319 9.0E-14
sp|Q1LTA7|PDXB_BAUCH Erythronate-4-phosphate dehydrogenase OS=Baumannia cicadellinicola subsp. Homalodisca coagulata GN=pdxB PE=3 SV=1 152 287 1.0E-13
sp|A8GH44|PDXB_SERP5 Erythronate-4-phosphate dehydrogenase OS=Serratia proteamaculans (strain 568) GN=pdxB PE=3 SV=1 152 306 1.0E-13
sp|Q492H2|PDXB_BLOPB Erythronate-4-phosphate dehydrogenase OS=Blochmannia pennsylvanicus (strain BPEN) GN=pdxB PE=3 SV=1 156 306 2.0E-13
sp|Q4ZVE7|PDXB_PSEU2 Erythronate-4-phosphate dehydrogenase OS=Pseudomonas syringae pv. syringae (strain B728a) GN=pdxB PE=3 SV=1 152 306 2.0E-13
sp|Q0HWL8|PDXB_SHESR Erythronate-4-phosphate dehydrogenase OS=Shewanella sp. (strain MR-7) GN=pdxB PE=3 SV=1 68 329 3.0E-13
sp|B0VT23|PDXB_ACIBS Erythronate-4-phosphate dehydrogenase OS=Acinetobacter baumannii (strain SDF) GN=pdxB PE=3 SV=1 78 338 3.0E-13
sp|Q9KQ92|PDXB_VIBCH Erythronate-4-phosphate dehydrogenase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=pdxB PE=1 SV=2 80 306 3.0E-13
sp|B2HX89|PDXB_ACIBC Erythronate-4-phosphate dehydrogenase OS=Acinetobacter baumannii (strain ACICU) GN=pdxB PE=3 SV=1 78 338 3.0E-13
sp|A3M810|PDXB_ACIBT Erythronate-4-phosphate dehydrogenase OS=Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377) GN=pdxB PE=3 SV=2 78 306 5.0E-13
sp|B0VDM7|PDXB_ACIBY Erythronate-4-phosphate dehydrogenase OS=Acinetobacter baumannii (strain AYE) GN=pdxB PE=3 SV=1 78 338 6.0E-13
sp|B7I5Z2|PDXB_ACIB5 Erythronate-4-phosphate dehydrogenase OS=Acinetobacter baumannii (strain AB0057) GN=pdxB PE=3 SV=1 78 338 6.0E-13
sp|B7GY62|PDXB_ACIB3 Erythronate-4-phosphate dehydrogenase OS=Acinetobacter baumannii (strain AB307-0294) GN=pdxB PE=3 SV=1 78 338 6.0E-13
sp|Q8ECR2|PDXB_SHEON Erythronate-4-phosphate dehydrogenase OS=Shewanella oneidensis (strain MR-1) GN=pdxB PE=3 SV=1 79 306 6.0E-13
sp|A4SNU1|PDXB_AERS4 Erythronate-4-phosphate dehydrogenase OS=Aeromonas salmonicida (strain A449) GN=pdxB PE=3 SV=1 68 329 7.0E-13
sp|Q3K9D1|PDXB_PSEPF Erythronate-4-phosphate dehydrogenase OS=Pseudomonas fluorescens (strain Pf0-1) GN=pdxB PE=3 SV=1 152 306 1.0E-12
sp|Q08911|FDH1_YEAST Formate dehydrogenase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FDH1 PE=1 SV=1 79 289 2.0E-12
sp|N1P3Y5|FDH1_YEASC Formate dehydrogenase 1 OS=Saccharomyces cerevisiae (strain CEN.PK113-7D) GN=FDH1 PE=2 SV=1 79 289 2.0E-12
sp|C8ZHD6|FDH1_YEAS8 Formate dehydrogenase 1 OS=Saccharomyces cerevisiae (strain Lalvin EC1118 / Prise de mousse) GN=FDH1 PE=2 SV=1 79 289 2.0E-12
sp|A6ZN46|FDH1_YEAS7 Formate dehydrogenase 1 OS=Saccharomyces cerevisiae (strain YJM789) GN=FDH1 PE=2 SV=1 79 289 2.0E-12
sp|P0CT22|FDH2_YEASC Formate dehydrogenase 2 OS=Saccharomyces cerevisiae (strain CEN.PK113-7D) GN=FDH2 PE=2 SV=1 79 289 2.0E-12
sp|Q07103|FDH_NEUCR Formate dehydrogenase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=fdh PE=2 SV=1 66 306 2.0E-12
sp|Q2NSH9|PDXB_SODGM Erythronate-4-phosphate dehydrogenase OS=Sodalis glossinidius (strain morsitans) GN=pdxB PE=3 SV=1 179 306 2.0E-12
sp|Q0HKB6|PDXB_SHESM Erythronate-4-phosphate dehydrogenase OS=Shewanella sp. (strain MR-4) GN=pdxB PE=3 SV=1 68 329 4.0E-12
sp|B0TKZ7|PDXB_SHEHH Erythronate-4-phosphate dehydrogenase OS=Shewanella halifaxensis (strain HAW-EB4) GN=pdxB PE=3 SV=1 80 329 4.0E-12
sp|A4XTK4|PDXB_PSEMY Erythronate-4-phosphate dehydrogenase OS=Pseudomonas mendocina (strain ymp) GN=pdxB PE=3 SV=1 180 306 6.0E-12
sp|Q8D2P6|PDXB_WIGBR Erythronate-4-phosphate dehydrogenase OS=Wigglesworthia glossinidia brevipalpis GN=pdxB PE=3 SV=1 158 306 6.0E-12
sp|B4EZF9|PDXB_PROMH Erythronate-4-phosphate dehydrogenase OS=Proteus mirabilis (strain HI4320) GN=pdxB PE=3 SV=1 201 306 7.0E-12
sp|B5BCH6|PDXB_SALPK Erythronate-4-phosphate dehydrogenase OS=Salmonella paratyphi A (strain AKU_12601) GN=pdxB PE=3 SV=1 152 306 8.0E-12
sp|Q5PCV8|PDXB_SALPA Erythronate-4-phosphate dehydrogenase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=pdxB PE=3 SV=1 152 306 8.0E-12
sp|Q15QG8|PDXB_PSEA6 Erythronate-4-phosphate dehydrogenase OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=pdxB PE=3 SV=1 158 329 1.0E-11
sp|Q0VQC3|PDXB_ALCBS Erythronate-4-phosphate dehydrogenase OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=pdxB PE=3 SV=2 78 306 2.0E-11
sp|P60802|PDXB_SALTY Erythronate-4-phosphate dehydrogenase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=pdxB PE=1 SV=1 152 306 3.0E-11
sp|P60801|PDXB_SALTI Erythronate-4-phosphate dehydrogenase OS=Salmonella typhi GN=pdxB PE=3 SV=1 152 306 3.0E-11
sp|C0PZZ3|PDXB_SALPC Erythronate-4-phosphate dehydrogenase OS=Salmonella paratyphi C (strain RKS4594) GN=pdxB PE=3 SV=1 152 306 3.0E-11
sp|A9N474|PDXB_SALPB Erythronate-4-phosphate dehydrogenase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=pdxB PE=3 SV=1 152 306 3.0E-11
sp|B4SZP2|PDXB_SALNS Erythronate-4-phosphate dehydrogenase OS=Salmonella newport (strain SL254) GN=pdxB PE=3 SV=1 152 306 3.0E-11
sp|B4TBN9|PDXB_SALHS Erythronate-4-phosphate dehydrogenase OS=Salmonella heidelberg (strain SL476) GN=pdxB PE=3 SV=1 152 306 3.0E-11
sp|Q57LY4|PDXB_SALCH Erythronate-4-phosphate dehydrogenase OS=Salmonella choleraesuis (strain SC-B67) GN=pdxB PE=3 SV=2 152 306 3.0E-11
sp|B5EZQ4|PDXB_SALA4 Erythronate-4-phosphate dehydrogenase OS=Salmonella agona (strain SL483) GN=pdxB PE=3 SV=1 152 306 3.0E-11
sp|A0KV91|PDXB_SHESA Erythronate-4-phosphate dehydrogenase OS=Shewanella sp. (strain ANA-3) GN=pdxB PE=3 SV=1 68 329 3.0E-11
sp|B4TQA6|PDXB_SALSV Erythronate-4-phosphate dehydrogenase OS=Salmonella schwarzengrund (strain CVM19633) GN=pdxB PE=3 SV=1 152 306 3.0E-11
sp|B5RCJ5|PDXB_SALG2 Erythronate-4-phosphate dehydrogenase OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=pdxB PE=3 SV=1 152 306 3.0E-11
sp|B5R3Q1|PDXB_SALEP Erythronate-4-phosphate dehydrogenase OS=Salmonella enteritidis PT4 (strain P125109) GN=pdxB PE=3 SV=1 152 306 3.0E-11
sp|B5FPL4|PDXB_SALDC Erythronate-4-phosphate dehydrogenase OS=Salmonella dublin (strain CT_02021853) GN=pdxB PE=3 SV=1 152 306 3.0E-11
sp|G0SGU4|FDH_CHATD Formate dehydrogenase OS=Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) GN=FDH PE=1 SV=1 66 309 4.0E-11
sp|Q48KQ3|PDXB_PSE14 Erythronate-4-phosphate dehydrogenase OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=pdxB PE=3 SV=2 199 306 4.0E-11
sp|Q1QE21|PDXB_PSYCK Erythronate-4-phosphate dehydrogenase OS=Psychrobacter cryohalolentis (strain K5) GN=pdxB PE=3 SV=1 79 302 5.0E-11
sp|Q3IF36|PDXB_PSEHT Erythronate-4-phosphate dehydrogenase OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=pdxB PE=3 SV=1 157 306 9.0E-11
sp|C1DM66|PDXB_AZOVD Erythronate-4-phosphate dehydrogenase OS=Azotobacter vinelandii (strain DJ / ATCC BAA-1303) GN=pdxB PE=3 SV=1 179 306 1.0E-10
sp|A1RIA7|PDXB_SHESW Erythronate-4-phosphate dehydrogenase OS=Shewanella sp. (strain W3-18-1) GN=pdxB PE=3 SV=1 79 306 1.0E-10
sp|A4Y882|PDXB_SHEPC Erythronate-4-phosphate dehydrogenase OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=pdxB PE=3 SV=1 79 306 1.0E-10
sp|O13437|FDH_CANBO Formate dehydrogenase OS=Candida boidinii GN=FDH1 PE=1 SV=1 67 309 2.0E-10
sp|B8EEB4|PDXB_SHEB2 Erythronate-4-phosphate dehydrogenase OS=Shewanella baltica (strain OS223) GN=pdxB PE=3 SV=1 68 306 2.0E-10
sp|A5W6I8|PDXB_PSEP1 Erythronate-4-phosphate dehydrogenase OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=pdxB PE=3 SV=1 199 306 2.0E-10
sp|A6VXM3|PDXB_MARMS Erythronate-4-phosphate dehydrogenase OS=Marinomonas sp. (strain MWYL1) GN=pdxB PE=3 SV=1 71 306 2.0E-10
sp|Q88L20|PDXB_PSEPK Erythronate-4-phosphate dehydrogenase OS=Pseudomonas putida (strain KT2440) GN=pdxB PE=3 SV=1 199 306 2.0E-10
sp|A9KTV0|PDXB_SHEB9 Erythronate-4-phosphate dehydrogenase OS=Shewanella baltica (strain OS195) GN=pdxB PE=3 SV=1 68 329 2.0E-10
sp|Q884R9|PDXB_PSESM Erythronate-4-phosphate dehydrogenase OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=pdxB PE=3 SV=1 179 306 3.0E-10
sp|C6DA76|PDXB_PECCP Erythronate-4-phosphate dehydrogenase OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=pdxB PE=3 SV=1 201 333 3.0E-10
sp|Q4KFD1|PDXB_PSEF5 Erythronate-4-phosphate dehydrogenase OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=pdxB PE=3 SV=1 194 306 3.0E-10
sp|P33677|FDH_PICAN Formate dehydrogenase OS=Pichia angusta GN=FMDH PE=3 SV=2 86 282 3.0E-10
sp|A6WQ07|PDXB_SHEB8 Erythronate-4-phosphate dehydrogenase OS=Shewanella baltica (strain OS185) GN=pdxB PE=3 SV=1 68 329 3.0E-10
sp|Q31IH6|PDXB_THICR Erythronate-4-phosphate dehydrogenase OS=Thiomicrospira crunogena (strain XCL-2) GN=pdxB PE=3 SV=1 157 297 4.0E-10
sp|Q2VEQ7|DDH_HALMT D-2-hydroxyacid dehydrogenase OS=Haloferax mediterranei (strain ATCC 33500 / DSM 1411 / JCM 8866 / NBRC 14739 / NCIMB 2177 / R-4) GN=ddh PE=1 SV=1 88 300 5.0E-10
sp|A3D669|PDXB_SHEB5 Erythronate-4-phosphate dehydrogenase OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=pdxB PE=3 SV=1 68 329 5.0E-10
sp|B6EIW3|PDXB_ALISL Erythronate-4-phosphate dehydrogenase OS=Aliivibrio salmonicida (strain LFI1238) GN=pdxB PE=3 SV=1 68 306 5.0E-10
sp|P0CF35|FDH2_YEAST Truncated formate dehydrogenase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FDH2 PE=5 SV=1 153 289 5.0E-10
sp|Q4FV16|PDXB_PSYA2 Erythronate-4-phosphate dehydrogenase OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=pdxB PE=3 SV=2 79 302 5.0E-10
sp|A0KLP0|PDXB_AERHH Erythronate-4-phosphate dehydrogenase OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=pdxB PE=3 SV=1 160 306 8.0E-10
sp|Q5QUE2|PDXB_IDILO Erythronate-4-phosphate dehydrogenase OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=pdxB PE=3 SV=1 68 302 8.0E-10
sp|Q6D2N5|PDXB_PECAS Erythronate-4-phosphate dehydrogenase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=pdxB PE=3 SV=1 201 333 9.0E-10
sp|Q1I7B3|PDXB_PSEE4 Erythronate-4-phosphate dehydrogenase OS=Pseudomonas entomophila (strain L48) GN=pdxB PE=3 SV=1 195 306 1.0E-09
sp|Q1QXV7|PDXB_CHRSD Erythronate-4-phosphate dehydrogenase OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=pdxB PE=3 SV=1 158 330 2.0E-09
sp|B0KGD9|PDXB_PSEPG Erythronate-4-phosphate dehydrogenase OS=Pseudomonas putida (strain GB-1) GN=pdxB PE=3 SV=1 199 306 2.0E-09
sp|Q7VRU9|PDXB_BLOFL Erythronate-4-phosphate dehydrogenase OS=Blochmannia floridanus GN=pdxB PE=3 SV=1 156 306 3.0E-09
sp|Q57QM2|GHRA_SALCH Glyoxylate/hydroxypyruvate reductase A OS=Salmonella choleraesuis (strain SC-B67) GN=ghrA PE=3 SV=1 160 297 4.0E-09
sp|A8GD46|GHRA_SERP5 Glyoxylate/hydroxypyruvate reductase A OS=Serratia proteamaculans (strain 568) GN=ghrA PE=3 SV=1 142 321 5.0E-09
sp|B1J5D7|PDXB_PSEPW Erythronate-4-phosphate dehydrogenase OS=Pseudomonas putida (strain W619) GN=pdxB PE=3 SV=1 199 306 5.0E-09
sp|B7VL81|PDXB_VIBTL Erythronate-4-phosphate dehydrogenase OS=Vibrio tasmaniensis (strain LGP32) GN=pdxB PE=3 SV=1 157 306 7.0E-09
sp|A9MH27|GHRA_SALAR Glyoxylate/hydroxypyruvate reductase A OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=ghrA PE=3 SV=1 160 297 7.0E-09
sp|C3K5G7|PDXB_PSEFS Erythronate-4-phosphate dehydrogenase OS=Pseudomonas fluorescens (strain SBW25) GN=pdxB PE=3 SV=1 201 306 8.0E-09
sp|Q7N2B2|PDXB_PHOLL Erythronate-4-phosphate dehydrogenase OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=pdxB PE=3 SV=1 199 306 9.0E-09
sp|A4W948|GHRA_ENT38 Glyoxylate/hydroxypyruvate reductase A OS=Enterobacter sp. (strain 638) GN=ghrA PE=3 SV=1 156 296 1.0E-08
sp|A1SW94|PDXB_PSYIN Erythronate-4-phosphate dehydrogenase OS=Psychromonas ingrahamii (strain 37) GN=pdxB PE=3 SV=1 157 309 1.0E-08
sp|A9N5T3|GHRA_SALPB Glyoxylate/hydroxypyruvate reductase A OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=ghrA PE=3 SV=1 160 321 1.0E-08
sp|Q8ZQ30|GHRA_SALTY Glyoxylate/hydroxypyruvate reductase A OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=ghrA PE=1 SV=1 160 297 2.0E-08
sp|C0Q872|GHRA_SALPC Glyoxylate/hydroxypyruvate reductase A OS=Salmonella paratyphi C (strain RKS4594) GN=ghrA PE=3 SV=1 160 297 2.0E-08
sp|B4TSP5|GHRA_SALSV Glyoxylate/hydroxypyruvate reductase A OS=Salmonella schwarzengrund (strain CVM19633) GN=ghrA PE=3 SV=1 160 297 2.0E-08
sp|B5BBF3|GHRA_SALPK Glyoxylate/hydroxypyruvate reductase A OS=Salmonella paratyphi A (strain AKU_12601) GN=ghrA PE=3 SV=1 160 297 2.0E-08
sp|Q5PGZ3|GHRA_SALPA Glyoxylate/hydroxypyruvate reductase A OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=ghrA PE=3 SV=1 160 297 2.0E-08
sp|B4TEQ6|GHRA_SALHS Glyoxylate/hydroxypyruvate reductase A OS=Salmonella heidelberg (strain SL476) GN=ghrA PE=3 SV=1 160 297 2.0E-08
sp|B5FL30|GHRA_SALDC Glyoxylate/hydroxypyruvate reductase A OS=Salmonella dublin (strain CT_02021853) GN=ghrA PE=3 SV=1 160 296 2.0E-08
sp|B5QY30|GHRA_SALEP Glyoxylate/hydroxypyruvate reductase A OS=Salmonella enteritidis PT4 (strain P125109) GN=ghrA PE=3 SV=1 160 297 2.0E-08
sp|B4T2W6|GHRA_SALNS Glyoxylate/hydroxypyruvate reductase A OS=Salmonella newport (strain SL254) GN=ghrA PE=3 SV=1 160 297 2.0E-08
sp|B5RBG3|GHRA_SALG2 Glyoxylate/hydroxypyruvate reductase A OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=ghrA PE=3 SV=1 160 297 2.0E-08
sp|B5F974|GHRA_SALA4 Glyoxylate/hydroxypyruvate reductase A OS=Salmonella agona (strain SL483) GN=ghrA PE=3 SV=1 160 297 2.0E-08
sp|Q8Z7M6|GHRA_SALTI Glyoxylate/hydroxypyruvate reductase A OS=Salmonella typhi GN=ghrA PE=3 SV=1 160 297 2.0E-08
sp|Q5E452|PDXB_VIBF1 Erythronate-4-phosphate dehydrogenase OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=pdxB PE=3 SV=1 68 306 2.0E-08
sp|B5XNR7|PDXB_KLEP3 Erythronate-4-phosphate dehydrogenase OS=Klebsiella pneumoniae (strain 342) GN=pdxB PE=3 SV=1 194 306 2.0E-08
sp|A1AWW7|PDXB_RUTMC Erythronate-4-phosphate dehydrogenase OS=Ruthia magnifica subsp. Calyptogena magnifica GN=pdxB PE=3 SV=1 151 304 3.0E-08
sp|A8AI49|GHRA_CITK8 Glyoxylate/hydroxypyruvate reductase A OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=ghrA PE=3 SV=1 153 296 4.0E-08
sp|O23702|CTBP_ARATH C-terminal binding protein AN OS=Arabidopsis thaliana GN=AN PE=1 SV=1 105 313 4.0E-08
sp|C5B8N0|PDXB_EDWI9 Erythronate-4-phosphate dehydrogenase OS=Edwardsiella ictaluri (strain 93-146) GN=pdxB PE=3 SV=1 201 306 5.0E-08
sp|A1JRR3|GHRA_YERE8 Glyoxylate/hydroxypyruvate reductase A OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=ghrA PE=3 SV=1 153 301 5.0E-08
sp|B5FFP0|PDXB_VIBFM Erythronate-4-phosphate dehydrogenase OS=Vibrio fischeri (strain MJ11) GN=pdxB PE=3 SV=1 68 306 8.0E-08
sp|A9MJ55|PDXB_SALAR Erythronate-4-phosphate dehydrogenase OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=pdxB PE=3 SV=1 204 306 1.0E-07
sp|A7MH63|PDXB_CROS8 Erythronate-4-phosphate dehydrogenase OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=pdxB PE=3 SV=1 204 306 1.0E-07
sp|B7LBH4|PDXB_ECO55 Erythronate-4-phosphate dehydrogenase OS=Escherichia coli (strain 55989 / EAEC) GN=pdxB PE=3 SV=1 194 306 1.0E-07
sp|Q1R992|PDXB_ECOUT Erythronate-4-phosphate dehydrogenase OS=Escherichia coli (strain UTI89 / UPEC) GN=pdxB PE=3 SV=1 201 306 1.0E-07
sp|A1ADG9|PDXB_ECOK1 Erythronate-4-phosphate dehydrogenase OS=Escherichia coli O1:K1 / APEC GN=pdxB PE=3 SV=1 201 306 1.0E-07
sp|B7MG84|PDXB_ECO45 Erythronate-4-phosphate dehydrogenase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=pdxB PE=3 SV=1 201 306 1.0E-07
sp|Q56731|PDXB_SHESP Erythronate-4-phosphate dehydrogenase (Fragment) OS=Shewanella sp. (strain DB6705) GN=pdxB PE=3 SV=1 156 306 1.0E-07
sp|B5YXW1|PDXB_ECO5E Erythronate-4-phosphate dehydrogenase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=pdxB PE=3 SV=1 194 306 1.0E-07
sp|Q8XCR0|PDXB_ECO57 Erythronate-4-phosphate dehydrogenase OS=Escherichia coli O157:H7 GN=pdxB PE=3 SV=1 194 306 1.0E-07
sp|B7NLA1|GHRA_ECO7I Glyoxylate/hydroxypyruvate reductase A OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=ghrA PE=3 SV=1 156 321 2.0E-07
sp|Q32DL6|PDXB_SHIDS Erythronate-4-phosphate dehydrogenase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=pdxB PE=3 SV=1 201 329 2.0E-07
sp|A4VKJ1|PDXB_PSEU5 Erythronate-4-phosphate dehydrogenase OS=Pseudomonas stutzeri (strain A1501) GN=pdxB PE=3 SV=1 197 306 2.0E-07
sp|B1KKP1|PDXB_SHEWM Erythronate-4-phosphate dehydrogenase OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=pdxB PE=3 SV=1 68 343 2.0E-07
sp|C5BR49|PDXB_TERTT Erythronate-4-phosphate dehydrogenase OS=Teredinibacter turnerae (strain ATCC 39867 / T7901) GN=pdxB PE=3 SV=1 151 306 2.0E-07
sp|B1IXM2|PDXB_ECOLC Erythronate-4-phosphate dehydrogenase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=pdxB PE=3 SV=1 201 306 2.0E-07
sp|Q83QR1|PDXB_SHIFL Erythronate-4-phosphate dehydrogenase OS=Shigella flexneri GN=pdxB PE=3 SV=1 201 306 2.0E-07
sp|Q0T2G5|PDXB_SHIF8 Erythronate-4-phosphate dehydrogenase OS=Shigella flexneri serotype 5b (strain 8401) GN=pdxB PE=3 SV=1 201 306 2.0E-07
sp|Q8FIT1|GHRA_ECOL6 Glyoxylate/hydroxypyruvate reductase A OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=ghrA PE=3 SV=1 156 297 2.0E-07
sp|B5YVQ3|GHRA_ECO5E Glyoxylate/hydroxypyruvate reductase A OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=ghrA PE=3 SV=1 156 297 2.0E-07
sp|Q8X9K1|GHRA_ECO57 Glyoxylate/hydroxypyruvate reductase A OS=Escherichia coli O157:H7 GN=ghrA PE=3 SV=2 156 297 2.0E-07
sp|B7N5T2|PDXB_ECOLU Erythronate-4-phosphate dehydrogenase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=pdxB PE=3 SV=1 200 306 3.0E-07
sp|B7UFX8|PDXB_ECO27 Erythronate-4-phosphate dehydrogenase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=pdxB PE=3 SV=1 201 306 3.0E-07
sp|A1U1I8|PDXB_MARHV Erythronate-4-phosphate dehydrogenase OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=pdxB PE=3 SV=1 211 330 3.0E-07
sp|Q3YZP1|PDXB_SHISS Erythronate-4-phosphate dehydrogenase OS=Shigella sonnei (strain Ss046) GN=pdxB PE=3 SV=1 201 306 3.0E-07
sp|Q31YD8|PDXB_SHIBS Erythronate-4-phosphate dehydrogenase OS=Shigella boydii serotype 4 (strain Sb227) GN=pdxB PE=3 SV=1 201 306 3.0E-07
sp|B2TWA2|PDXB_SHIB3 Erythronate-4-phosphate dehydrogenase OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=pdxB PE=3 SV=1 201 306 3.0E-07
sp|B7LLF0|PDXB_ESCF3 Erythronate-4-phosphate dehydrogenase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=pdxB PE=3 SV=1 201 306 3.0E-07
sp|B6I4U8|PDXB_ECOSE Erythronate-4-phosphate dehydrogenase OS=Escherichia coli (strain SE11) GN=pdxB PE=3 SV=1 201 306 3.0E-07
sp|A8A2I9|PDXB_ECOHS Erythronate-4-phosphate dehydrogenase OS=Escherichia coli O9:H4 (strain HS) GN=pdxB PE=3 SV=1 201 306 3.0E-07
sp|B7M6K1|PDXB_ECO8A Erythronate-4-phosphate dehydrogenase OS=Escherichia coli O8 (strain IAI1) GN=pdxB PE=3 SV=1 201 306 3.0E-07
sp|B1LLS6|PDXB_ECOSM Erythronate-4-phosphate dehydrogenase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=pdxB PE=3 SV=1 201 306 3.0E-07
sp|Q8FFH2|PDXB_ECOL6 Erythronate-4-phosphate dehydrogenase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=pdxB PE=3 SV=1 201 306 3.0E-07
sp|A7ZPD6|PDXB_ECO24 Erythronate-4-phosphate dehydrogenase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=pdxB PE=3 SV=1 200 306 3.0E-07
sp|Q7MV70|PDXB_PORGI Erythronate-4-phosphate dehydrogenase OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) GN=pdxB PE=3 SV=2 78 302 4.0E-07
sp|B7NP01|PDXB_ECO7I Erythronate-4-phosphate dehydrogenase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=pdxB PE=3 SV=1 201 306 4.0E-07
sp|Q0TFC6|PDXB_ECOL5 Erythronate-4-phosphate dehydrogenase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=pdxB PE=3 SV=1 201 306 4.0E-07
sp|B5XXL3|GHRA_KLEP3 Glyoxylate/hydroxypyruvate reductase A OS=Klebsiella pneumoniae (strain 342) GN=ghrA PE=3 SV=1 160 308 5.0E-07
sp|A3QFC7|PDXB_SHELP Erythronate-4-phosphate dehydrogenase OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=pdxB PE=3 SV=1 153 306 5.0E-07
sp|B3PK14|PDXB_CELJU Erythronate-4-phosphate dehydrogenase OS=Cellvibrio japonicus (strain Ueda107) GN=pdxB PE=3 SV=1 160 329 5.0E-07
sp|B7MTG4|GHRA_ECO81 Glyoxylate/hydroxypyruvate reductase A OS=Escherichia coli O81 (strain ED1a) GN=ghrA PE=3 SV=1 156 297 5.0E-07
sp|Q7MIT6|PDXB_VIBVY Erythronate-4-phosphate dehydrogenase OS=Vibrio vulnificus (strain YJ016) GN=pdxB PE=3 SV=2 78 306 6.0E-07
sp|A5CWD1|PDXB_VESOH Erythronate-4-phosphate dehydrogenase OS=Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA) GN=pdxB PE=3 SV=1 151 304 7.0E-07
sp|B7LTA2|GHRA_ESCF3 Glyoxylate/hydroxypyruvate reductase A OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=ghrA PE=3 SV=1 79 297 7.0E-07
sp|A6T7B8|GHRA_KLEP7 Glyoxylate/hydroxypyruvate reductase A OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=ghrA PE=3 SV=1 160 308 8.0E-07
sp|A8ADQ9|PDXB_CITK8 Erythronate-4-phosphate dehydrogenase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=pdxB PE=3 SV=1 201 306 8.0E-07
sp|Q7N571|GHRA_PHOLL Glyoxylate/hydroxypyruvate reductase A OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=ghrA PE=3 SV=1 138 301 8.0E-07
sp|Q87MN8|PDXB_VIBPA Erythronate-4-phosphate dehydrogenase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=pdxB PE=3 SV=1 68 306 9.0E-07
sp|A4WCV4|PDXB_ENT38 Erythronate-4-phosphate dehydrogenase OS=Enterobacter sp. (strain 638) GN=pdxB PE=3 SV=1 201 306 9.0E-07
sp|B7MXZ7|PDXB_ECO81 Erythronate-4-phosphate dehydrogenase OS=Escherichia coli O81 (strain ED1a) GN=pdxB PE=3 SV=1 201 306 1.0E-06
sp|Q31Z89|GHRA_SHIBS Glyoxylate/hydroxypyruvate reductase A OS=Shigella boydii serotype 4 (strain Sb227) GN=ghrA PE=3 SV=2 156 297 1.0E-06
sp|B2TTN6|GHRA_SHIB3 Glyoxylate/hydroxypyruvate reductase A OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=ghrA PE=3 SV=1 156 297 1.0E-06
sp|A7ZYY6|GHRA_ECOHS Glyoxylate/hydroxypyruvate reductase A OS=Escherichia coli O9:H4 (strain HS) GN=ghrA PE=3 SV=1 156 297 1.0E-06
sp|Q0TJ41|GHRA_ECOL5 Glyoxylate/hydroxypyruvate reductase A OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=ghrA PE=3 SV=1 156 297 1.0E-06
sp|Q3Z393|GHRA_SHISS Glyoxylate/hydroxypyruvate reductase A OS=Shigella sonnei (strain Ss046) GN=ghrA PE=3 SV=2 156 297 1.0E-06
sp|B6I9A9|GHRA_ECOSE Glyoxylate/hydroxypyruvate reductase A OS=Escherichia coli (strain SE11) GN=ghrA PE=3 SV=1 156 297 1.0E-06
sp|P75913|GHRA_ECOLI Glyoxylate/hydroxypyruvate reductase A OS=Escherichia coli (strain K12) GN=ghrA PE=1 SV=2 156 297 1.0E-06
sp|B1X9E7|GHRA_ECODH Glyoxylate/hydroxypyruvate reductase A OS=Escherichia coli (strain K12 / DH10B) GN=ghrA PE=3 SV=1 156 297 1.0E-06
sp|C4ZRX4|GHRA_ECOBW Glyoxylate/hydroxypyruvate reductase A OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=ghrA PE=3 SV=1 156 297 1.0E-06
sp|B7M907|GHRA_ECO8A Glyoxylate/hydroxypyruvate reductase A OS=Escherichia coli O8 (strain IAI1) GN=ghrA PE=3 SV=1 156 297 1.0E-06
sp|B7UP47|GHRA_ECO27 Glyoxylate/hydroxypyruvate reductase A OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=ghrA PE=3 SV=1 156 297 1.0E-06
sp|B1IV68|GHRA_ECOLC Glyoxylate/hydroxypyruvate reductase A OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=ghrA PE=3 SV=1 156 297 1.0E-06
sp|B1LIY1|GHRA_ECOSM Glyoxylate/hydroxypyruvate reductase A OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=ghrA PE=3 SV=1 156 297 1.0E-06
sp|Q32HN5|GHRA_SHIDS Glyoxylate/hydroxypyruvate reductase A OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=ghrA PE=3 SV=2 156 297 1.0E-06
sp|Q1RDC8|GHRA_ECOUT Glyoxylate/hydroxypyruvate reductase A OS=Escherichia coli (strain UTI89 / UPEC) GN=ghrA PE=3 SV=2 156 297 1.0E-06
sp|A1A9T1|GHRA_ECOK1 Glyoxylate/hydroxypyruvate reductase A OS=Escherichia coli O1:K1 / APEC GN=ghrA PE=3 SV=2 156 297 1.0E-06
sp|B7MIH3|GHRA_ECO45 Glyoxylate/hydroxypyruvate reductase A OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=ghrA PE=3 SV=1 156 297 1.0E-06
sp|Q8DB36|PDXB_VIBVU Erythronate-4-phosphate dehydrogenase OS=Vibrio vulnificus (strain CMCP6) GN=pdxB PE=3 SV=2 78 306 2.0E-06
sp|P05459|PDXB_ECOLI Erythronate-4-phosphate dehydrogenase OS=Escherichia coli (strain K12) GN=pdxB PE=2 SV=2 201 306 3.0E-06
sp|B1X931|PDXB_ECODH Erythronate-4-phosphate dehydrogenase OS=Escherichia coli (strain K12 / DH10B) GN=pdxB PE=3 SV=1 201 306 3.0E-06
sp|C4ZVL3|PDXB_ECOBW Erythronate-4-phosphate dehydrogenase OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=pdxB PE=3 SV=1 201 306 3.0E-06
sp|B7LFE3|GHRA_ECO55 Glyoxylate/hydroxypyruvate reductase A OS=Escherichia coli (strain 55989 / EAEC) GN=ghrA PE=3 SV=1 156 297 3.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016616 oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor Yes
GO:0051287 NAD binding Yes
GO:0003824 catalytic activity No
GO:0003674 molecular_function No
GO:0005488 binding No
GO:0036094 small molecule binding No
GO:0016614 oxidoreductase activity, acting on CH-OH group of donors No
GO:1901363 heterocyclic compound binding No
GO:0016491 oxidoreductase activity No
GO:1901265 nucleoside phosphate binding No
GO:0097159 organic cyclic compound binding No
GO:0000166 nucleotide binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|6044
MTAKPKVLLLGEIEHAHDAWHSISDVADIVTPQAQNRNDFITEARSGAFDGVVVAYRTFESFDTTGFIDGELLDT
MPTSLRFICHNGAGYDQVNVAACTAHNVLLSNTPTAVDDATADITLWLLLGALRNLPLSMATLRSGQWRGSPPVA
LGHDPQDKVLGILGMGGIGRCLATKARAAFGMRIRYHNRSRLAPELEAGAEYVDFETLLRESDVLSLNLPLNTAT
RHTISHPQFALMKQGIIIVNTARGAVIHEAALVDALASGRVASVGLDVYEDEPQVHPALLADHRVLLVPHMGTWT
VETQTKMEEWAISNVRMAIAQKKLRTIVPEQKHLAGEDGDGAFT*
Coding >OphauB2|6044
ATGACAGCCAAGCCCAAGGTCCTCCTGCTCGGCGAAATCGAACACGCCCACGATGCCTGGCACTCCATATCAGAC
GTGGCCGACATTGTGACGCCCCAGGCCCAGAACCGCAATGACTTTATAACCGAGGCCCGCTCCGGCGCCTTTGAC
GGCGTCGTCGTCGCCTACCGCACCTTTGAGTCCTTTGACACAACTGGCTTCATCGACGGAGAGCTCCTCGATACC
ATGCCCACCAGCCTTCGCTTCATCTGCCACAACGGCGCTGGCTACGACCAAGTAAACGTGGCCGCCTGTACTGCC
CACAACGTCCTCCTCTCAAATACTCCCACAGCCGTCGATGATGCCACGGCAGACATTACCCTCTGGCTGCTCCTC
GGCGCCCTTCGCAATCTTCCTCTATCCATGGCAACCCTGCGCTCTGGCCAATGGCGTGGCTCGCCGCCAGTAGCT
CTGGGCCACGATCCTCAAGACAAGGTGCTTGGTATCCTTGGCATGGGCGGCATTGGCCGCTGTCTGGCCACCAAG
GCCCGTGCTGCCTTTGGCATGCGCATTCGCTATCACAACCGATCCCGATTGGCCCCCGAGCTCGAGGCTGGAGCA
GAGTATGTCGACTTTGAGACTTTGCTTCGCGAATCAGACGTCCTCAGTCTGAATCTTCCCCTCAATACCGCCACC
CGCCACACCATTTCCCACCCCCAATTCGCCCTCATGAAACAAGGCATCATCATTGTAAACACGGCCCGCGGCGCC
GTCATCCACGAAGCCGCCCTCGTCGACGCCCTTGCCTCGGGCCGCGTCGCCAGCGTCGGCCTCGACGTCTACGAA
GACGAGCCCCAGGTCCATCCTGCCCTCCTCGCCGACCACCGCGTCCTCCTCGTTCCACACATGGGCACCTGGACC
GTCGAGACACAGACAAAAATGGAAGAGTGGGCCATAAGCAACGTCCGCATGGCTATTGCTCAGAAAAAGCTTCGT
ACTATTGTCCCTGAGCAAAAACACTTGGCTGGAGAGGACGGTGACGGAGCCTTCACATGA
Transcript >OphauB2|6044
ATGACAGCCAAGCCCAAGGTCCTCCTGCTCGGCGAAATCGAACACGCCCACGATGCCTGGCACTCCATATCAGAC
GTGGCCGACATTGTGACGCCCCAGGCCCAGAACCGCAATGACTTTATAACCGAGGCCCGCTCCGGCGCCTTTGAC
GGCGTCGTCGTCGCCTACCGCACCTTTGAGTCCTTTGACACAACTGGCTTCATCGACGGAGAGCTCCTCGATACC
ATGCCCACCAGCCTTCGCTTCATCTGCCACAACGGCGCTGGCTACGACCAAGTAAACGTGGCCGCCTGTACTGCC
CACAACGTCCTCCTCTCAAATACTCCCACAGCCGTCGATGATGCCACGGCAGACATTACCCTCTGGCTGCTCCTC
GGCGCCCTTCGCAATCTTCCTCTATCCATGGCAACCCTGCGCTCTGGCCAATGGCGTGGCTCGCCGCCAGTAGCT
CTGGGCCACGATCCTCAAGACAAGGTGCTTGGTATCCTTGGCATGGGCGGCATTGGCCGCTGTCTGGCCACCAAG
GCCCGTGCTGCCTTTGGCATGCGCATTCGCTATCACAACCGATCCCGATTGGCCCCCGAGCTCGAGGCTGGAGCA
GAGTATGTCGACTTTGAGACTTTGCTTCGCGAATCAGACGTCCTCAGTCTGAATCTTCCCCTCAATACCGCCACC
CGCCACACCATTTCCCACCCCCAATTCGCCCTCATGAAACAAGGCATCATCATTGTAAACACGGCCCGCGGCGCC
GTCATCCACGAAGCCGCCCTCGTCGACGCCCTTGCCTCGGGCCGCGTCGCCAGCGTCGGCCTCGACGTCTACGAA
GACGAGCCCCAGGTCCATCCTGCCCTCCTCGCCGACCACCGCGTCCTCCTCGTTCCACACATGGGCACCTGGACC
GTCGAGACACAGACAAAAATGGAAGAGTGGGCCATAAGCAACGTCCGCATGGCTATTGCTCAGAAAAAGCTTCGT
ACTATTGTCCCTGAGCAAAAACACTTGGCTGGAGAGGACGGTGACGGAGCCTTCACATGA
Gene >OphauB2|6044
ATGACAGCCAAGCCCAAGGTCCTCCTGCTCGGCGAAATCGAACAGTCAGTTGTGTGCTAGCCAGAGCTGCCAAGT
CAGACAAAAAAAAAAAAGACTAGAAAAACCTTGCTCCAACACGGCTGACTCGCATCTCAAAGCGCCCACGATGCC
TGGCACTCCATATCAGACGTGGCCGACATTGTGACGCCCCAGGCCCAGAACCGCAATGACTTTATAACCGAGGCC
CGCTCCGGCGCCTTTGACGGCGTCGTCGTCGCCTACCGCACCTTTGAGTCCTTTGACACAACTGGCTTCATCGAC
GGAGAGCTCCTCGATACCATGCCCACCAGCCTTCGCTTCATCTGCCACAACGGTACCTCCTTTTTCCCCTTCTCC
ATCTCTTCACATATGCCTCGGCGCCATGGCTGACCAGCTTCCAAACTTTCAAGGCGCTGGCTACGACCAAGTAAA
CGTGGCCGCCTGTACTGCCCACAACGTCCTCCTCTCAAATACTCCCACAGCCGTCGATGATGCCACGGCAGACAT
TACCCTCTGGCTGCTCCTCGGCGCCCTTCGCAATCTTCCTCTATCCATGGCAACCCTGCGCTCTGGCCAATGGCG
TGGCTCGCCGCCAGTAGCTCTGGGCCACGATCCTCAAGACAAGGTGCTTGGTATCCTTGGCATGGGCGGCATTGG
CCGCTGTCTGGCCACCAAGGCCCGTGCTGCCTTTGGCATGCGCATTCGCTATCACAACCGATCCCGATTGGCCCC
CGAGCTCGAGGCTGGAGCAGAGTATGTCGACTTTGAGACTTTGCTTCGCGAATCAGACGTCCTCAGTCTGAATCT
TCCCCTCAATGTATGAAGCCCCTGCTCCCTGTTTCTTGTCCCGTCACTTGTGCTCTAGCTTCCACCTCTTTCTCG
CCTCTGGCCTACAAGGTGTACTTGTCGTCTCCATTGGCCTCTTACTAGTCGACTAACACCTCTCCCCCTCTAGAC
CGCCACCCGCCACACCATTTCCCACCCCCAATTCGCCCTCATGAAACAAGGCATCATCATTGTAAACACGGCCCG
CGGCGCCGTCATCCACGAAGCCGCCCTCGTCGACGCCCTTGCCTCGGGCCGCGTCGCCAGCGTCGGCCTCGACGT
CTACGAAGACGAGCCCCAGGTCCATCCTGCCCTCCTCGCCGACCACCGCGTCCTCCTCGTTCCACACATGGGCAC
CTGGACCGTCGAGACACAGACAAAAATGGAAGAGTGGGCCATAAGCAACGTCCGCATGGCTATTGCTCAGAAAAA
GCTTCGTACTATTGTCCCTGAGCAAAAACACTTGGCTGGAGAGGACGGTGACGGAGCCTTCACATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail