Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|6043
Gene name
LocationContig_51:16793..18205
Strand+
Gene length (bp)1412
Transcript length (bp)1350
Coding sequence length (bp)1350
Protein length (aa) 450

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05221 AdoHcyase S-adenosyl-L-homocysteine hydrolase 1.4E-74 7 144
PF05221 AdoHcyase S-adenosyl-L-homocysteine hydrolase 2.2E-55 144 448
PF00670 AdoHcyase_NAD S-adenosyl-L-homocysteine hydrolase, NAD binding domain 2.5E-83 194 355
PF02826 2-Hacid_dh_C D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain 4.6E-06 213 303

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P83783|SAHH_CANAL Adenosylhomocysteinase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SAH1 PE=1 SV=2 2 449 0.0E+00
sp|P39954|SAHH_YEAST Adenosylhomocysteinase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SAH1 PE=1 SV=1 1 449 0.0E+00
sp|O13639|SAHH_SCHPO Adenosylhomocysteinase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pi047 PE=3 SV=1 6 449 0.0E+00
sp|P27604|SAHH_CAEEL Adenosylhomocysteinase OS=Caenorhabditis elegans GN=ahcy-1 PE=3 SV=1 1 449 0.0E+00
sp|O93477|SAHHB_XENLA Adenosylhomocysteinase B OS=Xenopus laevis GN=ahcy-b PE=2 SV=1 8 449 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P83783|SAHH_CANAL Adenosylhomocysteinase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SAH1 PE=1 SV=2 2 449 0.0E+00
sp|P39954|SAHH_YEAST Adenosylhomocysteinase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SAH1 PE=1 SV=1 1 449 0.0E+00
sp|O13639|SAHH_SCHPO Adenosylhomocysteinase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pi047 PE=3 SV=1 6 449 0.0E+00
sp|P27604|SAHH_CAEEL Adenosylhomocysteinase OS=Caenorhabditis elegans GN=ahcy-1 PE=3 SV=1 1 449 0.0E+00
sp|O93477|SAHHB_XENLA Adenosylhomocysteinase B OS=Xenopus laevis GN=ahcy-b PE=2 SV=1 8 449 0.0E+00
sp|P51893|SAHHA_XENLA Adenosylhomocysteinase A OS=Xenopus laevis GN=ahcy-a PE=2 SV=1 8 449 0.0E+00
sp|Q27580|SAHH_DROME Adenosylhomocysteinase OS=Drosophila melanogaster GN=Ahcy13 PE=2 SV=2 1 449 0.0E+00
sp|P10819|SAHH_DICDI Adenosylhomocysteinase OS=Dictyostelium discoideum GN=sahA PE=1 SV=2 8 449 0.0E+00
sp|O76757|SAHH_ANOGA Adenosylhomocysteinase OS=Anopheles gambiae GN=Ahcy13 PE=2 SV=2 1 449 0.0E+00
sp|Q3MHL4|SAHH_BOVIN Adenosylhomocysteinase OS=Bos taurus GN=AHCY PE=2 SV=3 8 449 0.0E+00
sp|Q710C4|SAHH_PIG Adenosylhomocysteinase OS=Sus scrofa GN=AHCY PE=3 SV=3 8 449 0.0E+00
sp|P50247|SAHH_MOUSE Adenosylhomocysteinase OS=Mus musculus GN=Ahcy PE=1 SV=3 8 449 0.0E+00
sp|Q4R596|SAHH_MACFA Adenosylhomocysteinase OS=Macaca fascicularis GN=AHCY PE=2 SV=3 8 449 0.0E+00
sp|P10760|SAHH_RAT Adenosylhomocysteinase OS=Rattus norvegicus GN=Ahcy PE=1 SV=3 8 449 0.0E+00
sp|P23526|SAHH_HUMAN Adenosylhomocysteinase OS=Homo sapiens GN=AHCY PE=1 SV=4 8 449 0.0E+00
sp|Q7TTZ5|SAHH_RHOBA Adenosylhomocysteinase OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=ahcY PE=3 SV=1 8 449 0.0E+00
sp|Q12663|SAHH_PNECA Adenosylhomocysteinase (Fragment) OS=Pneumocystis carinii GN=SAHH PE=2 SV=1 15 449 0.0E+00
sp|P36889|SAHH_LEIDO Adenosylhomocysteinase OS=Leishmania donovani PE=3 SV=2 8 449 0.0E+00
sp|A1WXM7|SAHH_HALHL Adenosylhomocysteinase OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=ahcY PE=3 SV=1 6 449 0.0E+00
sp|Q6MNC0|SAHH_BDEBA Adenosylhomocysteinase OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=ahcY PE=3 SV=2 15 449 0.0E+00
sp|B6J6H1|SAHH_COXB1 Adenosylhomocysteinase OS=Coxiella burnetii (strain CbuK_Q154) GN=ahcY PE=3 SV=1 2 449 0.0E+00
sp|A9KD88|SAHH_COXBN Adenosylhomocysteinase OS=Coxiella burnetii (strain Dugway 5J108-111) GN=ahcY PE=3 SV=2 2 449 0.0E+00
sp|Q83A77|SAHH_COXBU Adenosylhomocysteinase OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=ahcY PE=3 SV=2 2 449 0.0E+00
sp|B6J3R0|SAHH_COXB2 Adenosylhomocysteinase OS=Coxiella burnetii (strain CbuG_Q212) GN=ahcY PE=3 SV=1 2 449 0.0E+00
sp|Q0BW40|SAHH_GRABC Adenosylhomocysteinase OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) GN=ahcY PE=3 SV=1 3 449 0.0E+00
sp|B3EDY3|SAHH_CHLL2 Adenosylhomocysteinase OS=Chlorobium limicola (strain DSM 245 / NBRC 103803) GN=ahcY PE=3 SV=1 3 449 0.0E+00
sp|Q8EXV1|SAHH_LEPIN Adenosylhomocysteinase OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=ahcY PE=3 SV=1 8 449 0.0E+00
sp|Q75FU8|SAHH_LEPIC Adenosylhomocysteinase OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=ahcY PE=3 SV=1 8 449 0.0E+00
sp|A4SF77|SAHH_CHLPM Adenosylhomocysteinase OS=Chlorobium phaeovibrioides (strain DSM 265 / 1930) GN=ahcY PE=3 SV=1 1 449 0.0E+00
sp|A0M5W6|SAHH_GRAFK Adenosylhomocysteinase OS=Gramella forsetii (strain KT0803) GN=ahcY PE=3 SV=1 4 449 0.0E+00
sp|Q04WX0|SAHH_LEPBL Adenosylhomocysteinase OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain L550) GN=ahcY PE=3 SV=1 1 449 0.0E+00
sp|Q04NN6|SAHH_LEPBJ Adenosylhomocysteinase OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) GN=ahcY PE=3 SV=1 1 449 0.0E+00
sp|Q3B532|SAHH_CHLL7 Adenosylhomocysteinase OS=Chlorobium luteolum (strain DSM 273 / 2530) GN=ahcY PE=3 SV=1 1 449 0.0E+00
sp|Q8KEG8|SAHH_CHLTE Adenosylhomocysteinase OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=ahcY PE=3 SV=1 8 449 0.0E+00
sp|B3QMF5|SAHH_CHLP8 Adenosylhomocysteinase OS=Chlorobaculum parvum (strain NCIB 8327) GN=ahcY PE=3 SV=1 8 449 0.0E+00
sp|Q01VU1|SAHH_SOLUE Adenosylhomocysteinase OS=Solibacter usitatus (strain Ellin6076) GN=ahcY PE=3 SV=1 8 449 0.0E+00
sp|Q3AQC2|SAHH_CHLCH Adenosylhomocysteinase OS=Chlorobium chlorochromatii (strain CaD3) GN=ahcY PE=3 SV=1 3 449 0.0E+00
sp|Q30WL8|SAHH_DESAG Adenosylhomocysteinase OS=Desulfovibrio alaskensis (strain G20) GN=ahcY PE=3 SV=1 9 449 0.0E+00
sp|B4SD43|SAHH_PELPB Adenosylhomocysteinase OS=Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1) GN=ahcY PE=3 SV=1 8 449 0.0E+00
sp|A5FJK3|SAHH_FLAJ1 Adenosylhomocysteinase OS=Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / UW101) GN=ahcY PE=3 SV=1 4 449 0.0E+00
sp|Q64MT2|SAHH_BACFR Adenosylhomocysteinase OS=Bacteroides fragilis (strain YCH46) GN=ahcY PE=3 SV=1 8 449 0.0E+00
sp|A6GW32|SAHH_FLAPJ Adenosylhomocysteinase OS=Flavobacterium psychrophilum (strain JIP02/86 / ATCC 49511) GN=ahcY PE=3 SV=1 4 449 0.0E+00
sp|Q8A407|SAHH_BACTN Adenosylhomocysteinase OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=ahcY PE=3 SV=1 8 449 0.0E+00
sp|Q63PT2|SAHH_BURPS Adenosylhomocysteinase OS=Burkholderia pseudomallei (strain K96243) GN=ahcY PE=3 SV=1 5 449 0.0E+00
sp|A3NER1|SAHH_BURP6 Adenosylhomocysteinase OS=Burkholderia pseudomallei (strain 668) GN=ahcY PE=3 SV=1 5 449 0.0E+00
sp|Q3JY79|SAHH_BURP1 Adenosylhomocysteinase OS=Burkholderia pseudomallei (strain 1710b) GN=ahcY PE=1 SV=1 5 449 0.0E+00
sp|A3P0L8|SAHH_BURP0 Adenosylhomocysteinase OS=Burkholderia pseudomallei (strain 1106a) GN=ahcY PE=3 SV=1 5 449 0.0E+00
sp|A1V8Z2|SAHH_BURMS Adenosylhomocysteinase OS=Burkholderia mallei (strain SAVP1) GN=ahcY PE=3 SV=1 5 449 0.0E+00
sp|Q62G22|SAHH_BURMA Adenosylhomocysteinase OS=Burkholderia mallei (strain ATCC 23344) GN=ahcY PE=3 SV=1 5 449 0.0E+00
sp|A2S6W2|SAHH_BURM9 Adenosylhomocysteinase OS=Burkholderia mallei (strain NCTC 10229) GN=ahcY PE=3 SV=1 5 449 0.0E+00
sp|A3MQW7|SAHH_BURM7 Adenosylhomocysteinase OS=Burkholderia mallei (strain NCTC 10247) GN=ahcY PE=3 SV=1 5 449 0.0E+00
sp|B2JIP4|SAHH_BURP8 Adenosylhomocysteinase OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=ahcY PE=3 SV=1 5 449 0.0E+00
sp|Q2STU0|SAHH_BURTA Adenosylhomocysteinase OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=ahcY PE=3 SV=1 5 449 0.0E+00
sp|Q6N2N5|SAHH_RHOPA Adenosylhomocysteinase OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=ahcY PE=3 SV=1 1 449 0.0E+00
sp|B3QJT3|SAHH_RHOPT Adenosylhomocysteinase OS=Rhodopseudomonas palustris (strain TIE-1) GN=ahcY PE=3 SV=1 1 449 0.0E+00
sp|Q13AQ5|SAHH_RHOPS Adenosylhomocysteinase OS=Rhodopseudomonas palustris (strain BisB5) GN=ahcY PE=3 SV=1 1 449 0.0E+00
sp|Q7NZF7|SAHH_CHRVO Adenosylhomocysteinase OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=ahcY PE=3 SV=1 8 449 0.0E+00
sp|A9C184|SAHH_DELAS Adenosylhomocysteinase OS=Delftia acidovorans (strain DSM 14801 / SPH-1) GN=ahcY PE=3 SV=1 10 449 0.0E+00
sp|A1BEZ2|SAHH_CHLPD Adenosylhomocysteinase OS=Chlorobium phaeobacteroides (strain DSM 266) GN=ahcY PE=3 SV=1 8 449 0.0E+00
sp|A2C620|SAHH_PROM3 Adenosylhomocysteinase OS=Prochlorococcus marinus (strain MIT 9303) GN=ahcY PE=3 SV=1 1 449 0.0E+00
sp|Q87EI8|SAHH_XYLFT Adenosylhomocysteinase OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=ahcY PE=3 SV=1 3 449 0.0E+00
sp|B2I7N4|SAHH_XYLF2 Adenosylhomocysteinase OS=Xylella fastidiosa (strain M23) GN=ahcY PE=3 SV=1 3 449 0.0E+00
sp|Q9PEJ1|SAHH_XYLFA Adenosylhomocysteinase OS=Xylella fastidiosa (strain 9a5c) GN=ahcY PE=3 SV=2 3 449 0.0E+00
sp|Q2IZR1|SAHH_RHOP2 Adenosylhomocysteinase OS=Rhodopseudomonas palustris (strain HaA2) GN=ahcY PE=3 SV=1 1 449 0.0E+00
sp|Q9KZM1|SAHH_STRCO Adenosylhomocysteinase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=ahcY PE=3 SV=1 6 449 0.0E+00
sp|B0U232|SAHH_XYLFM Adenosylhomocysteinase OS=Xylella fastidiosa (strain M12) GN=ahcY PE=3 SV=1 3 449 2.0E-180
sp|B2T6X2|SAHH_BURPP Adenosylhomocysteinase OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=ahcY PE=3 SV=1 5 449 2.0E-180
sp|Q7V926|SAHH_PROMM Adenosylhomocysteinase OS=Prochlorococcus marinus (strain MIT 9313) GN=ahcY PE=3 SV=1 7 449 5.0E-180
sp|Q13T36|SAHH_BURXL Adenosylhomocysteinase OS=Burkholderia xenovorans (strain LB400) GN=ahcY PE=3 SV=1 5 449 7.0E-180
sp|Q82DC9|SAHH_STRAW Adenosylhomocysteinase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=ahcY PE=3 SV=1 6 449 8.0E-180
sp|B2AGG2|SAHH_CUPTR Adenosylhomocysteinase OS=Cupriavidus taiwanensis (strain R1 / LMG 19424) GN=ahcY PE=3 SV=1 6 449 1.0E-179
sp|B1VUW6|SAHH_STRGG Adenosylhomocysteinase OS=Streptomyces griseus subsp. griseus (strain JCM 4626 / NBRC 13350) GN=ahcY PE=3 SV=1 6 449 3.0E-179
sp|P61617|SAHH_GEOSL Adenosylhomocysteinase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=ahcY PE=3 SV=1 8 449 3.0E-179
sp|Q0KF25|SAHH_CUPNH Adenosylhomocysteinase OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=ahcY PE=3 SV=1 6 449 4.0E-179
sp|Q1LS20|SAHH_CUPMC Adenosylhomocysteinase OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=ahcY PE=3 SV=1 6 449 5.0E-179
sp|Q476T8|SAHH_CUPPJ Adenosylhomocysteinase OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=ahcY PE=3 SV=1 6 449 5.0E-179
sp|Q7VUL8|SAHH_BORPE Adenosylhomocysteinase OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=ahcY PE=3 SV=1 8 449 6.0E-179
sp|A8G7D1|SAHH_PROM2 Adenosylhomocysteinase OS=Prochlorococcus marinus (strain MIT 9215) GN=ahcY PE=3 SV=1 8 449 8.0E-179
sp|B2U774|SAHH_RALPJ Adenosylhomocysteinase OS=Ralstonia pickettii (strain 12J) GN=ahcY PE=3 SV=1 8 449 4.0E-178
sp|A5ENA7|SAHH_BRASB Adenosylhomocysteinase OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) GN=ahcY PE=3 SV=1 8 449 9.0E-178
sp|Q8Y387|SAHH_RALSO Adenosylhomocysteinase OS=Ralstonia solanacearum (strain GMI1000) GN=ahcY PE=3 SV=1 8 449 1.0E-177
sp|Q60CG8|SAHH_METCA Adenosylhomocysteinase OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=ahcY PE=3 SV=1 2 449 1.0E-177
sp|Q3BXC6|SAHH_XANC5 Adenosylhomocysteinase OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=ahcY PE=3 SV=1 4 449 1.0E-177
sp|Q3ANF4|SAHH_SYNSC Adenosylhomocysteinase OS=Synechococcus sp. (strain CC9605) GN=ahcY PE=3 SV=1 10 449 2.0E-177
sp|Q0IDX7|SAHH_SYNS3 Adenosylhomocysteinase OS=Synechococcus sp. (strain CC9311) GN=ahcY PE=3 SV=1 5 449 2.0E-177
sp|B1Y647|SAHH_LEPCP Adenosylhomocysteinase OS=Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6) GN=ahcY PE=3 SV=1 8 449 4.0E-177
sp|A9IGY5|SAHH_BORPD Adenosylhomocysteinase OS=Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448) GN=ahcY PE=3 SV=1 8 449 1.0E-176
sp|Q5NR48|SAHH_ZYMMO Adenosylhomocysteinase OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=ahcY PE=3 SV=1 6 449 1.0E-176
sp|A3PFB5|SAHH_PROM0 Adenosylhomocysteinase OS=Prochlorococcus marinus (strain MIT 9301) GN=ahcY PE=3 SV=1 7 449 2.0E-176
sp|Q7U9Y3|SAHH_SYNPX Adenosylhomocysteinase OS=Synechococcus sp. (strain WH8102) GN=ahcY PE=3 SV=1 10 449 2.0E-176
sp|A5GI30|SAHH_SYNPW Adenosylhomocysteinase OS=Synechococcus sp. (strain WH7803) GN=ahcY PE=3 SV=1 5 449 2.0E-176
sp|Q8GGL7|SAHH_STRAZ Adenosylhomocysteinase OS=Streptomyces atroolivaceus GN=ahcY PE=3 SV=1 8 449 2.0E-176
sp|Q3B0K7|SAHH_SYNS9 Adenosylhomocysteinase OS=Synechococcus sp. (strain CC9902) GN=ahcY PE=3 SV=1 10 449 3.0E-176
sp|Q8PP84|SAHH_XANAC Adenosylhomocysteinase OS=Xanthomonas axonopodis pv. citri (strain 306) GN=ahcY PE=3 SV=1 4 449 5.0E-176
sp|B8DR41|SAHH_DESVM Adenosylhomocysteinase OS=Desulfovibrio vulgaris (strain Miyazaki F / DSM 19637) GN=ahcY PE=3 SV=1 9 449 2.0E-175
sp|B2SPN6|SAHH_XANOP Adenosylhomocysteinase OS=Xanthomonas oryzae pv. oryzae (strain PXO99A) GN=ahcY PE=3 SV=1 4 449 2.0E-175
sp|Q2NZE3|SAHH_XANOM Adenosylhomocysteinase OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=ahcY PE=3 SV=1 4 449 2.0E-175
sp|Q01781|SAHH_PETCR Adenosylhomocysteinase OS=Petroselinum crispum GN=SAHH PE=2 SV=2 3 449 3.0E-175
sp|A6T2Y9|SAHH_JANMA Adenosylhomocysteinase OS=Janthinobacterium sp. (strain Marseille) GN=ahcY PE=3 SV=1 1 449 3.0E-175
sp|Q7W1Z7|SAHH_BORPA Adenosylhomocysteinase OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=ahcY PE=3 SV=1 8 449 4.0E-175
sp|Q7WQX5|SAHH_BORBR Adenosylhomocysteinase OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=ahcY PE=3 SV=1 8 449 4.0E-175
sp|Q3A392|SAHH_PELCD Adenosylhomocysteinase OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=ahcY PE=3 SV=1 5 449 6.0E-175
sp|A4T0E9|SAHH_POLSQ Adenosylhomocysteinase OS=Polynucleobacter necessarius subsp. asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1) GN=ahcY PE=3 SV=1 5 449 1.0E-174
sp|A9BD69|SAHH_PROM4 Adenosylhomocysteinase OS=Prochlorococcus marinus (strain MIT 9211) GN=ahcY PE=3 SV=1 7 449 2.0E-174
sp|Q89HP6|SAHH_BRADU Adenosylhomocysteinase OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=ahcY PE=3 SV=1 8 449 2.0E-174
sp|Q5P6B7|SAHH_AROAE Adenosylhomocysteinase OS=Aromatoleum aromaticum (strain EbN1) GN=ahcY PE=3 SV=1 8 449 2.0E-174
sp|Q7V9P3|SAHH_PROMA Adenosylhomocysteinase OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=ahcY PE=3 SV=1 8 449 2.0E-174
sp|B0UM37|SAHH_METS4 Adenosylhomocysteinase OS=Methylobacterium sp. (strain 4-46) GN=ahcY PE=3 SV=1 6 449 2.0E-174
sp|Q318B6|SAHH_PROM9 Adenosylhomocysteinase OS=Prochlorococcus marinus (strain MIT 9312) GN=ahcY PE=3 SV=1 8 449 4.0E-174
sp|Q8PCH5|SAHH_XANCP Adenosylhomocysteinase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=ahcY PE=3 SV=1 4 449 5.0E-174
sp|Q4UQZ8|SAHH_XANC8 Adenosylhomocysteinase OS=Xanthomonas campestris pv. campestris (strain 8004) GN=ahcY PE=3 SV=1 4 449 5.0E-174
sp|Q82WL1|SAHH_NITEU Adenosylhomocysteinase OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=ahcY PE=3 SV=1 9 449 5.0E-174
sp|A1TUG3|SAHH_ACIAC Adenosylhomocysteinase OS=Acidovorax citrulli (strain AAC00-1) GN=ahcY PE=3 SV=1 4 449 6.0E-174
sp|Q936D6|SAHH_STRAA Adenosylhomocysteinase OS=Streptomyces argillaceus GN=ahcY PE=3 SV=1 1 449 1.0E-173
sp|A1VFZ7|SAHH_DESVV Adenosylhomocysteinase OS=Desulfovibrio vulgaris subsp. vulgaris (strain DP4) GN=ahcY PE=3 SV=1 9 449 1.0E-173
sp|Q72EH1|SAHH_DESVH Adenosylhomocysteinase OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=ahcY PE=3 SV=1 9 449 1.0E-173
sp|B1XSH8|SAHH_POLNS Adenosylhomocysteinase OS=Polynucleobacter necessarius subsp. necessarius (strain STIR1) GN=ahcY PE=3 SV=1 5 449 1.0E-173
sp|B8IPU4|SAHH_METNO Adenosylhomocysteinase OS=Methylobacterium nodulans (strain ORS2060 / LMG 21967) GN=ahcY PE=3 SV=1 5 449 3.0E-173
sp|Q0AEV8|SAHH_NITEC Adenosylhomocysteinase OS=Nitrosomonas eutropha (strain C91) GN=ahcY PE=3 SV=1 9 449 4.0E-173
sp|A4G975|SAHH_HERAR Adenosylhomocysteinase OS=Herminiimonas arsenicoxydans GN=ahcY PE=3 SV=1 8 449 7.0E-173
sp|A2SL00|SAHH_METPP Adenosylhomocysteinase OS=Methylibium petroleiphilum (strain PM1) GN=ahcY PE=3 SV=1 4 449 8.0E-173
sp|A9VYP7|SAHH_METEP Adenosylhomocysteinase OS=Methylobacterium extorquens (strain PA1) GN=ahcY PE=3 SV=1 3 449 2.0E-172
sp|B7KSJ4|SAHH_METC4 Adenosylhomocysteinase OS=Methylobacterium extorquens (strain CM4 / NCIMB 13688) GN=ahcY PE=3 SV=1 3 449 2.0E-172
sp|C5CM29|SAHH_VARPS Adenosylhomocysteinase OS=Variovorax paradoxus (strain S110) GN=ahcY PE=3 SV=1 10 449 3.0E-172
sp|B1ZLX0|SAHH_METPB Adenosylhomocysteinase OS=Methylobacterium populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001) GN=ahcY PE=3 SV=1 3 449 4.0E-172
sp|Q1CY84|SAHH_MYXXD Adenosylhomocysteinase OS=Myxococcus xanthus (strain DK 1622) GN=ahcY PE=3 SV=1 6 449 6.0E-172
sp|Q9SP37|SAHH_LUPLU Adenosylhomocysteinase OS=Lupinus luteus GN=SAHH PE=1 SV=1 5 449 1.0E-171
sp|P35007|SAHH_CATRO Adenosylhomocysteinase OS=Catharanthus roseus GN=SAHH PE=2 SV=1 3 449 1.0E-171
sp|Q7UZN3|SAHH_PROMP Adenosylhomocysteinase OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=ahcY PE=3 SV=1 8 449 2.0E-171
sp|Q11CD0|SAHH_CHESB Adenosylhomocysteinase OS=Chelativorans sp. (strain BNC1) GN=ahcY PE=3 SV=1 5 449 2.0E-171
sp|A1W3P0|SAHH_ACISJ Adenosylhomocysteinase OS=Acidovorax sp. (strain JS42) GN=ahcY PE=3 SV=1 1 449 3.0E-171
sp|A6WX40|SAHH_OCHA4 Adenosylhomocysteinase OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=ahcY PE=3 SV=1 5 449 3.0E-171
sp|Q1GWT5|SAHH_SPHAL Adenosylhomocysteinase OS=Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256) GN=ahcY PE=3 SV=1 1 449 1.0E-170
sp|P68173|SAHH_TOBAC Adenosylhomocysteinase OS=Nicotiana tabacum GN=SAHH PE=2 SV=1 5 449 2.0E-170
sp|P68172|SAHH_NICSY Adenosylhomocysteinase OS=Nicotiana sylvestris GN=SAHH PE=2 SV=1 5 449 2.0E-170
sp|B9MD45|SAHH_ACIET Adenosylhomocysteinase OS=Acidovorax ebreus (strain TPSY) GN=ahcY PE=3 SV=1 1 449 3.0E-170
sp|A0PRF5|SAHH_MYCUA Adenosylhomocysteinase OS=Mycobacterium ulcerans (strain Agy99) GN=ahcY PE=3 SV=1 8 449 3.0E-170
sp|O50562|SAHH_RHOSH Adenosylhomocysteinase OS=Rhodobacter sphaeroides GN=ahcY PE=3 SV=1 8 449 4.0E-170
sp|P50246|SAHH_MEDSA Adenosylhomocysteinase OS=Medicago sativa GN=SAHH PE=2 SV=1 5 449 4.0E-170
sp|B2HEP6|SAHH_MYCMM Adenosylhomocysteinase OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=ahcY PE=3 SV=1 8 449 6.0E-170
sp|P93253|SAHH_MESCR Adenosylhomocysteinase OS=Mesembryanthemum crystallinum GN=SAHH PE=2 SV=1 3 449 3.0E-169
sp|P28183|SAHH_RHOCB Adenosylhomocysteinase OS=Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003) GN=ahcY PE=3 SV=2 8 449 3.0E-169
sp|Q8FXZ7|SAHH_BRUSU Adenosylhomocysteinase OS=Brucella suis biovar 1 (strain 1330) GN=ahcY PE=3 SV=1 5 449 3.0E-169
sp|B0CJJ7|SAHH_BRUSI Adenosylhomocysteinase OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=ahcY PE=3 SV=1 5 449 3.0E-169
sp|A9M9T1|SAHH_BRUC2 Adenosylhomocysteinase OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=ahcY PE=3 SV=1 5 449 3.0E-169
sp|Q57AG3|SAHH_BRUAB Adenosylhomocysteinase OS=Brucella abortus biovar 1 (strain 9-941) GN=ahcY PE=3 SV=1 5 449 3.0E-169
sp|Q2YQX8|SAHH_BRUA2 Adenosylhomocysteinase OS=Brucella abortus (strain 2308) GN=ahcY PE=1 SV=1 5 449 3.0E-169
sp|B2S994|SAHH_BRUA1 Adenosylhomocysteinase OS=Brucella abortus (strain S19) GN=ahcY PE=3 SV=1 5 449 3.0E-169
sp|O23255|SAHH1_ARATH Adenosylhomocysteinase 1 OS=Arabidopsis thaliana GN=SAHH1 PE=1 SV=1 5 449 3.0E-169
sp|A6UEJ1|SAHH_SINMW Adenosylhomocysteinase OS=Sinorhizobium medicae (strain WSM419) GN=ahcY PE=3 SV=1 6 449 4.0E-169
sp|A5VT52|SAHH_BRUO2 Adenosylhomocysteinase OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=ahcY PE=3 SV=1 5 449 5.0E-169
sp|Q92TC1|SAHH_RHIME Adenosylhomocysteinase OS=Rhizobium meliloti (strain 1021) GN=ahcY PE=3 SV=1 6 449 6.0E-169
sp|Q8YE49|SAHH_BRUME Adenosylhomocysteinase OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=ahcY PE=3 SV=2 5 449 7.0E-169
sp|C0RFY3|SAHH_BRUMB Adenosylhomocysteinase OS=Brucella melitensis biotype 2 (strain ATCC 23457) GN=ahcY PE=3 SV=1 5 449 7.0E-169
sp|A4ZHR8|SAHH_MYCS2 Adenosylhomocysteinase OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=ahcY PE=1 SV=1 8 449 8.0E-169
sp|Q2G6T1|SAHH_NOVAD Adenosylhomocysteinase OS=Novosphingobium aromaticivorans (strain DSM 12444 / F199) GN=ahcY PE=3 SV=1 8 449 2.0E-168
sp|Q73UK6|SAHH_MYCPA Adenosylhomocysteinase OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=ahcY PE=3 SV=1 7 449 3.0E-168
sp|P32112|SAHH_WHEAT Adenosylhomocysteinase OS=Triticum aestivum GN=SAHH PE=2 SV=1 3 449 5.0E-168
sp|Q7TWW7|SAHH_MYCBO Adenosylhomocysteinase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ahcY PE=1 SV=3 8 449 6.0E-168
sp|P9WGV3|SAHH_MYCTU Adenosylhomocysteinase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ahcY PE=1 SV=1 8 449 7.0E-168
sp|P9WGV2|SAHH_MYCTO Adenosylhomocysteinase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ahcY PE=3 SV=1 8 449 7.0E-168
sp|A5U7S2|SAHH_MYCTA Adenosylhomocysteinase OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=ahcY PE=3 SV=1 8 449 7.0E-168
sp|C1AH22|SAHH_MYCBT Adenosylhomocysteinase OS=Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019) GN=ahcY PE=3 SV=1 8 449 7.0E-168
sp|A1KNQ0|SAHH_MYCBP Adenosylhomocysteinase OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=ahcY PE=3 SV=1 8 449 7.0E-168
sp|Q9CCJ4|SAHH_MYCLE Adenosylhomocysteinase OS=Mycobacterium leprae (strain TN) GN=ahcY PE=3 SV=1 8 449 8.0E-168
sp|B8ZQE9|SAHH_MYCLB Adenosylhomocysteinase OS=Mycobacterium leprae (strain Br4923) GN=ahcY PE=3 SV=1 8 449 8.0E-168
sp|Q1MNC6|SAHH_RHIL3 Adenosylhomocysteinase OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=ahcY PE=3 SV=1 6 449 2.0E-167
sp|Q1BCD6|SAHH_MYCSS Adenosylhomocysteinase OS=Mycobacterium sp. (strain MCS) GN=ahcY PE=3 SV=1 8 449 2.0E-167
sp|A1UCK8|SAHH_MYCSK Adenosylhomocysteinase OS=Mycobacterium sp. (strain KMS) GN=ahcY PE=3 SV=1 8 449 2.0E-167
sp|B5ZV80|SAHH_RHILW Adenosylhomocysteinase OS=Rhizobium leguminosarum bv. trifolii (strain WSM2304) GN=ahcY PE=3 SV=1 6 449 3.0E-167
sp|Q9LK36|SAHH2_ARATH Adenosylhomocysteinase 2 OS=Arabidopsis thaliana GN=SAHH2 PE=1 SV=1 3 449 5.0E-167
sp|A3PW97|SAHH_MYCSJ Adenosylhomocysteinase OS=Mycobacterium sp. (strain JLS) GN=ahcY PE=3 SV=1 8 449 6.0E-167
sp|P50249|SAHH_PHASS Adenosylhomocysteinase OS=Phalaenopsis sp. GN=SAHH PE=2 SV=1 5 449 2.0E-166
sp|Q5YQS7|SAHH_NOCFA Adenosylhomocysteinase OS=Nocardia farcinica (strain IFM 10152) GN=ahcY PE=3 SV=1 8 449 2.0E-166
sp|C6C1F4|SAHH_DESAD Adenosylhomocysteinase OS=Desulfovibrio salexigens (strain ATCC 14822 / DSM 2638 / NCIB 8403 / VKM B-1763) GN=ahcY PE=3 SV=1 8 449 5.0E-166
sp|Q8UJ99|SAHH_AGRFC Adenosylhomocysteinase OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=ahcY PE=3 SV=1 6 449 6.0E-166
sp|B9JG53|SAHH_AGRRK Adenosylhomocysteinase OS=Agrobacterium radiobacter (strain K84 / ATCC BAA-868) GN=ahcY PE=3 SV=1 8 449 7.0E-166
sp|Q0ALW1|SAHH_MARMM Adenosylhomocysteinase OS=Maricaulis maris (strain MCS10) GN=ahcY PE=3 SV=1 3 449 1.0E-165
sp|Q9ABH0|SAHH_CAUCR Adenosylhomocysteinase OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=ahcY PE=3 SV=1 8 449 1.0E-165
sp|Q2KE72|SAHH_RHIEC Adenosylhomocysteinase OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=ahcY PE=3 SV=1 6 449 2.0E-165
sp|B3PVW2|SAHH_RHIE6 Adenosylhomocysteinase OS=Rhizobium etli (strain CIAT 652) GN=ahcY PE=3 SV=1 6 449 2.0E-165
sp|Q98CM3|SAHH_RHILO Adenosylhomocysteinase OS=Rhizobium loti (strain MAFF303099) GN=ahcY PE=3 SV=1 5 449 1.0E-164
sp|Q6G584|SAHH_BARHE Adenosylhomocysteinase OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=ahcY PE=3 SV=1 5 449 1.0E-164
sp|Q9SWF5|SAHH_SOLLC Adenosylhomocysteinase OS=Solanum lycopersicum GN=SAHH PE=2 SV=1 5 449 4.0E-164
sp|Q9ZNA5|SAHH_ROSDO Adenosylhomocysteinase OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=ahcY PE=3 SV=1 6 449 4.0E-164
sp|Q6FA43|SAHH_ACIAD Adenosylhomocysteinase OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=ahcY PE=3 SV=1 8 449 4.0E-163
sp|Q0C427|SAHH_HYPNA Adenosylhomocysteinase OS=Hyphomonas neptunium (strain ATCC 15444) GN=ahcY PE=3 SV=1 2 449 4.0E-163
sp|P51540|SAHH_TRIVA Adenosylhomocysteinase OS=Trichomonas vaginalis PE=3 SV=1 7 449 5.0E-163
sp|A9IL83|SAHH_BART1 Adenosylhomocysteinase OS=Bartonella tribocorum (strain CIP 105476 / IBS 506) GN=ahcY PE=3 SV=1 5 449 1.0E-162
sp|Q4ZZ92|SAHH_PSEU2 Adenosylhomocysteinase OS=Pseudomonas syringae pv. syringae (strain B728a) GN=ahcY PE=3 SV=1 4 449 2.0E-162
sp|A4VRF7|SAHH_PSEU5 Adenosylhomocysteinase OS=Pseudomonas stutzeri (strain A1501) GN=ahcY PE=3 SV=1 8 449 2.0E-162
sp|Q4K4H7|SAHH_PSEF5 Adenosylhomocysteinase OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=ahcY PE=3 SV=1 8 449 4.0E-162
sp|Q9I685|SAHH_PSEAE Adenosylhomocysteinase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=ahcY PE=3 SV=1 8 449 4.0E-161
sp|B7V419|SAHH_PSEA8 Adenosylhomocysteinase OS=Pseudomonas aeruginosa (strain LESB58) GN=ahcY PE=3 SV=1 8 449 4.0E-161
sp|Q02TY0|SAHH_PSEAB Adenosylhomocysteinase OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=ahcY PE=3 SV=1 8 449 4.0E-161
sp|Q3K5D7|SAHH_PSEPF Adenosylhomocysteinase OS=Pseudomonas fluorescens (strain Pf0-1) GN=ahcY PE=3 SV=1 8 449 2.0E-160
sp|Q48PB5|SAHH_PSE14 Adenosylhomocysteinase OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=ahcY PE=3 SV=1 4 449 2.0E-160
sp|C3K3G6|SAHH_PSEFS Adenosylhomocysteinase OS=Pseudomonas fluorescens (strain SBW25) GN=ahcY PE=3 SV=1 8 449 4.0E-160
sp|Q8FRJ4|SAHH_COREF Adenosylhomocysteinase OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=ahcY PE=3 SV=1 3 449 5.0E-160
sp|A4XPF3|SAHH_PSEMY Adenosylhomocysteinase OS=Pseudomonas mendocina (strain ymp) GN=ahcY PE=3 SV=1 8 449 6.0E-160
sp|A4QC87|SAHH_CORGB Adenosylhomocysteinase OS=Corynebacterium glutamicum (strain R) GN=ahcY PE=3 SV=1 3 449 8.0E-160
sp|Q1I3W5|SAHH_PSEE4 Adenosylhomocysteinase OS=Pseudomonas entomophila (strain L48) GN=ahcY PE=3 SV=1 8 449 9.0E-160
sp|Q8NSC4|SAHH_CORGL Adenosylhomocysteinase OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=ahcY PE=3 SV=1 8 449 1.0E-159
sp|B0KM00|SAHH_PSEPG Adenosylhomocysteinase OS=Pseudomonas putida (strain GB-1) GN=ahcY PE=3 SV=1 1 449 5.0E-159
sp|B1J2Y8|SAHH_PSEPW Adenosylhomocysteinase OS=Pseudomonas putida (strain W619) GN=ahcY PE=3 SV=1 8 449 1.0E-158
sp|Q87V73|SAHH_PSESM Adenosylhomocysteinase OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=ahcY PE=3 SV=1 4 449 3.0E-158
sp|A5WA09|SAHH_PSEP1 Adenosylhomocysteinase OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=ahcY PE=3 SV=1 1 449 5.0E-158
sp|Q2SLT4|SAHH_HAHCH Adenosylhomocysteinase OS=Hahella chejuensis (strain KCTC 2396) GN=ahcY PE=3 SV=1 8 449 2.0E-156
sp|Q6G1D6|SAHH_BARQU Adenosylhomocysteinase OS=Bartonella quintana (strain Toulouse) GN=ahcY PE=3 SV=1 5 449 2.0E-156
sp|Q4XZZ5|SAHH_PLACH Adenosylhomocysteinase OS=Plasmodium chabaudi GN=PC000295.02.0 PE=3 SV=1 9 449 3.0E-155
sp|P50250|SAHH_PLAF7 Adenosylhomocysteinase OS=Plasmodium falciparum (isolate 3D7) GN=PFE1050w PE=1 SV=2 6 449 5.0E-155
sp|Q5R889|SAHH3_PONAB Putative adenosylhomocysteinase 3 OS=Pongo abelii GN=AHCYL2 PE=2 SV=1 8 449 9.0E-155
sp|Q7RKK8|SAHH_PLAYO Adenosylhomocysteinase OS=Plasmodium yoelii yoelii GN=PY02893 PE=3 SV=1 9 449 3.0E-154
sp|A6QLP2|SAHH3_BOVIN Adenosylhomocysteinase 3 OS=Bos taurus GN=AHCYL2 PE=1 SV=1 8 449 3.0E-153
sp|Q68FL4|SAHH3_MOUSE Putative adenosylhomocysteinase 3 OS=Mus musculus GN=Ahcyl2 PE=1 SV=1 8 449 6.0E-153
sp|Q96HN2|SAHH3_HUMAN Adenosylhomocysteinase 3 OS=Homo sapiens GN=AHCYL2 PE=1 SV=1 8 449 7.0E-153
sp|P61456|SAHH_CORDI Adenosylhomocysteinase OS=Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis) GN=ahcY PE=3 SV=1 8 449 1.0E-149
sp|P50245|SAHH2_DROME Putative adenosylhomocysteinase 2 OS=Drosophila melanogaster GN=Ahcy89E PE=2 SV=2 2 449 7.0E-148
sp|B5DFN2|SAHH2_RAT Adenosylhomocysteinase 2 OS=Rattus norvegicus GN=Ahcyl1 PE=1 SV=2 5 449 2.0E-147
sp|Q80SW1|SAHH2_MOUSE Putative adenosylhomocysteinase 2 OS=Mus musculus GN=Ahcyl1 PE=1 SV=1 5 449 9.0E-147
sp|O43865|SAHH2_HUMAN Adenosylhomocysteinase 2 OS=Homo sapiens GN=AHCYL1 PE=1 SV=2 5 449 9.0E-147
sp|Q9YEF2|SAHH_AERPE Adenosylhomocysteinase OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=ahcY PE=3 SV=2 5 434 2.0E-124
sp|P50252|SAHH_SULSO Adenosylhomocysteinase OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=ahcY PE=3 SV=1 8 434 8.0E-122
sp|Q975T0|SAHH_SULTO Adenosylhomocysteinase OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=ahcY PE=3 SV=1 8 434 1.0E-116
sp|O67240|SAHH_AQUAE Adenosylhomocysteinase OS=Aquifex aeolicus (strain VF5) GN=ahcY PE=3 SV=1 7 434 2.0E-109
sp|P58855|SAHH_METKA Adenosylhomocysteinase OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=ahcY PE=3 SV=1 7 440 2.0E-108
sp|Q4JAZ7|SAHH_SULAC Adenosylhomocysteinase OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=ahcY PE=3 SV=1 8 434 2.0E-108
sp|Q9UYK5|SAHH_PYRAB Adenosylhomocysteinase OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=ahcY PE=3 SV=1 10 434 1.0E-105
sp|Q58783|SAHH_METJA Adenosylhomocysteinase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=ahcY PE=3 SV=1 8 440 2.0E-105
sp|O58275|SAHH_PYRHO Adenosylhomocysteinase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=ahcY PE=3 SV=2 6 434 5.0E-104
sp|Q8ZTQ7|SAHH_PYRAE Adenosylhomocysteinase OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=ahcY PE=3 SV=1 9 434 7.0E-104
sp|P50251|SAHH_PYRFU Adenosylhomocysteinase OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=ahcY PE=3 SV=2 6 434 7.0E-104
sp|Q6LYR8|SAHH_METMP Adenosylhomocysteinase OS=Methanococcus maripaludis (strain S2 / LL) GN=ahcY PE=3 SV=1 10 440 5.0E-102
sp|P74008|SAHH_SYNY3 Adenosylhomocysteinase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=ahcY PE=3 SV=1 6 434 1.0E-101
sp|Q8YX05|SAHH_NOSS1 Adenosylhomocysteinase OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=ahcY PE=3 SV=1 3 434 1.0E-101
sp|B7K8X6|SAHH_CYAP7 Adenosylhomocysteinase OS=Cyanothece sp. (strain PCC 7424) GN=ahcY PE=3 SV=1 7 434 2.0E-100
sp|Q8DGC8|SAHH_THEEB Adenosylhomocysteinase OS=Thermosynechococcus elongatus (strain BP-1) GN=ahcY PE=3 SV=1 7 434 3.0E-100
sp|O28279|SAHH_ARCFU Adenosylhomocysteinase OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=ahcY PE=3 SV=1 19 434 8.0E-100
sp|Q5JED2|SAHH_THEKO Adenosylhomocysteinase OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=ahcY PE=3 SV=1 6 434 9.0E-99
sp|Q8TRA5|SAHH_METAC Adenosylhomocysteinase OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=ahcY PE=3 SV=1 15 434 3.0E-97
sp|Q8PUQ4|SAHH_METMA Adenosylhomocysteinase OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=ahcY PE=3 SV=1 19 434 5.0E-96
sp|Q7NGI6|SAHH_GLOVI Adenosylhomocysteinase OS=Gloeobacter violaceus (strain PCC 7421) GN=ahcY PE=3 SV=1 4 440 8.0E-95
sp|O27673|SAHH_METTH Adenosylhomocysteinase OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=ahcY PE=3 SV=1 8 434 3.0E-94
sp|Q9HKX4|SAHH_THEAC Adenosylhomocysteinase OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=ahcY PE=3 SV=1 26 440 8.0E-88
sp|Q979Z4|SAHH_THEVO Adenosylhomocysteinase OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=ahcY PE=3 SV=1 23 440 2.0E-85
sp|O51933|SAHH_THEMA Adenosylhomocysteinase OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=ahcY PE=1 SV=2 19 434 1.0E-84
sp|Q9HN50|SAHH_HALSA Adenosylhomocysteinase OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=ahcY PE=3 SV=1 3 434 1.0E-82
sp|B0R7F2|SAHH_HALS3 Adenosylhomocysteinase OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=ahcY PE=3 SV=1 3 434 1.0E-82
sp|G0LFB0|SAHH_HALWC Adenosylhomocysteinase OS=Haloquadratum walsbyi (strain DSM 16854 / JCM 12705 / C23) GN=ahcY PE=3 SV=1 19 434 3.0E-82
sp|Q18EV6|SAHH_HALWD Adenosylhomocysteinase OS=Haloquadratum walsbyi (strain DSM 16790 / HBSQ001) GN=ahcY PE=3 SV=1 19 434 5.0E-82
sp|P26799|SAHH_STRFR Adenosylhomocysteinase (Fragment) OS=Streptomyces fradiae GN=ahcY PE=3 SV=1 324 449 7.0E-34
[Show less]

GO

GO Term Description Terminal node
GO:0051287 NAD binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No
GO:0036094 small molecule binding No
GO:1901363 heterocyclic compound binding No
GO:1901265 nucleoside phosphate binding No
GO:0097159 organic cyclic compound binding No
GO:0000166 nucleotide binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|6043
MAAPAQKFKVADLSLAAFGRKEIELAENEMPGLMATRSKYASDQPLKGARIAGCLHMTIQTAVLIETLVALGAEV
TWTSCNIFSTQDHAAAAIAAAGVPVFAWKGETEEEYNWCLEQQLVSFKDGKKLNLILDDGGDLTQLVHSKYPDML
KDCYGVSEETTTGVHHLYRMLKDKKLLVPAINVNDSVTKSKFDNLYGCRESLIDGIKRATDVMIAGKVAVVAGFG
DVGKGCAMALHGMGARVLVTEIDPINALQAAMAGYQVTSMENAAKIGQIFVTTTGCRDILTGKHFELMPNDAIVC
NIGHFDIEIDVAWLKKNAKSVQNIKPQVDRFLMPSGRHIILLAEGRLVNLGCATGHSSFVMSCSFTNQVLAQIML
YKAKDEAWGKKHVEFAKTDKLGVGVYVLPKILDEEVARLHLAHVQAELTHLTNVQAEYLGLTVEGPFKSDHYRY*
Coding >OphauB2|6043
ATGGCTGCCCCCGCTCAAAAGTTCAAGGTCGCCGACCTCTCGCTTGCTGCCTTTGGTCGCAAGGAGATTGAGCTC
GCCGAGAATGAGATGCCTGGTCTCATGGCCACGCGCTCCAAATATGCCTCTGATCAGCCTCTCAAGGGCGCCCGC
ATTGCCGGCTGCCTCCACATGACTATCCAGACGGCCGTTTTGATTGAGACCTTGGTGGCACTTGGTGCCGAGGTG
ACGTGGACAAGCTGCAACATCTTTAGCACCCAGGACCATGCTGCTGCTGCCATTGCGGCTGCTGGTGTCCCTGTA
TTTGCCTGGAAGGGCGAGACGGAGGAGGAGTACAATTGGTGTCTGGAGCAGCAGCTGGTATCCTTCAAGGATGGC
AAGAAGCTGAATCTGATTCTCGACGACGGCGGTGATCTTACTCAGCTGGTGCATTCCAAGTATCCCGACATGCTC
AAGGACTGCTACGGTGTCTCGGAAGAAACGACTACTGGGGTTCACCATCTATACCGCATGCTCAAGGACAAGAAG
CTTCTAGTGCCTGCCATTAATGTCAACGACTCGGTCACAAAGTCCAAATTCGATAACCTCTACGGCTGCCGCGAG
TCTCTTATCGATGGCATCAAGCGAGCTACCGATGTCATGATTGCGGGCAAGGTTGCCGTGGTTGCTGGTTTTGGT
GATGTCGGCAAGGGGTGTGCCATGGCTCTGCATGGCATGGGTGCCCGTGTTCTCGTCACAGAGATCGACCCCATC
AATGCTCTTCAGGCAGCCATGGCAGGCTACCAGGTTACCTCGATGGAAAATGCTGCCAAGATTGGTCAGATTTTT
GTTACCACCACTGGCTGCAGAGACATTCTCACGGGCAAGCATTTTGAGCTAATGCCCAATGACGCCATTGTGTGT
AACATTGGCCACTTTGACATCGAGATTGATGTCGCTTGGCTCAAGAAGAATGCCAAGTCGGTCCAGAACATTAAG
CCTCAGGTCGATCGCTTCCTGATGCCCTCGGGCCGTCACATCATCCTCCTGGCTGAGGGGCGTCTTGTCAATCTT
GGCTGTGCCACGGGTCACTCGTCCTTTGTCATGTCGTGCTCCTTTACAAACCAAGTCTTGGCTCAAATCATGTTG
TACAAGGCCAAGGATGAGGCCTGGGGAAAGAAACATGTCGAGTTTGCCAAGACTGACAAGCTCGGCGTCGGCGTT
TACGTCTTGCCCAAGATTTTGGACGAAGAAGTTGCCCGCTTGCACCTTGCCCATGTGCAGGCTGAACTTACCCAT
CTCACCAATGTCCAAGCCGAATATCTCGGTCTTACAGTCGAGGGACCATTCAAGAGCGACCATTACCGCTACTAA
Transcript >OphauB2|6043
ATGGCTGCCCCCGCTCAAAAGTTCAAGGTCGCCGACCTCTCGCTTGCTGCCTTTGGTCGCAAGGAGATTGAGCTC
GCCGAGAATGAGATGCCTGGTCTCATGGCCACGCGCTCCAAATATGCCTCTGATCAGCCTCTCAAGGGCGCCCGC
ATTGCCGGCTGCCTCCACATGACTATCCAGACGGCCGTTTTGATTGAGACCTTGGTGGCACTTGGTGCCGAGGTG
ACGTGGACAAGCTGCAACATCTTTAGCACCCAGGACCATGCTGCTGCTGCCATTGCGGCTGCTGGTGTCCCTGTA
TTTGCCTGGAAGGGCGAGACGGAGGAGGAGTACAATTGGTGTCTGGAGCAGCAGCTGGTATCCTTCAAGGATGGC
AAGAAGCTGAATCTGATTCTCGACGACGGCGGTGATCTTACTCAGCTGGTGCATTCCAAGTATCCCGACATGCTC
AAGGACTGCTACGGTGTCTCGGAAGAAACGACTACTGGGGTTCACCATCTATACCGCATGCTCAAGGACAAGAAG
CTTCTAGTGCCTGCCATTAATGTCAACGACTCGGTCACAAAGTCCAAATTCGATAACCTCTACGGCTGCCGCGAG
TCTCTTATCGATGGCATCAAGCGAGCTACCGATGTCATGATTGCGGGCAAGGTTGCCGTGGTTGCTGGTTTTGGT
GATGTCGGCAAGGGGTGTGCCATGGCTCTGCATGGCATGGGTGCCCGTGTTCTCGTCACAGAGATCGACCCCATC
AATGCTCTTCAGGCAGCCATGGCAGGCTACCAGGTTACCTCGATGGAAAATGCTGCCAAGATTGGTCAGATTTTT
GTTACCACCACTGGCTGCAGAGACATTCTCACGGGCAAGCATTTTGAGCTAATGCCCAATGACGCCATTGTGTGT
AACATTGGCCACTTTGACATCGAGATTGATGTCGCTTGGCTCAAGAAGAATGCCAAGTCGGTCCAGAACATTAAG
CCTCAGGTCGATCGCTTCCTGATGCCCTCGGGCCGTCACATCATCCTCCTGGCTGAGGGGCGTCTTGTCAATCTT
GGCTGTGCCACGGGTCACTCGTCCTTTGTCATGTCGTGCTCCTTTACAAACCAAGTCTTGGCTCAAATCATGTTG
TACAAGGCCAAGGATGAGGCCTGGGGAAAGAAACATGTCGAGTTTGCCAAGACTGACAAGCTCGGCGTCGGCGTT
TACGTCTTGCCCAAGATTTTGGACGAAGAAGTTGCCCGCTTGCACCTTGCCCATGTGCAGGCTGAACTTACCCAT
CTCACCAATGTCCAAGCCGAATATCTCGGTCTTACAGTCGAGGGACCATTCAAGAGCGACCATTACCGCTACTAA
Gene >OphauB2|6043
ATGGCTGCCCCCGCTCAAAAGTTCAAGGTCGCCGACCTCTCGCTTGCTGCCTTTGGTCGCAAGGAGATTGAGCTC
GCCGAGAATGAGATGCCTGGTCTCATGGCCACGCGCTCCAAATATGCCTCTGATCAGCCTCTCAAGGGCGCCCGC
ATTGCCGGCTGCCTCCACATGACTATCCAGACGGCCGTTTTGATTGAGACCTTGGTGGCACTTGGTGCCGAGGTG
ACGTGGACAAGCTGCAACATCTTTAGCACCCAGGACCATGCTGCTGCTGCCATTGCGGCTGCTGGTGTCCCTGTA
TTTGCCTGGAAGGGCGAGACGGAGGAGGAGTACAATTGGTGTCTGGAGCAGCAGCTGGTATCCTTCAAGGATGGC
AAGAAGCTGAATCTGATTCTCGACGACGGCGGTGATCTTACTCAGCTGGTGCATTCCAAGTATCCCGACATGCTC
AAGGACTGCTACGGTGTCTCGGAAGAAACGACTACTGGGGTTCACCATCTATACCGCATGCTCAAGGACAAGAAG
CTTCTAGTGCCTGCCATTAATGTCAACGACTCGGTCACAAAGTCCAAATTCGATAACCTCTACGGCTGCCGCGAG
TCTCTTATCGATGGCATCAAGCGAGCTACCGATGTCATGATTGCGGGCAAGGTTGCCGTGGTTGCTGGTTTTGGT
GATGTCGGCAAGGGGTGTGCCATGGCTCTGCATGGCATGGGTGCCCGTGTTCTCGTCACAGAGATCGACCCCATC
AATGCTCTTCAGGCAGCCATGGCAGGCTACCAGGTTACCTCGATGGAAAATGCTGCCAAGATTGGTCAGATTTTT
GTTACCACCACTGGCTGCAGAGACATTCTCACGGGCAAGCATTTTGAGCTAATGCCCAATGACGCCATTGTGTGT
AGTAAGTCTTGGCTCGTTTTCTCCTTTAATGGCCCTATTATAGCCCTTGCTAACACCCTGTAGACATTGGCCACT
TTGACATCGAGATTGATGTCGCTTGGCTCAAGAAGAATGCCAAGTCGGTCCAGAACATTAAGCCTCAGGTCGATC
GCTTCCTGATGCCCTCGGGCCGTCACATCATCCTCCTGGCTGAGGGGCGTCTTGTCAATCTTGGCTGTGCCACGG
GTCACTCGTCCTTTGTCATGTCGTGCTCCTTTACAAACCAAGTCTTGGCTCAAATCATGTTGTACAAGGCCAAGG
ATGAGGCCTGGGGAAAGAAACATGTCGAGTTTGCCAAGACTGACAAGCTCGGCGTCGGCGTTTACGTCTTGCCCA
AGATTTTGGACGAAGAAGTTGCCCGCTTGCACCTTGCCCATGTGCAGGCTGAACTTACCCATCTCACCAATGTCC
AAGCCGAATATCTCGGTCTTACAGTCGAGGGACCATTCAAGAGCGACCATTACCGCTACTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail