Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|6035
Gene name
LocationContig_51:717..2970
Strand+
Gene length (bp)2253
Transcript length (bp)2253
Coding sequence length (bp)2253
Protein length (aa) 751

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00069 Pkinase Protein kinase domain 6.5E-51 45 308
PF07714 PK_Tyr_Ser-Thr Protein tyrosine and serine/threonine kinase 1.7E-36 45 304

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O75011|NAK1_SCHPO Serine/threonine-protein kinase nak1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=nak1 PE=1 SV=1 39 363 4.0E-54
sp|P38692|KIC1_YEAST Serine/threonine-protein kinase KIC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KIC1 PE=1 SV=1 43 340 2.0E-51
sp|O61122|SVKA_DICDI Serine/threonine-protein kinase svkA OS=Dictyostelium discoideum GN=svkA PE=1 SV=1 43 330 2.0E-50
sp|H2L099|GCK1_CAEEL Germinal center kinase 1 OS=Caenorhabditis elegans GN=gck-1 PE=1 SV=1 43 367 5.0E-50
sp|Q86IX1|DST1_DICDI Serine/threonine-protein kinase dst1 OS=Dictyostelium discoideum GN=dst1 PE=3 SV=1 43 324 1.0E-48
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O75011|NAK1_SCHPO Serine/threonine-protein kinase nak1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=nak1 PE=1 SV=1 39 363 4.0E-54
sp|P38692|KIC1_YEAST Serine/threonine-protein kinase KIC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KIC1 PE=1 SV=1 43 340 2.0E-51
sp|O61122|SVKA_DICDI Serine/threonine-protein kinase svkA OS=Dictyostelium discoideum GN=svkA PE=1 SV=1 43 330 2.0E-50
sp|H2L099|GCK1_CAEEL Germinal center kinase 1 OS=Caenorhabditis elegans GN=gck-1 PE=1 SV=1 43 367 5.0E-50
sp|Q86IX1|DST1_DICDI Serine/threonine-protein kinase dst1 OS=Dictyostelium discoideum GN=dst1 PE=3 SV=1 43 324 1.0E-48
sp|O14047|PPK11_SCHPO Serine/threonine-protein kinase ppk11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppk11 PE=3 SV=1 47 331 2.0E-46
sp|O00506|STK25_HUMAN Serine/threonine-protein kinase 25 OS=Homo sapiens GN=STK25 PE=1 SV=1 49 416 2.0E-44
sp|Q9Z2W1|STK25_MOUSE Serine/threonine-protein kinase 25 OS=Mus musculus GN=Stk25 PE=1 SV=2 49 370 9.0E-44
sp|Q3SWY6|STK25_BOVIN Serine/threonine-protein kinase 25 OS=Bos taurus GN=STK25 PE=2 SV=1 49 339 2.0E-43
sp|Q9UKE5|TNIK_HUMAN TRAF2 and NCK-interacting protein kinase OS=Homo sapiens GN=TNIK PE=1 SV=1 43 308 3.0E-42
sp|P83510|TNIK_MOUSE Traf2 and NCK-interacting protein kinase OS=Mus musculus GN=Tnik PE=1 SV=2 43 308 3.0E-42
sp|Q55GC2|DST2_DICDI Serine/threonine-protein kinase dst2 OS=Dictyostelium discoideum GN=dst2 PE=3 SV=1 43 330 4.0E-42
sp|O14305|SID1_SCHPO Serine/threonine-protein kinase sid1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sid1 PE=1 SV=1 40 308 5.0E-42
sp|P08458|SPS1_YEAST Sporulation-specific protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SPS1 PE=1 SV=2 30 313 3.0E-40
sp|Q9P289|STK26_HUMAN Serine/threonine-protein kinase 26 OS=Homo sapiens GN=STK26 PE=1 SV=2 43 334 5.0E-40
sp|Q99JT2|STK26_MOUSE Serine/threonine-protein kinase 26 OS=Mus musculus GN=Stk26 PE=1 SV=1 43 334 5.0E-40
sp|Q9Y6E0|STK24_HUMAN Serine/threonine-protein kinase 24 OS=Homo sapiens GN=STK24 PE=1 SV=1 43 333 2.0E-39
sp|Q99KH8|STK24_MOUSE Serine/threonine-protein kinase 24 OS=Mus musculus GN=Stk24 PE=1 SV=1 43 333 2.0E-39
sp|B0LT89|STK24_RAT Serine/threonine-protein kinase 24 OS=Rattus norvegicus GN=Stk24 PE=2 SV=1 43 333 4.0E-39
sp|Q6IP06|STK3_XENLA Serine/threonine-protein kinase 3 OS=Xenopus laevis GN=stk3 PE=2 SV=1 26 325 2.0E-38
sp|Q802A6|STK4_SQUAC Serine/threonine-protein kinase 3/4 OS=Squalus acanthias GN=STK4 PE=2 SV=1 28 325 3.0E-38
sp|Q13188|STK3_HUMAN Serine/threonine-protein kinase 3 OS=Homo sapiens GN=STK3 PE=1 SV=2 26 325 5.0E-38
sp|Q9JI10|STK3_MOUSE Serine/threonine-protein kinase 3 OS=Mus musculus GN=Stk3 PE=1 SV=1 25 325 6.0E-38
sp|A4K2W5|STK4_AOTNA Serine/threonine-protein kinase 4 OS=Aotus nancymaae GN=STK4 PE=3 SV=1 35 308 8.0E-38
sp|O54748|STK3_RAT Serine/threonine-protein kinase 3 OS=Rattus norvegicus GN=Stk3 PE=1 SV=1 26 325 9.0E-38
sp|A4K2M3|STK4_PAPAN Serine/threonine-protein kinase 4 OS=Papio anubis GN=STK4 PE=3 SV=1 35 308 2.0E-37
sp|A4K2T0|STK4_MACMU Serine/threonine-protein kinase 4 OS=Macaca mulatta GN=STK4 PE=3 SV=1 35 308 2.0E-37
sp|Q5E9L6|STK4_BOVIN Serine/threonine-protein kinase 4 OS=Bos taurus GN=STK4 PE=2 SV=1 35 308 2.0E-37
sp|A4K2Y1|STK4_CHLAE Serine/threonine-protein kinase 4 OS=Chlorocebus aethiops GN=STK4 PE=3 SV=1 35 308 2.0E-37
sp|Q13043|STK4_HUMAN Serine/threonine-protein kinase 4 OS=Homo sapiens GN=STK4 PE=1 SV=2 35 308 2.0E-37
sp|Q9JI11|STK4_MOUSE Serine/threonine-protein kinase 4 OS=Mus musculus GN=Stk4 PE=1 SV=1 35 308 3.0E-37
sp|Q551H4|FRAY2_DICDI Serine/threonine-protein kinase fray2 OS=Dictyostelium discoideum GN=fray2 PE=3 SV=1 43 325 3.0E-37
sp|Q924I2|M4K3_RAT Mitogen-activated protein kinase kinase kinase kinase 3 OS=Rattus norvegicus GN=Map4k3 PE=1 SV=2 43 308 3.0E-37
sp|Q8IVH8|M4K3_HUMAN Mitogen-activated protein kinase kinase kinase kinase 3 OS=Homo sapiens GN=MAP4K3 PE=1 SV=1 35 308 3.0E-37
sp|A4K2P5|STK4_COLGU Serine/threonine-protein kinase 4 OS=Colobus guereza GN=STK4 PE=3 SV=1 35 308 3.0E-37
sp|A4K2Q5|STK4_OTOGA Serine/threonine-protein kinase 4 OS=Otolemur garnettii GN=STK4 PE=3 SV=1 35 308 4.0E-37
sp|Q7ZUQ3|STK3_DANRE Serine/threonine-protein kinase 3 OS=Danio rerio GN=stk3 PE=2 SV=1 35 325 5.0E-37
sp|A4K2S1|STK4_LEMCA Serine/threonine-protein kinase 4 OS=Lemur catta GN=STK4 PE=3 SV=1 35 308 5.0E-37
sp|Q23356|MIG15_CAEEL Serine/threonine-protein kinase mig-15 OS=Caenorhabditis elegans GN=mig-15 PE=2 SV=3 43 308 7.0E-37
sp|Q99JP0|M4K3_MOUSE Mitogen-activated protein kinase kinase kinase kinase 3 OS=Mus musculus GN=Map4k3 PE=1 SV=4 43 308 1.0E-36
sp|Q7Z2Y5|NRK_HUMAN Nik-related protein kinase OS=Homo sapiens GN=NRK PE=1 SV=2 31 334 2.0E-36
sp|Q64303|PAK2_RAT Serine/threonine-protein kinase PAK 2 OS=Rattus norvegicus GN=Pak2 PE=1 SV=1 2 328 2.0E-36
sp|Q8CIN4|PAK2_MOUSE Serine/threonine-protein kinase PAK 2 OS=Mus musculus GN=Pak2 PE=1 SV=1 2 328 2.0E-36
sp|Q61161|M4K2_MOUSE Mitogen-activated protein kinase kinase kinase kinase 2 OS=Mus musculus GN=Map4k2 PE=1 SV=1 43 307 2.0E-36
sp|A8XJW8|CST1_CAEBR Serine/threonine-protein kinase cst-1 OS=Caenorhabditis briggsae GN=cst-1 PE=3 SV=2 41 310 3.0E-36
sp|Q9NB31|CST1_CAEEL Serine/threonine-protein kinase cst-1 OS=Caenorhabditis elegans GN=cst-1 PE=1 SV=1 41 310 4.0E-36
sp|Q13177|PAK2_HUMAN Serine/threonine-protein kinase PAK 2 OS=Homo sapiens GN=PAK2 PE=1 SV=3 2 328 4.0E-36
sp|Q9R0G8|NRK_MOUSE Nik-related protein kinase OS=Mus musculus GN=Nrk PE=1 SV=2 31 334 5.0E-36
sp|Q55FS2|STK4L_DICDI Serine/threonine-protein kinase 4 homolog B OS=Dictyostelium discoideum GN=krsB PE=3 SV=1 43 375 5.0E-36
sp|Q12851|M4K2_HUMAN Mitogen-activated protein kinase kinase kinase kinase 2 OS=Homo sapiens GN=MAP4K2 PE=1 SV=2 43 307 8.0E-36
sp|Q6PA14|STK4_XENLA Serine/threonine-protein kinase 4 OS=Xenopus laevis GN=stk4 PE=2 SV=1 43 308 1.0E-35
sp|Q29502|PAK2_RABIT Serine/threonine-protein kinase PAK 2 OS=Oryctolagus cuniculus GN=PAK2 PE=2 SV=1 15 328 1.0E-35
sp|Q5ZJK4|STK4_CHICK Serine/threonine-protein kinase 4 OS=Gallus gallus GN=STK4 PE=2 SV=1 35 308 1.0E-35
sp|Q8BPM2|M4K5_MOUSE Mitogen-activated protein kinase kinase kinase kinase 5 OS=Mus musculus GN=Map4k5 PE=1 SV=2 31 308 2.0E-35
sp|Q9Y4K4|M4K5_HUMAN Mitogen-activated protein kinase kinase kinase kinase 5 OS=Homo sapiens GN=MAP4K5 PE=1 SV=1 31 308 2.0E-35
sp|O95819|M4K4_HUMAN Mitogen-activated protein kinase kinase kinase kinase 4 OS=Homo sapiens GN=MAP4K4 PE=1 SV=2 43 308 2.0E-35
sp|Q9JM52|MINK1_MOUSE Misshapen-like kinase 1 OS=Mus musculus GN=Mink1 PE=1 SV=3 43 308 2.0E-35
sp|Q6P3Q4|STK4_XENTR Serine/threonine-protein kinase 4 OS=Xenopus tropicalis GN=stk4 PE=2 SV=1 43 308 3.0E-35
sp|F1LP90|MINK1_RAT Misshapen-like kinase 1 OS=Rattus norvegicus GN=Mink1 PE=1 SV=2 43 308 3.0E-35
sp|Q62829|PAK3_RAT Serine/threonine-protein kinase PAK 3 OS=Rattus norvegicus GN=Pak3 PE=1 SV=1 31 328 3.0E-35
sp|Q8N4C8|MINK1_HUMAN Misshapen-like kinase 1 OS=Homo sapiens GN=MINK1 PE=1 SV=2 43 308 3.0E-35
sp|Q61036|PAK3_MOUSE Serine/threonine-protein kinase PAK 3 OS=Mus musculus GN=Pak3 PE=1 SV=2 31 328 4.0E-35
sp|Q7YQL3|PAK3_PONPY Serine/threonine-protein kinase PAK 3 OS=Pongo pygmaeus GN=PAK3 PE=2 SV=1 31 328 6.0E-35
sp|Q7YQL4|PAK3_PANTR Serine/threonine-protein kinase PAK 3 OS=Pan troglodytes GN=PAK3 PE=2 SV=1 31 328 6.0E-35
sp|O75914|PAK3_HUMAN Serine/threonine-protein kinase PAK 3 OS=Homo sapiens GN=PAK3 PE=1 SV=2 31 328 6.0E-35
sp|Q54XL6|FRAY1_DICDI Serine/threonine-protein kinase fray1 OS=Dictyostelium discoideum GN=fray1 PE=3 SV=1 31 305 6.0E-35
sp|Q13153|PAK1_HUMAN Serine/threonine-protein kinase PAK 1 OS=Homo sapiens GN=PAK1 PE=1 SV=2 31 328 1.0E-34
sp|P35465|PAK1_RAT Serine/threonine-protein kinase PAK 1 OS=Rattus norvegicus GN=Pak1 PE=1 SV=3 31 328 1.0E-34
sp|Q08E52|PAK1_BOVIN Serine/threonine-protein kinase PAK 1 OS=Bos taurus GN=PAK1 PE=1 SV=1 31 328 1.0E-34
sp|Q8AXB4|PAK3_XENLA Serine/threonine-protein kinase PAK 3 OS=Xenopus laevis GN=pak3 PE=2 SV=1 31 328 1.0E-34
sp|Q2VWQ3|STE20_TALMA Serine/threonine-protein kinase pakA OS=Talaromyces marneffei GN=pakA PE=3 SV=1 49 333 2.0E-34
sp|O23304|BLUS1_ARATH Serine/threonine-protein kinase BLUS1 OS=Arabidopsis thaliana GN=BLUS1 PE=1 SV=1 49 325 2.0E-34
sp|P50527|STE20_SCHPO Serine/threonine-protein kinase shk1/pak1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=shk1 PE=1 SV=2 49 326 2.0E-34
sp|O88643|PAK1_MOUSE Serine/threonine-protein kinase PAK 1 OS=Mus musculus GN=Pak1 PE=1 SV=1 33 328 2.0E-34
sp|Q5BBL3|STE20_EMENI Serine/threonine-protein kinase ste20 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=ste20 PE=3 SV=1 49 333 4.0E-34
sp|Q6FN53|STE20_CANGA Serine/threonine-protein kinase STE20 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=STE20 PE=3 SV=1 49 329 6.0E-34
sp|Q8T0S6|HIPPO_DROME Serine/threonine-protein kinase hippo OS=Drosophila melanogaster GN=hpo PE=1 SV=1 41 354 6.0E-34
sp|Q863I2|OXSR1_PIG Serine/threonine-protein kinase OSR1 OS=Sus scrofa GN=OXSR1 PE=2 SV=1 43 308 1.0E-33
sp|Q869T7|PAKF_DICDI Serine/threonine-protein kinase pakF OS=Dictyostelium discoideum GN=pakF PE=3 SV=1 43 308 2.0E-33
sp|F1NBT0|STK10_CHICK Serine/threonine-protein kinase 10 OS=Gallus gallus GN=STK10 PE=3 SV=2 49 308 2.0E-33
sp|Q2ULU3|STE20_ASPOR Serine/threonine-protein kinase ste20 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=ste20 PE=3 SV=1 49 333 2.0E-33
sp|Q8BTW9|PAK4_MOUSE Serine/threonine-protein kinase PAK 4 OS=Mus musculus GN=Pak4 PE=1 SV=1 49 308 4.0E-33
sp|Q5R495|OXSR1_PONAB Serine/threonine-protein kinase OSR1 OS=Pongo abelii GN=OXSR1 PE=2 SV=1 43 308 4.0E-33
sp|O95747|OXSR1_HUMAN Serine/threonine-protein kinase OSR1 OS=Homo sapiens GN=OXSR1 PE=1 SV=1 43 308 4.0E-33
sp|Q5R8Z4|PAK6_PONAB Serine/threonine-protein kinase PAK 6 OS=Pongo abelii GN=PAK6 PE=2 SV=1 28 328 4.0E-33
sp|Q4WHP3|STE20_ASPFU Serine/threonine-protein kinase ste20 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=ste20 PE=3 SV=2 49 333 5.0E-33
sp|Q9NQU5|PAK6_HUMAN Serine/threonine-protein kinase PAK 6 OS=Homo sapiens GN=PAK6 PE=1 SV=1 28 328 5.0E-33
sp|O96013|PAK4_HUMAN Serine/threonine-protein kinase PAK 4 OS=Homo sapiens GN=PAK4 PE=1 SV=1 49 308 7.0E-33
sp|Q6P9R2|OXSR1_MOUSE Serine/threonine-protein kinase OSR1 OS=Mus musculus GN=Oxsr1 PE=1 SV=1 43 308 7.0E-33
sp|O61125|STK4_DICDI Serine/threonine-protein kinase 4 homolog A OS=Dictyostelium discoideum GN=krsA PE=1 SV=1 43 308 8.0E-33
sp|Q3ULB5|PAK6_MOUSE Serine/threonine-protein kinase PAK 6 OS=Mus musculus GN=Pak6 PE=2 SV=1 28 328 1.0E-32
sp|Q8T2I8|SEPA_DICDI Serine/threonine-protein kinase sepA OS=Dictyostelium discoideum GN=sepA PE=2 SV=1 43 319 2.0E-32
sp|Q6CVA2|STE20_KLULA Serine/threonine-protein kinase STE20 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=STE20 PE=3 SV=1 49 329 2.0E-32
sp|P27636|CDC15_YEAST Cell division control protein 15 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC15 PE=1 SV=3 36 312 2.0E-32
sp|D4A280|PAK7_RAT Serine/threonine-protein kinase PAK 7 OS=Rattus norvegicus GN=Pak7 PE=1 SV=1 49 328 3.0E-32
sp|Q8C015|PAK7_MOUSE Serine/threonine-protein kinase PAK 7 OS=Mus musculus GN=Pak7 PE=1 SV=1 49 328 3.0E-32
sp|Q75DK7|STE20_ASHGO Serine/threonine-protein kinase STE20 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=STE20 PE=3 SV=2 23 329 7.0E-32
sp|Q7RZD3|STE20_NEUCR Serine/threonine-protein kinase ste20 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=stk-4 PE=3 SV=1 27 338 8.0E-32
sp|Q9P286|PAK7_HUMAN Serine/threonine-protein kinase PAK 7 OS=Homo sapiens GN=PAK7 PE=1 SV=1 49 328 9.0E-32
sp|Q9SFB6|M3KE2_ARATH MAP3K epsilon protein kinase 2 OS=Arabidopsis thaliana GN=MAP3KE2 PE=2 SV=1 43 338 1.0E-31
sp|P97820|M4K4_MOUSE Mitogen-activated protein kinase kinase kinase kinase 4 OS=Mus musculus GN=Map4k4 PE=1 SV=1 43 308 1.0E-31
sp|E9PTG8|STK10_RAT Serine/threonine-protein kinase 10 OS=Rattus norvegicus GN=Stk10 PE=1 SV=1 44 308 1.0E-31
sp|Q54B33|PAKE_DICDI Serine/threonine-protein kinase pakE OS=Dictyostelium discoideum GN=pakE PE=3 SV=1 43 324 2.0E-31
sp|Q556S2|PAKH_DICDI Serine/threonine-protein kinase pakH OS=Dictyostelium discoideum GN=pakH-1 PE=3 SV=1 43 308 2.0E-31
sp|Q7SY52|STK10_DANRE Serine/threonine-protein kinase 10 OS=Danio rerio GN=stk10 PE=2 SV=1 49 321 2.0E-31
sp|O55098|STK10_MOUSE Serine/threonine-protein kinase 10 OS=Mus musculus GN=Stk10 PE=1 SV=2 49 308 3.0E-31
sp|E1BK52|STK10_BOVIN Serine/threonine-protein kinase 10 OS=Bos taurus GN=STK10 PE=3 SV=3 30 308 3.0E-31
sp|Q9VXE5|PAKM_DROME Serine/threonine-protein kinase PAK mbt OS=Drosophila melanogaster GN=mbt PE=1 SV=2 49 308 3.0E-31
sp|B7ZR30|STK10_XENLA Serine/threonine-protein kinase 10-A OS=Xenopus laevis GN=stk10-a PE=1 SV=1 31 321 3.0E-31
sp|A0A078CGE6|M3KE1_BRANA MAP3K epsilon protein kinase 1 OS=Brassica napus GN=M3KE1 PE=1 SV=1 43 373 3.0E-31
sp|Q4P5N0|STE20_USTMA Serine/threonine-protein kinase SMU1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SMU1 PE=3 SV=1 14 328 4.0E-31
sp|Q9LJD8|M3KE1_ARATH MAP3K epsilon protein kinase 1 OS=Arabidopsis thaliana GN=M3KE1 PE=1 SV=1 43 312 5.0E-31
sp|Q8WXR4|MYO3B_HUMAN Myosin-IIIb OS=Homo sapiens GN=MYO3B PE=2 SV=4 47 308 6.0E-31
sp|Q9UEW8|STK39_HUMAN STE20/SPS1-related proline-alanine-rich protein kinase OS=Homo sapiens GN=STK39 PE=1 SV=3 33 320 6.0E-31
sp|Q7Z8E9|STE20_MAGO7 Serine/threonine-protein kinase MST20 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=MST20 PE=3 SV=3 27 338 8.0E-31
sp|Q9Z1W9|STK39_MOUSE STE20/SPS1-related proline-alanine-rich protein kinase OS=Mus musculus GN=Stk39 PE=1 SV=1 33 320 8.0E-31
sp|O94804|STK10_HUMAN Serine/threonine-protein kinase 10 OS=Homo sapiens GN=STK10 PE=1 SV=1 30 308 9.0E-31
sp|Q54QI2|Y9877_DICDI Serine/threonine-protein kinase DDB_G0283821 OS=Dictyostelium discoideum GN=DDB_G0283821 PE=3 SV=1 43 308 9.0E-31
sp|Q03497|STE20_YEAST Serine/threonine-protein kinase STE20 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=STE20 PE=1 SV=1 49 329 9.0E-31
sp|O88506|STK39_RAT STE20/SPS1-related proline-alanine-rich protein kinase OS=Rattus norvegicus GN=Stk39 PE=1 SV=2 33 320 1.0E-30
sp|Q55D99|PAKA_DICDI Serine/threonine-protein kinase pakA OS=Dictyostelium discoideum GN=pakA PE=1 SV=1 49 308 1.0E-30
sp|Q0IHQ8|STK10_XENTR Serine/threonine-protein kinase 10 OS=Xenopus tropicalis GN=stk10 PE=2 SV=1 31 321 3.0E-30
sp|Q6C3D7|STE20_YARLI Serine/threonine-protein kinase STE20 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=STE20 PE=3 SV=1 49 333 4.0E-30
sp|O54988|SLK_MOUSE STE20-like serine/threonine-protein kinase OS=Mus musculus GN=Slk PE=1 SV=2 49 308 4.0E-30
sp|O08815|SLK_RAT STE20-like serine/threonine-protein kinase OS=Rattus norvegicus GN=Slk PE=1 SV=1 49 308 4.0E-30
sp|O55092|SLK_CAVPO STE20-like serine/threonine-protein kinase OS=Cavia porcellus GN=SLK PE=1 SV=1 49 308 5.0E-30
sp|P0C8M8|CCR1_MAIZE Probable serine/threonine-protein kinase CCRP1 OS=Zea mays GN=CCRP1 PE=1 SV=1 48 310 1.0E-29
sp|Q869N2|PAKB_DICDI Serine/threonine-protein kinase pakB OS=Dictyostelium discoideum GN=pakB PE=1 SV=1 49 308 1.0E-29
sp|Q1EG27|MYO3B_MOUSE Myosin-IIIb OS=Mus musculus GN=Myo3b PE=2 SV=2 47 312 2.0E-29
sp|E9Q3S4|M3K19_MOUSE Mitogen-activated protein kinase kinase kinase 19 OS=Mus musculus GN=Map3k19 PE=3 SV=1 47 312 3.0E-29
sp|Q9H2G2|SLK_HUMAN STE20-like serine/threonine-protein kinase OS=Homo sapiens GN=SLK PE=1 SV=1 49 308 3.0E-29
sp|Q55GV3|PAKC_DICDI Serine/threonine-protein kinase pakC OS=Dictyostelium discoideum GN=pakC PE=1 SV=2 49 308 3.0E-29
sp|Q92918|M4K1_HUMAN Mitogen-activated protein kinase kinase kinase kinase 1 OS=Homo sapiens GN=MAP4K1 PE=1 SV=1 43 308 4.0E-29
sp|Q53UA7|TAOK3_RAT Serine/threonine-protein kinase TAO3 OS=Rattus norvegicus GN=Taok3 PE=1 SV=1 49 308 4.0E-29
sp|Q54RV3|PAKG_DICDI Serine/threonine-protein kinase pakG OS=Dictyostelium discoideum GN=pakG PE=3 SV=1 33 324 6.0E-29
sp|Q5RAJ5|STK36_PONAB Serine/threonine-protein kinase 36 OS=Pongo abelii GN=STK36 PE=2 SV=1 47 308 6.0E-29
sp|Q8BYC6|TAOK3_MOUSE Serine/threonine-protein kinase TAO3 OS=Mus musculus GN=Taok3 PE=1 SV=2 49 308 7.0E-29
sp|A2BD05|NEK6_PIG Serine/threonine-protein kinase Nek6 OS=Sus scrofa GN=NEK6 PE=3 SV=1 21 304 8.0E-29
sp|Q9H2K8|TAOK3_HUMAN Serine/threonine-protein kinase TAO3 OS=Homo sapiens GN=TAOK3 PE=1 SV=2 49 308 9.0E-29
sp|Q9I9E0|TAOK3_CHICK Serine/threonine-protein kinase TAO3 OS=Gallus gallus GN=TAOK3 PE=2 SV=2 49 308 1.0E-28
sp|Q9NRP7|STK36_HUMAN Serine/threonine-protein kinase 36 OS=Homo sapiens GN=STK36 PE=1 SV=2 47 308 1.0E-28
sp|Q5R4F3|TAOK3_PONAB Serine/threonine-protein kinase TAO3 OS=Pongo abelii GN=TAOK3 PE=2 SV=1 49 308 2.0E-28
sp|Q0CL79|SEPH_ASPTN Cytokinesis protein sepH OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=sepH PE=3 SV=2 43 312 2.0E-28
sp|A2QHV0|SEPH_ASPNC Cytokinesis protein sepH OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=sepH PE=3 SV=1 43 312 3.0E-28
sp|Q5B4Z3|SEPH_EMENI Cytokinesis protein sepH OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=sepH PE=3 SV=2 43 312 3.0E-28
sp|Q7ZYJ0|TAO1B_XENLA Serine/threonine-protein kinase TAO1-B OS=Xenopus laevis GN=taok1-b PE=2 SV=1 49 309 4.0E-28
sp|G5EGQ3|MAX2_CAEEL Serine/threonine-protein kinase max-2 OS=Caenorhabditis elegans GN=max-2 PE=1 SV=1 31 328 4.0E-28
sp|Q01389|BCK1_YEAST Serine/threonine-protein kinase BCK1/SLK1/SSP31 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BCK1 PE=1 SV=1 47 307 4.0E-28
sp|Q9HC98|NEK6_HUMAN Serine/threonine-protein kinase Nek6 OS=Homo sapiens GN=NEK6 PE=1 SV=2 21 304 5.0E-28
sp|Q54JG7|DST4_DICDI Serine/threonine-protein kinase dst4 OS=Dictyostelium discoideum GN=dst4 PE=3 SV=1 43 308 5.0E-28
sp|Q5F2E8|TAOK1_MOUSE Serine/threonine-protein kinase TAO1 OS=Mus musculus GN=Taok1 PE=1 SV=1 49 309 6.0E-28
sp|Q6DD27|TAOK3_XENLA Serine/threonine-protein kinase TAO3 OS=Xenopus laevis GN=taok3 PE=2 SV=1 49 309 7.0E-28
sp|O88664|TAOK1_RAT Serine/threonine-protein kinase TAO1 OS=Rattus norvegicus GN=Taok1 PE=1 SV=1 49 309 7.0E-28
sp|O14427|CLA4_CANAX Serine/threonine-protein kinase CLA4 OS=Candida albicans GN=CLA4 PE=3 SV=1 41 324 7.0E-28
sp|Q7L7X3|TAOK1_HUMAN Serine/threonine-protein kinase TAO1 OS=Homo sapiens GN=TAOK1 PE=1 SV=1 49 309 7.0E-28
sp|Q6BNF3|STE20_DEBHA Serine/threonine-protein kinase STE20 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=STE20 PE=3 SV=2 15 324 8.0E-28
sp|Q00532|CDKL1_HUMAN Cyclin-dependent kinase-like 1 OS=Homo sapiens GN=CDKL1 PE=1 SV=5 49 321 8.0E-28
sp|Q17850|PK1_CAEEL Serine/threonine-protein kinase pak-1 OS=Caenorhabditis elegans GN=pak-1 PE=1 SV=2 49 249 8.0E-28
sp|Q69ZM6|STK36_MOUSE Serine/threonine-protein kinase 36 OS=Mus musculus GN=Stk36 PE=1 SV=3 47 308 9.0E-28
sp|Q5APR8|CLA4_CANAL Serine/threonine-protein kinase CLA4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CLA4 PE=1 SV=1 41 324 9.0E-28
sp|Q6GPK9|TAOK2_XENLA Serine/threonine-protein kinase TAO2 OS=Xenopus laevis GN=taok2 PE=2 SV=1 49 308 1.0E-27
sp|Q56UN5|M3K19_HUMAN Mitogen-activated protein kinase kinase kinase 19 OS=Homo sapiens GN=MAP3K19 PE=2 SV=1 47 308 1.0E-27
sp|P53351|PLK2_MOUSE Serine/threonine-protein kinase PLK2 OS=Mus musculus GN=Plk2 PE=1 SV=1 43 309 1.0E-27
sp|Q9ES70|NEK6_MOUSE Serine/threonine-protein kinase Nek6 OS=Mus musculus GN=Nek6 PE=1 SV=1 21 304 1.0E-27
sp|Q9LT35|NEK6_ARATH Serine/threonine-protein kinase Nek6 OS=Arabidopsis thaliana GN=NEK6 PE=3 SV=1 47 308 1.0E-27
sp|P59895|NEK6_RAT Serine/threonine-protein kinase Nek6 OS=Rattus norvegicus GN=Nek6 PE=1 SV=1 21 304 2.0E-27
sp|Q9S7U9|M2K2_ARATH Mitogen-activated protein kinase kinase 2 OS=Arabidopsis thaliana GN=MKK2 PE=1 SV=2 47 308 3.0E-27
sp|Q8NEV4|MYO3A_HUMAN Myosin-IIIa OS=Homo sapiens GN=MYO3A PE=2 SV=2 45 308 3.0E-27
sp|Q9R012|PLK2_RAT Serine/threonine-protein kinase PLK2 OS=Rattus norvegicus GN=Plk2 PE=1 SV=1 43 309 3.0E-27
sp|Q60806|PLK3_MOUSE Serine/threonine-protein kinase PLK3 OS=Mus musculus GN=Plk3 PE=1 SV=2 47 319 3.0E-27
sp|Q9H4B4|PLK3_HUMAN Serine/threonine-protein kinase PLK3 OS=Homo sapiens GN=PLK3 PE=1 SV=2 38 319 4.0E-27
sp|D3ZBE5|NEK7_RAT Serine/threonine-protein kinase Nek7 OS=Rattus norvegicus GN=Nek7 PE=2 SV=1 43 304 4.0E-27
sp|Q5R4L1|PLK2_PONAB Serine/threonine-protein kinase PLK2 OS=Pongo abelii GN=PLK2 PE=3 SV=1 47 309 5.0E-27
sp|Q9NYY3|PLK2_HUMAN Serine/threonine-protein kinase PLK2 OS=Homo sapiens GN=PLK2 PE=1 SV=3 47 309 5.0E-27
sp|Q6NU21|TAO1A_XENLA Serine/threonine-protein kinase TAO1-A OS=Xenopus laevis GN=taok1-a PE=2 SV=1 49 298 5.0E-27
sp|Q9ES74|NEK7_MOUSE Serine/threonine-protein kinase Nek7 OS=Mus musculus GN=Nek7 PE=1 SV=1 43 304 5.0E-27
sp|Q6AXJ9|CDKL1_DANRE Cyclin-dependent kinase-like 1 OS=Danio rerio GN=cdkl1 PE=2 SV=1 49 308 5.0E-27
sp|P0CY23|STE20_CANAX Serine/threonine-protein kinase CST20 OS=Candida albicans GN=CST20 PE=3 SV=1 49 329 6.0E-27
sp|C4YRB7|STE20_CANAW Serine/threonine-protein kinase CST20 OS=Candida albicans (strain WO-1) GN=CST20 PE=3 SV=2 49 329 6.0E-27
sp|Q9R011|PLK3_RAT Serine/threonine-protein kinase PLK3 OS=Rattus norvegicus GN=Plk3 PE=1 SV=2 38 319 6.0E-27
sp|P0CY24|STE20_CANAL Serine/threonine-protein kinase CST20 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CST20 PE=3 SV=1 49 329 6.0E-27
sp|G5EEN4|GCK3_CAEEL Germinal center kinase 3 OS=Caenorhabditis elegans GN=gck-3 PE=1 SV=1 43 308 7.0E-27
sp|P70218|M4K1_MOUSE Mitogen-activated protein kinase kinase kinase kinase 1 OS=Mus musculus GN=Map4k1 PE=1 SV=1 45 305 1.0E-26
sp|Q54PX0|Y4251_DICDI Probable serine/threonine-protein kinase DDB_G0284251 OS=Dictyostelium discoideum GN=DDB_G0284251 PE=3 SV=1 43 312 1.0E-26
sp|Q5A3P6|PKH2_CANAL Serine/threonine-protein kinase PKH2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PKH2 PE=1 SV=1 32 309 1.0E-26
sp|Q03141|MARK3_MOUSE MAP/microtubule affinity-regulating kinase 3 OS=Mus musculus GN=Mark3 PE=1 SV=2 33 308 1.0E-26
sp|P41892|CDC7_SCHPO Cell division control protein 7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cdc7 PE=1 SV=1 40 312 1.0E-26
sp|Q8VHF0|MARK3_RAT MAP/microtubule affinity-regulating kinase 3 OS=Rattus norvegicus GN=Mark3 PE=1 SV=1 33 308 1.0E-26
sp|O64629|AUR3_ARATH Serine/threonine-protein kinase Aurora-3 OS=Arabidopsis thaliana GN=AUR3 PE=2 SV=1 34 308 2.0E-26
sp|Q10056|SHK2_SCHPO Serine/threonine-protein kinase shk2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=shk2 PE=3 SV=1 43 308 2.0E-26
sp|Q0WPH8|NEK5_ARATH Serine/threonine-protein kinase Nek5 OS=Arabidopsis thaliana GN=NEK5 PE=1 SV=1 43 308 2.0E-26
sp|P27448|MARK3_HUMAN MAP/microtubule affinity-regulating kinase 3 OS=Homo sapiens GN=MARK3 PE=1 SV=4 33 308 2.0E-26
sp|O74536|SNF1_SCHPO SNF1-like protein kinase ssp2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ssp2 PE=1 SV=1 34 437 3.0E-26
sp|Q8TDX7|NEK7_HUMAN Serine/threonine-protein kinase Nek7 OS=Homo sapiens GN=NEK7 PE=1 SV=1 43 304 3.0E-26
sp|Q54JQ1|MKCC_DICDI Probable serine/threonine-protein kinase mkcC OS=Dictyostelium discoideum GN=mkcC PE=3 SV=1 49 308 5.0E-26
sp|Q9CAD5|YODA_ARATH Mitogen-activated protein kinase kinase kinase YODA OS=Arabidopsis thaliana GN=YDA PE=1 SV=1 47 319 5.0E-26
sp|Q8CEQ0|CDKL1_MOUSE Cyclin-dependent kinase-like 1 OS=Mus musculus GN=Cdkl1 PE=2 SV=1 49 308 5.0E-26
sp|Q6ZQ29|TAOK2_MOUSE Serine/threonine-protein kinase TAO2 OS=Mus musculus GN=Taok2 PE=1 SV=3 49 310 5.0E-26
sp|Q94CU5|NEK5_ORYSJ Serine/threonine-protein kinase Nek5 OS=Oryza sativa subsp. japonica GN=NEK5 PE=3 SV=1 111 320 5.0E-26
sp|Q5QN75|M2K1_ORYSJ Mitogen-activated protein kinase kinase 1 OS=Oryza sativa subsp. japonica GN=MKK1 PE=1 SV=1 47 320 5.0E-26
sp|O22042|M3K3_ARATH Mitogen-activated protein kinase kinase kinase 3 OS=Arabidopsis thaliana GN=ANP3 PE=1 SV=1 47 308 8.0E-26
sp|Q9UL54|TAOK2_HUMAN Serine/threonine-protein kinase TAO2 OS=Homo sapiens GN=TAOK2 PE=1 SV=2 49 312 8.0E-26
sp|Q9JLS3|TAOK2_RAT Serine/threonine-protein kinase TAO2 OS=Rattus norvegicus GN=Taok2 PE=1 SV=1 49 310 9.0E-26
sp|Q55CA6|Y0146_DICDI Probable serine/threonine-protein kinase DDB_G0270146 OS=Dictyostelium discoideum GN=DDB_G0270146 PE=3 SV=1 43 308 1.0E-25
sp|Q39008|M3K1_ARATH Mitogen-activated protein kinase kinase kinase 1 OS=Arabidopsis thaliana GN=MEKK1 PE=1 SV=2 47 308 1.0E-25
sp|Q6FV07|IPL1_CANGA Spindle assembly checkpoint kinase OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=IPL1 PE=3 SV=1 43 312 1.0E-25
sp|P51957|NEK4_HUMAN Serine/threonine-protein kinase Nek4 OS=Homo sapiens GN=NEK4 PE=1 SV=2 48 308 1.0E-25
sp|Q5MAI5|CDKL4_HUMAN Cyclin-dependent kinase-like 4 OS=Homo sapiens GN=CDKL4 PE=2 SV=2 50 287 2.0E-25
sp|Q8SRF5|Y823_ENCCU Probable cell division protein kinase ECU08_0230 OS=Encephalitozoon cuniculi (strain GB-M1) GN=ECU08_0230 PE=3 SV=1 43 248 2.0E-25
sp|Q9TW45|PAR1_CAEEL Serine/threonine-protein kinase par-1 OS=Caenorhabditis elegans GN=par-1 PE=1 SV=1 43 302 2.0E-25
sp|Q2QAV0|TIO_ARATH Serine/threonine-protein kinase TIO OS=Arabidopsis thaliana GN=TIO PE=1 SV=1 47 312 2.0E-25
sp|A5GFW1|AURKA_PIG Aurora kinase A OS=Sus scrofa GN=AURKA PE=3 SV=1 43 308 2.0E-25
sp|P50528|PLO1_SCHPO Serine/threonine-protein kinase plo1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=plo1 PE=1 SV=1 49 311 2.0E-25
sp|Q9M077|AUR1_ARATH Serine/threonine-protein kinase Aurora-1 OS=Arabidopsis thaliana GN=AUR1 PE=1 SV=1 49 308 2.0E-25
sp|Q86HN7|PLK_DICDI Probable serine/threonine-protein kinase PLK OS=Dictyostelium discoideum GN=PLK PE=3 SV=1 47 308 2.0E-25
sp|Q21029|NSY1_CAEEL Mitogen-activated protein kinase kinase kinase nsy-1 OS=Caenorhabditis elegans GN=nsy-1 PE=1 SV=4 48 312 2.0E-25
sp|Q8K3H5|MYO3A_MOUSE Myosin-IIIa OS=Mus musculus GN=Myo3a PE=2 SV=1 47 308 3.0E-25
sp|Q2TA06|AURKA_BOVIN Aurora kinase A OS=Bos taurus GN=AURKA PE=2 SV=1 43 309 3.0E-25
sp|A8WYE4|PAR1_CAEBR Serine/threonine-protein kinase par-1 OS=Caenorhabditis briggsae GN=par-1 PE=3 SV=1 43 304 3.0E-25
sp|P08018|PBS2_YEAST MAP kinase kinase PBS2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PBS2 PE=1 SV=4 45 308 3.0E-25
sp|O14965|AURKA_HUMAN Aurora kinase A OS=Homo sapiens GN=AURKA PE=1 SV=2 43 308 3.0E-25
sp|P48562|CLA4_YEAST Serine/threonine-protein kinase CLA4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CLA4 PE=1 SV=1 43 310 4.0E-25
sp|Q6P4S6|SIK3_MOUSE Serine/threonine-protein kinase SIK3 OS=Mus musculus GN=Sik3 PE=1 SV=3 43 308 4.0E-25
sp|Q9Z1J2|NEK4_MOUSE Serine/threonine-protein kinase Nek4 OS=Mus musculus GN=Nek4 PE=1 SV=1 48 308 5.0E-25
sp|Q9Y2K2|SIK3_HUMAN Serine/threonine-protein kinase SIK3 OS=Homo sapiens GN=SIK3 PE=1 SV=3 43 308 5.0E-25
sp|Q66HE7|CDKL1_RAT Cyclin-dependent kinase-like 1 OS=Rattus norvegicus GN=Cdkl1 PE=2 SV=1 49 308 5.0E-25
sp|P97477|AURKA_MOUSE Aurora kinase A OS=Mus musculus GN=Aurka PE=1 SV=1 21 308 6.0E-25
sp|Q05512|MARK2_MOUSE Serine/threonine-protein kinase MARK2 OS=Mus musculus GN=Mark2 PE=1 SV=3 43 304 6.0E-25
sp|Q7KZI7|MARK2_HUMAN Serine/threonine-protein kinase MARK2 OS=Homo sapiens GN=MARK2 PE=1 SV=2 43 304 6.0E-25
sp|Q54DC8|Y2350_DICDI Probable serine/threonine-protein kinase DDB_G0292350 OS=Dictyostelium discoideum GN=DDB_G0292350 PE=3 SV=1 36 308 7.0E-25
sp|Q6C3J2|IPL1_YARLI Spindle assembly checkpoint kinase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=IPL1 PE=3 SV=1 43 308 7.0E-25
sp|Q9QYZ3|SMK2B_MOUSE Sperm motility kinase 2B OS=Mus musculus GN=Smok2b PE=2 SV=1 43 308 7.0E-25
sp|O08679|MARK2_RAT Serine/threonine-protein kinase MARK2 OS=Rattus norvegicus GN=Mark2 PE=1 SV=1 43 304 7.0E-25
sp|Q683C9|AUR2_ARATH Serine/threonine-protein kinase Aurora-2 OS=Arabidopsis thaliana GN=AUR2 PE=2 SV=2 30 308 8.0E-25
sp|Q755C4|IPL1_ASHGO Spindle assembly checkpoint kinase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=IPL1 PE=3 SV=1 43 308 8.0E-25
sp|Q8BLF2|CDKL3_MOUSE Cyclin-dependent kinase-like 3 OS=Mus musculus GN=Cdkl3 PE=2 SV=2 49 248 1.0E-24
sp|Q9FZ36|M3K2_ARATH Mitogen-activated protein kinase kinase kinase 2 OS=Arabidopsis thaliana GN=ANP2 PE=2 SV=1 47 312 1.0E-24
sp|Q3TZA2|CDKL4_MOUSE Cyclin-dependent kinase-like 4 OS=Mus musculus GN=Cdkl4 PE=2 SV=1 49 271 1.0E-24
sp|Q9QYZ5|SMK3_MOUSE Sperm motility kinase 3 OS=Mus musculus GN=Smok3a PE=2 SV=1 43 308 1.0E-24
sp|P22987|KIN1_SCHPO Protein kinase kin1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=kin1 PE=1 SV=3 43 309 1.0E-24
sp|P28829|BYR2_SCHPO Protein kinase byr2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=byr2 PE=1 SV=1 48 308 2.0E-24
sp|Q9P0L2|MARK1_HUMAN Serine/threonine-protein kinase MARK1 OS=Homo sapiens GN=MARK1 PE=1 SV=2 43 292 2.0E-24
sp|Q8CIP4|MARK4_MOUSE MAP/microtubule affinity-regulating kinase 4 OS=Mus musculus GN=Mark4 PE=1 SV=1 43 308 2.0E-24
sp|Q96L34|MARK4_HUMAN MAP/microtubule affinity-regulating kinase 4 OS=Homo sapiens GN=MARK4 PE=1 SV=1 43 308 2.0E-24
sp|Q60DG4|NEK4_ORYSJ Serine/threonine-protein kinase Nek4 OS=Oryza sativa subsp. japonica GN=NEK4 PE=2 SV=1 111 308 2.0E-24
sp|P59241|AURKA_RAT Aurora kinase A OS=Rattus norvegicus GN=Aurka PE=1 SV=1 43 308 2.0E-24
sp|Q8VHJ5|MARK1_MOUSE Serine/threonine-protein kinase MARK1 OS=Mus musculus GN=Mark1 PE=1 SV=2 43 292 2.0E-24
sp|Q5Z6X0|CIPKP_ORYSJ CBL-interacting protein kinase 25 OS=Oryza sativa subsp. japonica GN=CIPK25 PE=2 SV=1 48 304 2.0E-24
sp|Q14680|MELK_HUMAN Maternal embryonic leucine zipper kinase OS=Homo sapiens GN=MELK PE=1 SV=3 43 318 2.0E-24
sp|Q753D9|PKH3_ASHGO Serine/threonine-protein kinase PKH3 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=PKH3 PE=3 SV=1 43 308 3.0E-24
sp|Q1ZXC8|PXI_DICDI Probable serine/threonine-protein kinase pXi OS=Dictyostelium discoideum GN=pXi PE=2 SV=1 49 311 3.0E-24
sp|Q9Y2U5|M3K2_HUMAN Mitogen-activated protein kinase kinase kinase 2 OS=Homo sapiens GN=MAP3K2 PE=1 SV=2 38 249 3.0E-24
sp|P54644|KRAC_DICDI RAC family serine/threonine-protein kinase homolog OS=Dictyostelium discoideum GN=pkbA PE=1 SV=1 7 249 3.0E-24
sp|O08678|MARK1_RAT Serine/threonine-protein kinase MARK1 OS=Rattus norvegicus GN=Mark1 PE=1 SV=1 43 277 3.0E-24
sp|Q40541|NPK1_TOBAC Mitogen-activated protein kinase kinase kinase NPK1 OS=Nicotiana tabacum GN=NPK1 PE=1 SV=1 47 308 3.0E-24
sp|Q2QMH1|NEK2_ORYSJ Serine/threonine-protein kinase Nek2 OS=Oryza sativa subsp. japonica GN=NEK2 PE=2 SV=1 121 314 3.0E-24
sp|Q9CAU7|NEK2_ARATH Serine/threonine-protein kinase Nek2 OS=Arabidopsis thaliana GN=NEK2 PE=2 SV=1 47 314 3.0E-24
sp|A2ZMH2|NEK2_ORYSI Serine/threonine-protein kinase Nek2 OS=Oryza sativa subsp. indica GN=NEK2 PE=3 SV=1 121 314 4.0E-24
sp|Q5XIT0|CDKL2_RAT Cyclin-dependent kinase-like 2 OS=Rattus norvegicus GN=Cdkl2 PE=2 SV=1 48 271 4.0E-24
sp|Q9JM01|CDKL3_RAT Cyclin-dependent kinase-like 3 OS=Rattus norvegicus GN=Cdkl3 PE=2 SV=2 49 248 4.0E-24
sp|Q9HFW2|CLA4_ASHGO Serine/threonine-protein kinase CLA4 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=CLA4 PE=3 SV=1 40 324 4.0E-24
sp|Q9QUK0|CDKL2_MOUSE Cyclin-dependent kinase-like 2 OS=Mus musculus GN=Cdkl2 PE=2 SV=1 48 271 5.0E-24
sp|P49025|CTRO_MOUSE Citron Rho-interacting kinase OS=Mus musculus GN=Cit PE=1 SV=3 39 266 5.0E-24
sp|Q91821|MELK_XENLA Maternal embryonic leucine zipper kinase OS=Xenopus laevis GN=melk PE=1 SV=2 43 317 5.0E-24
sp|Q6X4A2|CIPKV_ORYSJ CBL-interacting protein kinase 31 OS=Oryza sativa subsp. japonica GN=CIPK31 PE=1 SV=1 38 308 5.0E-24
sp|O59790|ARK1_SCHPO Serine/threonine-protein kinase ark1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ark1 PE=1 SV=2 43 308 7.0E-24
sp|O22040|ANP1_ARATH Mitogen-activated protein kinase kinase kinase ANP1 OS=Arabidopsis thaliana GN=ANP1 PE=1 SV=2 47 309 7.0E-24
sp|Q9QYZ6|SMK2A_MOUSE Sperm motility kinase 2A OS=Mus musculus GN=Smok2a PE=2 SV=1 38 308 7.0E-24
sp|Q10407|MKH1_SCHPO MAP kinase kinase kinase mkh1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mkh1 PE=3 SV=1 47 308 8.0E-24
sp|Q91820|AURAA_XENLA Aurora kinase A-A OS=Xenopus laevis GN=aurka-a PE=1 SV=1 14 320 8.0E-24
sp|Q4R8T9|CDKL3_MACFA Cyclin-dependent kinase-like 3 OS=Macaca fascicularis GN=CDKL3 PE=2 SV=1 49 248 9.0E-24
sp|Q10SC8|CIPK9_ORYSJ CBL-interacting protein kinase 9 OS=Oryza sativa subsp. japonica GN=CIPK9 PE=2 SV=1 30 304 1.0E-23
sp|Q54WJ0|STK11_DICDI Serine/threonine-protein kinase stk11 homolog OS=Dictyostelium discoideum GN=lkb1 PE=3 SV=1 43 307 1.0E-23
sp|Q6YY75|NEK6_ORYSJ Serine/threonine-protein kinase Nek6 OS=Oryza sativa subsp. japonica GN=NEK6 PE=3 SV=2 47 308 1.0E-23
sp|P32562|CDC5_YEAST Cell cycle serine/threonine-protein kinase CDC5/MSD2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC5 PE=1 SV=1 47 311 1.0E-23
sp|Q6BVA0|IPL1_DEBHA Spindle assembly checkpoint kinase OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=IPL1 PE=3 SV=2 43 319 1.0E-23
sp|Q23915|KINX_DICDI Probable serine/threonine-protein kinase kinX OS=Dictyostelium discoideum GN=kinX PE=3 SV=2 49 350 2.0E-23
sp|Q8IVW4|CDKL3_HUMAN Cyclin-dependent kinase-like 3 OS=Homo sapiens GN=CDKL3 PE=1 SV=1 49 248 2.0E-23
sp|O14578|CTRO_HUMAN Citron Rho-interacting kinase OS=Homo sapiens GN=CIT PE=1 SV=2 39 266 2.0E-23
sp|P45894|AAPK1_CAEEL 5'-AMP-activated protein kinase catalytic subunit alpha-1 OS=Caenorhabditis elegans GN=aak-1 PE=2 SV=2 43 315 2.0E-23
sp|Q86I06|NEK3_DICDI Probable serine/threonine-protein kinase nek3 OS=Dictyostelium discoideum GN=nek3 PE=3 SV=1 49 318 2.0E-23
sp|Q64702|PLK4_MOUSE Serine/threonine-protein kinase PLK4 OS=Mus musculus GN=Plk4 PE=1 SV=2 34 308 2.0E-23
sp|B0WAU8|PLK4_CULQU Serine/threonine-protein kinase PLK4 OS=Culex quinquefasciatus GN=SAK PE=3 SV=1 35 308 2.0E-23
sp|Q13131|AAPK1_HUMAN 5'-AMP-activated protein kinase catalytic subunit alpha-1 OS=Homo sapiens GN=PRKAA1 PE=1 SV=4 20 308 2.0E-23
sp|Q9N0X0|AURKB_PIG Aurora kinase B OS=Sus scrofa GN=AURKB PE=2 SV=2 43 308 2.0E-23
sp|Q5RDH5|AAPK1_PONAB 5'-AMP-activated protein kinase catalytic subunit alpha-1 (Fragment) OS=Pongo abelii GN=PRKAA1 PE=2 SV=2 43 308 2.0E-23
sp|P54645|AAPK1_RAT 5'-AMP-activated protein kinase catalytic subunit alpha-1 OS=Rattus norvegicus GN=Prkaa1 PE=1 SV=2 20 308 2.0E-23
sp|Q96PY6|NEK1_HUMAN Serine/threonine-protein kinase Nek1 OS=Homo sapiens GN=NEK1 PE=1 SV=2 43 308 2.0E-23
sp|Q6CWQ4|IPL1_KLULA Spindle assembly checkpoint kinase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=IPL1 PE=3 SV=1 43 312 2.0E-23
sp|Q8RWL2|CDPKT_ARATH Calcium-dependent protein kinase 29 OS=Arabidopsis thaliana GN=CPK29 PE=2 SV=2 43 313 3.0E-23
sp|Q9QYZ4|SMOK1_MOUSE Sperm motility kinase 1 OS=Mus musculus GN=Smok1 PE=2 SV=1 43 308 3.0E-23
sp|Q12469|SKM1_YEAST Serine/threonine-protein kinase SKM1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SKM1 PE=1 SV=1 41 249 3.0E-23
sp|P51954|NEK1_MOUSE Serine/threonine-protein kinase Nek1 OS=Mus musculus GN=Nek1 PE=1 SV=2 43 308 3.0E-23
sp|Q92772|CDKL2_HUMAN Cyclin-dependent kinase-like 2 OS=Homo sapiens GN=CDKL2 PE=1 SV=1 48 271 3.0E-23
sp|Q9TTK0|CDKL2_RABIT Cyclin-dependent kinase-like 2 OS=Oryctolagus cuniculus GN=CDKL2 PE=2 SV=1 48 271 4.0E-23
sp|Q9UQB9|AURKC_HUMAN Aurora kinase C OS=Homo sapiens GN=AURKC PE=1 SV=1 43 308 4.0E-23
sp|Q5R754|CDKL2_PONAB Cyclin-dependent kinase-like 2 OS=Pongo abelii GN=CDKL2 PE=2 SV=1 48 271 4.0E-23
sp|Q4R7T5|CDKL2_MACFA Cyclin-dependent kinase-like 2 OS=Macaca fascicularis GN=CDKL2 PE=2 SV=1 48 271 4.0E-23
sp|Q54R82|MKKA_DICDI Mitogen-activated protein kinase kinase kinase A OS=Dictyostelium discoideum GN=mkkA PE=1 SV=2 47 310 4.0E-23
sp|Q59W62|GIN4_CANAL Serine/threonine-protein kinase GIN4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=GIN4 PE=1 SV=1 42 328 5.0E-23
sp|Q61083|M3K2_MOUSE Mitogen-activated protein kinase kinase kinase 2 OS=Mus musculus GN=Map3k2 PE=1 SV=2 38 249 5.0E-23
sp|A1A5Q6|SMK_RAT Sperm motility kinase OS=Rattus norvegicus GN=Smok PE=2 SV=1 49 310 5.0E-23
sp|Q9ZSA2|CDPKL_ARATH Calcium-dependent protein kinase 21 OS=Arabidopsis thaliana GN=CPK21 PE=1 SV=1 43 308 5.0E-23
sp|A2VDZ4|PLK4_BOVIN Serine/threonine-protein kinase PLK4 OS=Bos taurus GN=PLK4 PE=2 SV=1 37 308 5.0E-23
sp|Q55DD4|PAKD_DICDI Serine/threonine-protein kinase pakD OS=Dictyostelium discoideum GN=pakD PE=3 SV=1 43 308 6.0E-23
sp|O60285|NUAK1_HUMAN NUAK family SNF1-like kinase 1 OS=Homo sapiens GN=NUAK1 PE=1 SV=1 43 308 6.0E-23
sp|Q28GW8|MELK_XENTR Maternal embryonic leucine zipper kinase OS=Xenopus tropicalis GN=melk PE=2 SV=1 43 317 6.0E-23
sp|Q55FT4|TSUA_DICDI Probable serine/threonine-protein kinase tsuA OS=Dictyostelium discoideum GN=tsuA PE=1 SV=1 49 258 7.0E-23
sp|Q641K5|NUAK1_MOUSE NUAK family SNF1-like kinase 1 OS=Mus musculus GN=Nuak1 PE=1 SV=1 43 308 8.0E-23
sp|B2GUY1|PLK4_RAT Serine/threonine-protein kinase PLK4 OS=Rattus norvegicus GN=Plk4 PE=2 SV=1 34 308 8.0E-23
sp|Q91819|AURAB_XENLA Aurora kinase A-B OS=Xenopus laevis GN=aurka-b PE=2 SV=3 15 311 9.0E-23
sp|Q93V58|GRIK1_ARATH Serine/threonine-protein kinase GRIK1 OS=Arabidopsis thaliana GN=GRIK1 PE=1 SV=1 35 308 9.0E-23
sp|O15075|DCLK1_HUMAN Serine/threonine-protein kinase DCLK1 OS=Homo sapiens GN=DCLK1 PE=1 SV=2 49 308 9.0E-23
sp|Q9FJV0|M2K6_ARATH Mitogen-activated protein kinase kinase 6 OS=Arabidopsis thaliana GN=MKK6 PE=1 SV=1 47 308 1.0E-22
sp|Q5EG47|AAPK1_MOUSE 5'-AMP-activated protein kinase catalytic subunit alpha-1 OS=Mus musculus GN=Prkaa1 PE=1 SV=2 20 308 1.0E-22
sp|Q54EY4|DST3_DICDI Serine/threonine-protein kinase dst3 OS=Dictyostelium discoideum GN=dst3 PE=3 SV=1 43 309 1.0E-22
sp|Q8C0X8|SMKX_MOUSE Sperm motility kinase X OS=Mus musculus PE=2 SV=1 49 302 1.0E-22
sp|O01427|AIR2_CAEEL Aurora/IPL1-related protein kinase 2 OS=Caenorhabditis elegans GN=air-2 PE=1 SV=2 43 308 1.0E-22
sp|P28582|CDPK_DAUCA Calcium-dependent protein kinase OS=Daucus carota PE=2 SV=2 42 308 1.0E-22
sp|Q99759|M3K3_HUMAN Mitogen-activated protein kinase kinase kinase 3 OS=Homo sapiens GN=MAP3K3 PE=1 SV=2 47 249 1.0E-22
sp|A7SNN5|PLK4_NEMVE Serine/threonine-protein kinase PLK4 OS=Nematostella vectensis GN=v1g246408 PE=3 SV=1 43 323 1.0E-22
sp|Q02723|RKIN1_SECCE Carbon catabolite-derepressing protein kinase OS=Secale cereale GN=RKIN1 PE=2 SV=1 39 315 1.0E-22
sp|Q4FZD7|PLK5_MOUSE Inactive serine/threonine-protein kinase PLK5 OS=Mus musculus GN=Plk5 PE=1 SV=1 47 299 1.0E-22
sp|P51955|NEK2_HUMAN Serine/threonine-protein kinase Nek2 OS=Homo sapiens GN=NEK2 PE=1 SV=1 49 308 1.0E-22
sp|Q12152|YP150_YEAST Putative serine/threonine-protein kinase YPL150W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPL150W PE=1 SV=1 49 308 1.0E-22
sp|P33886|WIS1_SCHPO Protein kinase wis1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=wis1 PE=1 SV=1 47 312 1.0E-22
sp|P10676|NINAC_DROME Neither inactivation nor afterpotential protein C OS=Drosophila melanogaster GN=ninaC PE=1 SV=2 43 308 1.0E-22
sp|O35942|NEK2_MOUSE Serine/threonine-protein kinase Nek2 OS=Mus musculus GN=Nek2 PE=1 SV=2 49 308 2.0E-22
sp|P46549|SULU_CAEEL Serine/threonine-protein kinase SULU OS=Caenorhabditis elegans GN=kin-18 PE=2 SV=1 49 249 2.0E-22
sp|O55099|AURKB_RAT Aurora kinase B OS=Rattus norvegicus GN=Aurkb PE=1 SV=1 42 308 2.0E-22
sp|Q9SLI2|NEK1_ARATH Serine/threonine-protein kinase Nek1 OS=Arabidopsis thaliana GN=NEK1 PE=2 SV=2 47 314 2.0E-22
sp|Q5R9Z7|PLK4_PONAB Serine/threonine-protein kinase PLK4 OS=Pongo abelii GN=PLK4 PE=2 SV=1 37 308 2.0E-22
sp|Q94CG0|CIPKL_ARATH CBL-interacting serine/threonine-protein kinase 21 OS=Arabidopsis thaliana GN=CIPK21 PE=1 SV=1 49 302 2.0E-22
sp|O00444|PLK4_HUMAN Serine/threonine-protein kinase PLK4 OS=Homo sapiens GN=PLK4 PE=1 SV=3 37 308 2.0E-22
sp|Q10GB1|NEK1_ORYSJ Serine/threonine-protein kinase Nek1 OS=Oryza sativa subsp. japonica GN=NEK1 PE=3 SV=1 121 314 2.0E-22
sp|Q54VI1|FHKE_DICDI Probable serine/threonine-protein kinase fhkE OS=Dictyostelium discoideum GN=fhkE PE=3 SV=1 10 314 3.0E-22
sp|Q6NSM8|SIK3_DANRE Serine/threonine-protein kinase SIK3 homolog OS=Danio rerio GN=zgc:66101 PE=2 SV=1 43 302 3.0E-22
sp|O81472|MP3K2_ARATH Mitogen-activated protein kinase kinase kinase 9 OS=Arabidopsis thaliana GN=MEKK2 PE=1 SV=1 33 308 3.0E-22
sp|Q8SWM6|CDC5_ENCCU Probable cell cycle serine/threonine-protein kinase CDC5 homolog OS=Encephalitozoon cuniculi (strain GB-M1) GN=CDC5 PE=3 SV=2 42 308 3.0E-22
sp|Q61084|M3K3_MOUSE Mitogen-activated protein kinase kinase kinase 3 OS=Mus musculus GN=Map3k3 PE=1 SV=1 47 249 3.0E-22
sp|Q8RXT4|NEK4_ARATH Serine/threonine-protein kinase Nek4 OS=Arabidopsis thaliana GN=NEK4 PE=2 SV=1 121 308 3.0E-22
sp|O70126|AURKB_MOUSE Aurora kinase B OS=Mus musculus GN=Aurkb PE=1 SV=2 42 308 3.0E-22
sp|Q55EC7|GEFX_DICDI RasGEF domain-containing serine/threonine-protein kinase X OS=Dictyostelium discoideum GN=gefX PE=2 SV=1 45 249 3.0E-22
sp|Q12236|PKH2_YEAST Serine/threonine-protein kinase PKH2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PKH2 PE=1 SV=1 25 308 4.0E-22
sp|Q869X3|Y9851_DICDI Probable serine/threonine-protein kinase DDB_G0275165 OS=Dictyostelium discoideum GN=DDB_G0275165 PE=3 SV=1 48 245 4.0E-22
sp|O88445|AURKC_MOUSE Aurora kinase C OS=Mus musculus GN=Aurkc PE=1 SV=1 43 308 4.0E-22
sp|G5EFU0|PK2_CAEEL Serine/threonine-protein kinase pak-2 OS=Caenorhabditis elegans GN=pak-2 PE=2 SV=1 49 312 4.0E-22
sp|Q5RD00|AAPK2_PONAB 5'-AMP-activated protein kinase catalytic subunit alpha-2 OS=Pongo abelii GN=PRKAA2 PE=2 SV=1 43 308 4.0E-22
sp|Q38873|CDPK7_ARATH Calcium-dependent protein kinase 7 OS=Arabidopsis thaliana GN=CPK7 PE=2 SV=1 49 326 5.0E-22
sp|Q61XD3|AIR2_CAEBR Aurora/IPL1-related protein kinase 2 OS=Caenorhabditis briggsae GN=air-2 PE=3 SV=1 43 308 5.0E-22
sp|Q8RX66|NEK3_ARATH Serine/threonine-protein kinase Nek3 OS=Arabidopsis thaliana GN=NEK3 PE=2 SV=1 47 308 5.0E-22
sp|P22216|RAD53_YEAST Serine/threonine-protein kinase RAD53 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RAD53 PE=1 SV=1 44 308 5.0E-22
sp|Q54XJ4|Y8901_DICDI Probable serine/threonine-protein kinase DDB_G0278901 OS=Dictyostelium discoideum GN=DDB_G0278901 PE=3 SV=1 43 316 6.0E-22
sp|Q59S66|IPL1_CANAL Spindle assembly checkpoint kinase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=IPL1 PE=3 SV=1 43 316 6.0E-22
sp|Q62862|MP2K5_RAT Dual specificity mitogen-activated protein kinase kinase 5 OS=Rattus norvegicus GN=Map2k5 PE=1 SV=1 49 310 7.0E-22
sp|F4JY37|RUK_ARATH Serine/threonine-protein kinase RUNKEL OS=Arabidopsis thaliana GN=RUK PE=1 SV=1 47 307 7.0E-22
sp|Q54WW7|Y0010_DICDI Probable serine/threonine-protein kinase DDB_G0279405 OS=Dictyostelium discoideum GN=DDB_G0279405 PE=3 SV=1 14 324 8.0E-22
sp|O14098|CTK1_SCHPO CTD kinase subunit alpha OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=lsk1 PE=1 SV=1 49 248 9.0E-22
sp|P54646|AAPK2_HUMAN 5'-AMP-activated protein kinase catalytic subunit alpha-2 OS=Homo sapiens GN=PRKAA2 PE=1 SV=2 43 308 1.0E-21
sp|Q6DE08|AUKBA_XENLA Aurora kinase B-A OS=Xenopus laevis GN=aurkb-a PE=1 SV=1 43 308 1.0E-21
sp|Q13163|MP2K5_HUMAN Dual specificity mitogen-activated protein kinase kinase 5 OS=Homo sapiens GN=MAP2K5 PE=1 SV=2 23 310 1.0E-21
sp|Q28948|AAPK2_PIG 5'-AMP-activated protein kinase catalytic subunit alpha-2 OS=Sus scrofa GN=PRKAA2 PE=2 SV=2 43 308 1.0E-21
sp|Q9VKN7|AURKB_DROME Aurora kinase B OS=Drosophila melanogaster GN=ial PE=1 SV=1 43 308 1.0E-21
sp|O94168|SNF1_CANTR Carbon catabolite-derepressing protein kinase OS=Candida tropicalis GN=SNF1 PE=3 SV=1 49 304 1.0E-21
sp|O49717|CDPKF_ARATH Calcium-dependent protein kinase 15 OS=Arabidopsis thaliana GN=CPK15 PE=2 SV=1 43 308 1.0E-21
sp|Q03306|PKH3_YEAST Serine/threonine-protein kinase PKH3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PKH3 PE=1 SV=1 38 338 1.0E-21
sp|Q86UX6|ST32C_HUMAN Serine/threonine-protein kinase 32C OS=Homo sapiens GN=STK32C PE=1 SV=1 43 270 1.0E-21
sp|Q9H0K1|SIK2_HUMAN Serine/threonine-protein kinase SIK2 OS=Homo sapiens GN=SIK2 PE=1 SV=1 49 309 1.0E-21
sp|Q09137|AAPK2_RAT 5'-AMP-activated protein kinase catalytic subunit alpha-2 OS=Rattus norvegicus GN=Prkaa2 PE=1 SV=1 43 308 1.0E-21
sp|Q7XIW5|CIPKT_ORYSJ CBL-interacting protein kinase 29 OS=Oryza sativa subsp. japonica GN=CIPK29 PE=2 SV=1 43 308 1.0E-21
sp|Q5HZ38|GRIK2_ARATH Serine/threonine-protein kinase GRIK2 OS=Arabidopsis thaliana GN=GRIK2 PE=1 SV=1 49 356 2.0E-21
sp|Q9NGW9|MKCB_DICDI Probable serine/threonine-protein kinase mkcB OS=Dictyostelium discoideum GN=mkcB PE=2 SV=1 49 320 2.0E-21
sp|Q9WVS7|MP2K5_MOUSE Dual specificity mitogen-activated protein kinase kinase 5 OS=Mus musculus GN=Map2k5 PE=1 SV=1 49 310 2.0E-21
sp|Q61846|MELK_MOUSE Maternal embryonic leucine zipper kinase OS=Mus musculus GN=Melk PE=1 SV=2 43 249 2.0E-21
sp|Q8CFH6|SIK2_MOUSE Serine/threonine-protein kinase SIK2 OS=Mus musculus GN=Sik2 PE=1 SV=1 49 309 2.0E-21
sp|B4IMC3|DCLK_DROSE Serine/threonine-protein kinase GM11705 OS=Drosophila sechellia GN=GM11705 PE=3 SV=1 43 312 2.0E-21
sp|O08875|DCLK1_RAT Serine/threonine-protein kinase DCLK1 OS=Rattus norvegicus GN=Dclk1 PE=1 SV=1 49 308 2.0E-21
sp|B4NSS9|DCLK_DROSI Serine/threonine-protein kinase GD17699 OS=Drosophila simulans GN=GD17699 PE=3 SV=1 43 312 2.0E-21
sp|P27466|KCC1_YEAST Calcium/calmodulin-dependent protein kinase I OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CMK1 PE=1 SV=2 43 314 2.0E-21
sp|Q9N2L7|PLK2_CAEEL Serine/threonine-protein kinase plk-2 OS=Caenorhabditis elegans GN=plk-2 PE=2 SV=1 23 256 2.0E-21
sp|A4IGM9|AURKB_XENTR Aurora kinase B OS=Xenopus tropicalis GN=aurkb PE=2 SV=1 1 308 2.0E-21
sp|Q8BRK8|AAPK2_MOUSE 5'-AMP-activated protein kinase catalytic subunit alpha-2 OS=Mus musculus GN=Prkaa2 PE=1 SV=3 43 308 2.0E-21
sp|P53683|CDPK2_ORYSJ Calcium-dependent protein kinase isoform 2 OS=Oryza sativa subsp. japonica GN=CPK2 PE=2 SV=2 43 308 2.0E-21
sp|P52497|SNF1_CANAX Carbon catabolite-derepressing protein kinase OS=Candida albicans GN=SNF1 PE=2 SV=2 49 304 2.0E-21
sp|U4PR86|MELK_CAEEL Maternal embryonic leucine zipper kinase OS=Caenorhabditis elegans GN=pig-1 PE=1 SV=1 44 318 2.0E-21
sp|Q8QFP8|LIMK1_CHICK LIM domain kinase 1 OS=Gallus gallus GN=LIMK1 PE=1 SV=1 43 333 2.0E-21
sp|G4SLH0|TTN1_CAEEL Titin homolog OS=Caenorhabditis elegans GN=ttn-1 PE=1 SV=2 43 308 3.0E-21
sp|Q9JLM8|DCLK1_MOUSE Serine/threonine-protein kinase DCLK1 OS=Mus musculus GN=Dclk1 PE=1 SV=1 26 308 3.0E-21
sp|Q8MYF1|Y2070_DICDI Probable serine/threonine-protein kinase DDB_G0277449 OS=Dictyostelium discoideum GN=DDB_G0277449 PE=3 SV=1 43 314 3.0E-21
sp|Q13233|M3K1_HUMAN Mitogen-activated protein kinase kinase kinase 1 OS=Homo sapiens GN=MAP3K1 PE=1 SV=4 49 311 3.0E-21
sp|P92199|ROCK_CAEEL Rho-associated protein kinase let-502 OS=Caenorhabditis elegans GN=let-502 PE=1 SV=1 40 312 3.0E-21
sp|Q5ZKN1|CDK9_CHICK Cyclin-dependent kinase 9 OS=Gallus gallus GN=CDK9 PE=2 SV=1 49 248 3.0E-21
sp|Q8C0V7|SMKW_MOUSE Putative sperm motility kinase W OS=Mus musculus GN=Stk-ps2 PE=5 SV=2 49 316 3.0E-21
sp|A8X775|DLK1_CAEBR Mitogen-activated protein kinase kinase kinase dlk-1 OS=Caenorhabditis briggsae GN=dlk-1 PE=3 SV=1 47 313 4.0E-21
sp|Q8AYG3|TTK_DANRE Dual specificity protein kinase Ttk OS=Danio rerio GN=ttk PE=1 SV=2 43 308 4.0E-21
sp|O08605|MKNK1_MOUSE MAP kinase-interacting serine/threonine-protein kinase 1 OS=Mus musculus GN=Mknk1 PE=1 SV=2 47 308 4.0E-21
sp|P28178|PK2_DICDI Protein kinase 2 OS=Dictyostelium discoideum GN=pkgB PE=1 SV=2 43 258 4.0E-21
sp|Q4V862|CDK9A_XENLA Cyclin-dependent kinase 9-A OS=Xenopus laevis GN=cdk9-a PE=2 SV=1 49 248 4.0E-21
sp|A0AUV4|SMKY_MOUSE Sperm motility kinase Y OS=Mus musculus GN=Gm7168 PE=2 SV=1 49 308 4.0E-21
sp|Q6GLD8|CDK9_XENTR Cyclin-dependent kinase 9 OS=Xenopus tropicalis GN=cdk9 PE=2 SV=1 49 248 4.0E-21
sp|Q7YRC6|AURKB_BOVIN Aurora kinase B OS=Bos taurus GN=AURKB PE=2 SV=1 43 308 4.0E-21
sp|O01700|DLK1_CAEEL Mitogen-activated protein kinase kinase kinase dlk-1 OS=Caenorhabditis elegans GN=dlk-1 PE=1 SV=4 47 313 4.0E-21
sp|Q7ZZC8|NEK9_XENLA Serine/threonine-protein kinase Nek9 OS=Xenopus laevis GN=nek9 PE=2 SV=1 92 308 4.0E-21
sp|Q66HE5|NUAK2_RAT NUAK family SNF1-like kinase 2 OS=Rattus norvegicus GN=Nuak2 PE=1 SV=1 47 308 5.0E-21
sp|Q8BW96|KCC1D_MOUSE Calcium/calmodulin-dependent protein kinase type 1D OS=Mus musculus GN=Camk1d PE=1 SV=2 43 411 5.0E-21
sp|A0JLX3|SMK4A_MOUSE Sperm motility kinase 4A OS=Mus musculus GN=Smok4a PE=2 SV=2 43 308 5.0E-21
sp|P23647|FUSED_DROME Serine/threonine-protein kinase fused OS=Drosophila melanogaster GN=fu PE=1 SV=2 43 258 5.0E-21
sp|Q16W24|PLK4_AEDAE Serine/threonine-protein kinase PLK4 OS=Aedes aegypti GN=SAK PE=3 SV=1 47 308 5.0E-21
sp|P06244|KAPA_YEAST cAMP-dependent protein kinase type 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPK1 PE=1 SV=3 21 284 5.0E-21
sp|A8X6H4|CMK1_CAEBR Calcium/calmodulin-dependent protein kinase type 1 OS=Caenorhabditis briggsae GN=cmk-1 PE=3 SV=3 47 308 5.0E-21
sp|Q38997|KIN10_ARATH SNF1-related protein kinase catalytic subunit alpha KIN10 OS=Arabidopsis thaliana GN=KIN10 PE=1 SV=2 41 315 6.0E-21
sp|P53349|M3K1_MOUSE Mitogen-activated protein kinase kinase kinase 1 OS=Mus musculus GN=Map3k1 PE=1 SV=3 49 311 6.0E-21
sp|A3B529|CIPKS_ORYSJ CBL-interacting protein kinase 28 OS=Oryza sativa subsp. japonica GN=CIPK28 PE=2 SV=2 43 303 6.0E-21
sp|Q4V7Q6|ULK3_XENLA Serine/threonine-protein kinase ULK3 OS=Xenopus laevis GN=ulk3 PE=2 SV=1 40 258 6.0E-21
sp|Q9C6P3|CDPKX_ARATH Calcium-dependent protein kinase 33 OS=Arabidopsis thaliana GN=CPK33 PE=2 SV=1 43 308 6.0E-21
sp|A8WVU9|ROCK_CAEBR Rho-associated protein kinase let-502 OS=Caenorhabditis briggsae GN=let-502 PE=3 SV=2 40 255 6.0E-21
sp|Q8TD19|NEK9_HUMAN Serine/threonine-protein kinase Nek9 OS=Homo sapiens GN=NEK9 PE=1 SV=2 43 308 6.0E-21
sp|Q03407|PKH1_YEAST Serine/threonine-protein kinase PKH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PKH1 PE=1 SV=1 43 308 7.0E-21
sp|O75116|ROCK2_HUMAN Rho-associated protein kinase 2 OS=Homo sapiens GN=ROCK2 PE=1 SV=4 40 312 7.0E-21
sp|Q5REX1|SIK2_PONAB Serine/threonine-protein kinase SIK2 OS=Pongo abelii GN=SIK2 PE=2 SV=1 49 309 7.0E-21
sp|A8X0C4|PAR4_CAEBR Serine/threonine-protein kinase par-4 OS=Caenorhabditis briggsae GN=par-4 PE=3 SV=2 48 352 7.0E-21
sp|Q8IU85|KCC1D_HUMAN Calcium/calmodulin-dependent protein kinase type 1D OS=Homo sapiens GN=CAMK1D PE=1 SV=1 43 308 7.0E-21
sp|Q9LWM4|CIPK5_ORYSJ CBL-interacting protein kinase 5 OS=Oryza sativa subsp. japonica GN=CIPK5 PE=2 SV=1 43 308 8.0E-21
sp|P05986|KAPC_YEAST cAMP-dependent protein kinase type 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPK3 PE=1 SV=2 43 249 8.0E-21
sp|Q0JI49|CIPKB_ORYSJ CBL-interacting protein kinase 11 OS=Oryza sativa subsp. japonica GN=CIPK11 PE=2 SV=1 49 318 8.0E-21
sp|G5EFM9|NEKL3_CAEEL Serine/threonine-protein kinase nekl-3 OS=Caenorhabditis elegans GN=nekl-3 PE=1 SV=1 43 305 8.0E-21
sp|Q9ZVM9|Y1461_ARATH Probable serine/threonine-protein kinase At1g54610 OS=Arabidopsis thaliana GN=At1g54610 PE=1 SV=1 38 248 8.0E-21
sp|P34099|KAPC_DICDI cAMP-dependent protein kinase catalytic subunit OS=Dictyostelium discoideum GN=pkaC PE=1 SV=2 48 249 9.0E-21
sp|Q8QZV4|ST32C_MOUSE Serine/threonine-protein kinase 32C OS=Mus musculus GN=Stk32c PE=1 SV=1 43 270 9.0E-21
sp|Q6ZEZ5|NEK3_ORYSJ Serine/threonine-protein kinase Nek3 OS=Oryza sativa subsp. japonica GN=NEK3 PE=2 SV=1 47 308 9.0E-21
sp|D2I3C6|DCLK2_AILME Serine/threonine-protein kinase DCLK2 OS=Ailuropoda melanoleuca GN=DCLK2 PE=3 SV=1 33 308 9.0E-21
sp|Q5EAB2|CDK9_BOVIN Cyclin-dependent kinase 9 OS=Bos taurus GN=CDK9 PE=2 SV=1 49 248 1.0E-20
sp|Q54WX4|AURK_DICDI Aurora kinase OS=Dictyostelium discoideum GN=aurK PE=1 SV=1 43 308 1.0E-20
sp|P50750|CDK9_HUMAN Cyclin-dependent kinase 9 OS=Homo sapiens GN=CDK9 PE=1 SV=3 49 248 1.0E-20
sp|P13185|KIN1_YEAST Serine/threonine protein kinase KIN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KIN1 PE=1 SV=3 47 308 1.0E-20
sp|Q641Z4|CDK9_RAT Cyclin-dependent kinase 9 OS=Rattus norvegicus GN=Cdk9 PE=2 SV=1 49 248 1.0E-20
sp|Q99J95|CDK9_MOUSE Cyclin-dependent kinase 9 OS=Mus musculus GN=Cdk9 PE=1 SV=1 49 248 1.0E-20
sp|Q62925|M3K1_RAT Mitogen-activated protein kinase kinase kinase 1 OS=Rattus norvegicus GN=Map3k1 PE=1 SV=1 49 311 1.0E-20
sp|Q6NW76|AURKB_DANRE Aurora kinase B OS=Danio rerio GN=aurkb PE=2 SV=1 49 308 1.0E-20
sp|Q621J7|ZYG1_CAEBR Probable serine/threonine-protein kinase zyg-1 OS=Caenorhabditis briggsae GN=zyg-1 PE=3 SV=1 49 268 1.0E-20
sp|Q8XJL8|PKN2_CLOPE Probable serine/threonine-protein kinase CPE1738 OS=Clostridium perfringens (strain 13 / Type A) GN=CPE1738 PE=3 SV=1 43 301 1.0E-20
sp|B4GXC2|DCLK_DROPE Serine/threonine-protein kinase GL21140 OS=Drosophila persimilis GN=GL21140 PE=3 SV=1 43 305 1.0E-20
sp|Q2TA25|PLK1_BOVIN Serine/threonine-protein kinase PLK1 OS=Bos taurus GN=PLK1 PE=2 SV=2 48 320 1.0E-20
sp|B5DK35|DCLK_DROPS Serine/threonine-protein kinase GA29083 OS=Drosophila pseudoobscura pseudoobscura GN=GA29083 PE=3 SV=1 43 305 1.0E-20
sp|Q03957|CTK1_YEAST CTD kinase subunit alpha OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CTK1 PE=1 SV=1 22 243 1.0E-20
sp|Q54MY9|MKCA_DICDI Probable serine/threonine-protein kinase mkcA OS=Dictyostelium discoideum GN=mkcA PE=2 SV=1 43 308 1.0E-20
sp|Q8N568|DCLK2_HUMAN Serine/threonine-protein kinase DCLK2 OS=Homo sapiens GN=DCLK2 PE=2 SV=4 33 308 1.0E-20
sp|Q54PK9|PDPKB_DICDI 3-phosphoinositide-dependent protein kinase B OS=Dictyostelium discoideum GN=pdkB PE=3 SV=1 49 312 1.0E-20
sp|Q24324|DSOR1_DROME Dual specificity mitogen-activated protein kinase kinase dSOR1 OS=Drosophila melanogaster GN=Dsor1 PE=1 SV=2 49 313 2.0E-20
sp|Q16816|PHKG1_HUMAN Phosphorylase b kinase gamma catalytic chain, skeletal muscle/heart isoform OS=Homo sapiens GN=PHKG1 PE=2 SV=3 47 323 2.0E-20
sp|Q38868|CDPK9_ARATH Calcium-dependent protein kinase 9 OS=Arabidopsis thaliana GN=CPK9 PE=1 SV=1 43 308 2.0E-20
sp|Q2PJ68|SGK1_CAEEL Serine/threonine-protein kinase sgk-1 OS=Caenorhabditis elegans GN=sgk-1 PE=1 SV=1 49 249 2.0E-20
sp|P34112|CDK1_DICDI Cyclin-dependent kinase 1 OS=Dictyostelium discoideum GN=cdk1 PE=2 SV=1 47 248 2.0E-20
sp|P06245|KAPB_YEAST cAMP-dependent protein kinase type 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPK2 PE=1 SV=2 43 254 2.0E-20
sp|Q86CS2|ATG1_DICDI Serine/threonine-protein kinase atg1 OS=Dictyostelium discoideum GN=atg1 PE=3 SV=1 43 248 2.0E-20
sp|B4IT27|DCLK_DROYA Serine/threonine-protein kinase GE16371 OS=Drosophila yakuba GN=GE16371 PE=3 SV=2 43 305 2.0E-20
sp|Q95ZQ4|AAPK2_CAEEL 5'-AMP-activated protein kinase catalytic subunit alpha-2 OS=Caenorhabditis elegans GN=aak-2 PE=1 SV=2 43 308 2.0E-20
sp|Q6GPL3|AUKBB_XENLA Aurora kinase B-B OS=Xenopus laevis GN=aurkb-b PE=2 SV=1 43 308 2.0E-20
sp|Q7ZVS3|PLK4_DANRE Serine/threonine-protein kinase PLK4 OS=Danio rerio GN=plk4 PE=2 SV=2 43 308 2.0E-20
sp|Q4G3H4|IKKA_DANRE Inhibitor of nuclear factor kappa-B kinase subunit alpha OS=Danio rerio GN=chuk PE=1 SV=1 41 249 2.0E-20
sp|Q8LIG4|CIPK3_ORYSJ CBL-interacting protein kinase 3 OS=Oryza sativa subsp. japonica GN=CIPK3 PE=2 SV=1 38 302 2.0E-20
sp|O22971|CIPKD_ARATH CBL-interacting serine/threonine-protein kinase 13 OS=Arabidopsis thaliana GN=CIPK13 PE=1 SV=2 43 305 2.0E-20
sp|Q20845|PLK3_CAEEL Serine/threonine-protein kinase plk-3 OS=Caenorhabditis elegans GN=plk-3 PE=2 SV=1 40 249 2.0E-20
sp|B4J3F1|PLK4_DROGR Serine/threonine-protein kinase PLK4 OS=Drosophila grimshawi GN=SAK PE=3 SV=1 35 308 3.0E-20
sp|Q7ZX42|CDK9B_XENLA Cyclin-dependent kinase 9-B OS=Xenopus laevis GN=cdk9-b PE=2 SV=1 49 248 3.0E-20
sp|Q54VV7|Y0111_DICDI Probable serine/threonine-protein kinase DDB_G0280111 OS=Dictyostelium discoideum GN=DDB_G0280111 PE=3 SV=1 49 302 3.0E-20
sp|Q54L81|Y0700_DICDI Probable serine/threonine-protein kinase DDB_G0286841 OS=Dictyostelium discoideum GN=DDB_G0286841 PE=3 SV=1 29 249 3.0E-20
sp|Q9NAH6|KS6B_CAEEL Ribosomal protein S6 kinase beta OS=Caenorhabditis elegans GN=rsks-1 PE=1 SV=2 38 258 3.0E-20
sp|Q9YHZ5|PIM2_DANRE Serine/threonine-protein kinase pim-2 OS=Danio rerio GN=pim2 PE=2 SV=2 17 313 3.0E-20
sp|P38991|IPL1_YEAST Spindle assembly checkpoint kinase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IPL1 PE=1 SV=1 100 312 3.0E-20
sp|Q54MV2|MRKB_DICDI Probable serine/threonine-protein kinase MARK-B OS=Dictyostelium discoideum GN=mrkB PE=3 SV=1 37 308 3.0E-20
sp|P51817|PRKX_HUMAN cAMP-dependent protein kinase catalytic subunit PRKX OS=Homo sapiens GN=PRKX PE=1 SV=1 49 296 4.0E-20
sp|Q2KJ16|PHKG2_BOVIN Phosphorylase b kinase gamma catalytic chain, liver/testis isoform OS=Bos taurus GN=PHKG2 PE=2 SV=1 47 308 4.0E-20
sp|O70405|ULK1_MOUSE Serine/threonine-protein kinase ULK1 OS=Mus musculus GN=Ulk1 PE=1 SV=1 43 270 4.0E-20
sp|Q8ICR0|CDPK2_PLAF7 Calcium-dependent protein kinase 2 OS=Plasmodium falciparum (isolate 3D7) GN=CPK2 PE=2 SV=3 36 308 4.0E-20
sp|O93982|HOG1_ZYGRC Mitogen-activated protein kinase HOG1 OS=Zygosaccharomyces rouxii (strain ATCC 2623 / CBS 732 / NBRC 1130 / NCYC 568 / NRRL Y-229) GN=HOG1 PE=3 SV=2 49 248 4.0E-20
sp|Q7PLI7|DCLK_DROME Serine/threonine-protein kinase CG17528 OS=Drosophila melanogaster GN=CG17528 PE=1 SV=1 43 312 4.0E-20
sp|Q00372|SNF1_CANGA Carbon catabolite-derepressing protein kinase OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=SNF1 PE=3 SV=2 33 304 4.0E-20
sp|A8XNJ6|SGK1_CAEBR Serine/threonine-protein kinase sgk-1 OS=Caenorhabditis briggsae GN=sgk-1 PE=3 SV=3 49 249 5.0E-20
sp|O15865|CDPK2_PLAFK Calcium-dependent protein kinase 2 OS=Plasmodium falciparum (isolate K1 / Thailand) GN=CPK2 PE=1 SV=3 36 308 5.0E-20
sp|Q21307|MEK1_CAEEL Dual specificity mitogen-activated protein kinase kinase mek-1 OS=Caenorhabditis elegans GN=mek-1 PE=1 SV=2 47 312 5.0E-20
sp|Q2LYK3|PLK4_DROPS Serine/threonine-protein kinase PLK4 OS=Drosophila pseudoobscura pseudoobscura GN=SAK PE=3 SV=1 37 311 5.0E-20
sp|B4HBU3|PLK4_DROPE Serine/threonine-protein kinase PLK4 OS=Drosophila persimilis GN=SAK PE=3 SV=1 37 311 5.0E-20
sp|Q42438|CDPK8_ARATH Calcium-dependent protein kinase 8 OS=Arabidopsis thaliana GN=CPK8 PE=1 SV=1 49 326 5.0E-20
sp|Q07832|PLK1_MOUSE Serine/threonine-protein kinase PLK1 OS=Mus musculus GN=Plk1 PE=1 SV=2 38 320 5.0E-20
sp|P06782|SNF1_YEAST Carbon catabolite-derepressing protein kinase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SNF1 PE=1 SV=1 49 304 5.0E-20
sp|Q9C098|DCLK3_HUMAN Serine/threonine-protein kinase DCLK3 OS=Homo sapiens GN=DCLK3 PE=2 SV=2 48 308 6.0E-20
sp|P13186|KIN2_YEAST Serine/threonine-protein kinase KIN2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KIN2 PE=1 SV=3 94 308 6.0E-20
sp|P16912|KDC2_DROME Protein kinase DC2 OS=Drosophila melanogaster GN=Pka-C3 PE=2 SV=2 49 296 6.0E-20
sp|Q1PFH8|CDPKJ_ARATH Calcium-dependent protein kinase 19 OS=Arabidopsis thaliana GN=CPK19 PE=2 SV=1 43 308 6.0E-20
sp|Q9UU87|PPK34_SCHPO Serine/threonine-protein kinase ppk34 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppk34 PE=3 SV=2 88 308 6.0E-20
sp|Q5ZJB4|IKKA_CHICK Inhibitor of nuclear factor kappa-B kinase subunit alpha OS=Gallus gallus GN=CHUK PE=2 SV=1 42 249 6.0E-20
sp|Q5MPA9|DCLK2_RAT Serine/threonine-protein kinase DCLK2 OS=Rattus norvegicus GN=Dclk2 PE=1 SV=2 33 308 6.0E-20
sp|Q9SZ67|WRK19_ARATH Probable WRKY transcription factor 19 OS=Arabidopsis thaliana GN=WRKY19 PE=2 SV=1 47 308 6.0E-20
sp|Q9FMP5|CDPKH_ARATH Calcium-dependent protein kinase 17 OS=Arabidopsis thaliana GN=CPK17 PE=2 SV=1 43 308 7.0E-20
sp|Q8BGW6|ST32A_MOUSE Serine/threonine-protein kinase 32A OS=Mus musculus GN=Stk32a PE=2 SV=1 49 249 7.0E-20
sp|Q55CE0|MKCF_DICDI Probable serine/threonine-protein kinase mkcF OS=Dictyostelium discoideum GN=mkcF PE=3 SV=1 48 308 7.0E-20
sp|B3NKK1|DCLK_DROER Serine/threonine-protein kinase GG21441 OS=Drosophila erecta GN=GG21441 PE=3 SV=1 43 305 7.0E-20
sp|P00531|MIL_AVIMH Serine/threonine-protein kinase-transforming protein mil OS=Avian retrovirus MH2 GN=V-MIL PE=3 SV=1 40 302 7.0E-20
sp|Q86SG6|NEK8_HUMAN Serine/threonine-protein kinase Nek8 OS=Homo sapiens GN=NEK8 PE=1 SV=1 48 313 8.0E-20
[Show less]

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:0004672 protein kinase activity Yes
GO:0006468 protein phosphorylation Yes
GO:0000166 nucleotide binding No
GO:0097367 carbohydrate derivative binding No
GO:0006807 nitrogen compound metabolic process No
GO:0036211 protein modification process No
GO:0006796 phosphate-containing compound metabolic process No
GO:0032553 ribonucleotide binding No
GO:0016301 kinase activity No
GO:0140096 catalytic activity, acting on a protein No
GO:0043167 ion binding No
GO:0017076 purine nucleotide binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0006793 phosphorus metabolic process No
GO:0003674 molecular_function No
GO:0005488 binding No
GO:0008150 biological_process No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0043170 macromolecule metabolic process No
GO:0016773 phosphotransferase activity, alcohol group as acceptor No
GO:0008152 metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0016740 transferase activity No
GO:0030554 adenyl nucleotide binding No
GO:0019538 protein metabolic process No
GO:0044238 primary metabolic process No
GO:0009987 cellular process No
GO:0043412 macromolecule modification No
GO:0036094 small molecule binding No
GO:0032559 adenyl ribonucleotide binding No
GO:0003824 catalytic activity No
GO:0044237 cellular metabolic process No
GO:0071704 organic substance metabolic process No
GO:1901363 heterocyclic compound binding No
GO:0032555 purine ribonucleotide binding No
GO:1901265 nucleoside phosphate binding No
GO:0097159 organic cyclic compound binding No
GO:0016310 phosphorylation No
GO:0043168 anion binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 40 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|6035
MANVEPKAMDLTATKKKALLDAQKAQAAIARECADAGRAAPPFVLDELIGKGSFGRVYKASDTAWGRPVAVKIIS
IEEGDALQPGTADTFGDILKEISTLQLLSNSNARNINKIIHAFLVGQSVWMVTDYCAGGSVASLMRPTNGLAERW
VIPILREVAEAIYWVHGQGIIHRDIKCANVLVTDTGAVQLCDFGVAGIMETRFDKRSTVTGTLNWMAPELFDSTV
SYGMEVDIWAFGSMAYEMASGLPPNAATTIDSLPSFGSFLKQFCPRLDGQQYSDGLKHLIAFCMVDDPVQRPTIA
RIQEHPYIFNTQLRYPIESLAHLVSAYRLWETQGWSRQSLFSAGGAQGLSKEQSPTANDEWNFSDQDQPSMPDEE
ASRQAQQVYDAYLPDSSVSSMPSSGQPARRRRRPPTFKELKGPLQKVFDPDTTTNYHDDSRVFYGKRSASCTSDL
PLRDNTQETSVRESLIDLDAALSQSPKGNTIVRLAEIDTIRPASKQMPSSTASSAQRRTQDWTFPLMGESSAGLD
SNEEGSNNDLVAPLTLESAQQLPAVDEAQTFPNRSSSLSLIDLDASLVQPTEVARPSTAGSSIGSNTTHHTFRTS
FDTIRTEPYSGVTSPTTTRPSTAGSHATSSSSVAGSAVFDLELDTQHLPVPEREASLYQVDQVATAEAATGPGSD
EANDDAIATPSQDNASTRQSPSFLPPLPRMPSAAVLQGNCSVQDFKLELQHLVSSLRDHLEATSHCLEGLQSPAE
*
Coding >OphauB2|6035
ATGGCCAACGTGGAGCCCAAGGCTATGGACCTGACGGCCACCAAGAAGAAGGCGCTGCTAGATGCTCAAAAGGCA
CAGGCAGCCATTGCGCGGGAATGCGCCGATGCTGGCCGTGCCGCGCCGCCCTTTGTGCTGGACGAATTGATTGGC
AAGGGCAGCTTTGGGCGCGTCTACAAGGCATCGGACACGGCTTGGGGCCGCCCCGTGGCGGTCAAGATTATCAGC
ATCGAGGAGGGCGATGCGCTGCAGCCAGGCACGGCCGACACGTTTGGCGACATCCTCAAGGAAATCAGCACGCTG
CAGCTGCTGAGCAACAGCAACGCGCGCAACATCAACAAGATTATCCATGCCTTTCTCGTTGGCCAGTCGGTGTGG
ATGGTGACGGACTATTGCGCCGGCGGCAGCGTCGCCTCGCTGATGCGTCCCACAAACGGCCTGGCGGAGCGCTGG
GTCATTCCCATTCTCAGAGAGGTGGCCGAGGCGATATACTGGGTCCACGGACAGGGCATCATCCATCGCGACATC
AAGTGCGCCAATGTCTTGGTCACGGACACGGGAGCCGTCCAGCTGTGTGATTTTGGCGTCGCCGGCATCATGGAG
ACGCGCTTCGATAAGCGAAGCACCGTCACCGGCACCCTCAACTGGATGGCCCCCGAGCTCTTTGATTCCACCGTC
TCGTACGGCATGGAGGTGGACATTTGGGCCTTTGGCTCCATGGCCTATGAAATGGCCTCGGGCCTGCCGCCAAAC
GCTGCCACAACCATTGACAGTCTGCCCAGCTTTGGCTCCTTTCTCAAGCAGTTTTGCCCCCGCCTCGACGGCCAA
CAGTACTCTGATGGCCTCAAGCATCTCATTGCCTTTTGCATGGTGGACGACCCTGTACAGCGTCCCACCATTGCC
AGGATCCAGGAGCATCCATACATCTTCAACACGCAGCTGAGGTATCCCATTGAGTCGCTCGCCCATCTCGTCAGC
GCCTACCGCCTCTGGGAGACGCAGGGCTGGTCCAGGCAGTCTCTCTTCTCGGCTGGCGGCGCCCAGGGCTTGTCC
AAGGAACAGAGCCCAACGGCAAACGACGAGTGGAACTTTAGCGACCAAGACCAGCCCAGCATGCCCGACGAGGAA
GCTTCAAGACAGGCACAGCAAGTCTATGACGCCTATCTCCCTGACTCGAGCGTATCCTCCATGCCCTCGTCGGGG
CAGCCTGCACGACGCCGCCGCCGCCCGCCAACCTTTAAAGAGCTCAAGGGCCCCTTGCAAAAGGTCTTTGACCCC
GACACCACCACCAACTACCACGACGATTCGCGCGTCTTTTACGGCAAGCGTAGTGCCTCTTGCACTTCCGACTTG
CCGCTGCGGGACAACACGCAAGAGACGTCGGTGCGAGAATCGCTCATTGACCTCGACGCAGCTCTGAGCCAGTCC
CCCAAGGGCAACACAATTGTTCGGCTTGCCGAGATTGACACGATACGGCCGGCGTCGAAGCAAATGCCCAGCAGC
ACTGCGAGCTCTGCCCAGCGCCGAACTCAGGACTGGACCTTTCCCTTGATGGGGGAGTCATCAGCAGGCCTCGAC
AGCAACGAGGAGGGGAGCAATAACGACTTGGTTGCCCCTCTCACCCTGGAGAGTGCCCAGCAGCTGCCAGCCGTT
GACGAGGCGCAGACATTTCCAAATCGATCATCGAGCCTGAGTCTGATTGACCTGGATGCGAGCTTGGTACAGCCG
ACCGAGGTGGCTCGCCCATCTACAGCCGGCTCTTCAATTGGCTCCAACACGACGCATCATACATTTCGGACCTCG
TTTGATACCATCAGGACGGAGCCGTATTCTGGCGTCACGAGCCCCACGACAACACGGCCTTCGACTGCGGGATCG
CATGCTACTAGCTCGAGCTCAGTCGCAGGCTCTGCCGTCTTTGATCTGGAGCTCGACACACAGCACCTGCCCGTG
CCGGAGCGAGAGGCGTCGCTGTATCAAGTCGACCAAGTCGCCACGGCGGAGGCGGCAACGGGCCCCGGGTCCGAC
GAGGCAAACGACGATGCCATTGCAACGCCAAGCCAAGACAATGCAAGCACAAGACAATCGCCGTCGTTTTTGCCG
CCGTTGCCGCGGATGCCGTCGGCGGCGGTGCTGCAAGGAAACTGCTCAGTCCAAGACTTTAAGCTGGAGCTGCAG
CACCTGGTTTCGAGCTTGCGGGATCATCTCGAAGCAACATCGCATTGTTTGGAAGGCTTGCAGTCGCCTGCAGAG
TAG
Transcript >OphauB2|6035
ATGGCCAACGTGGAGCCCAAGGCTATGGACCTGACGGCCACCAAGAAGAAGGCGCTGCTAGATGCTCAAAAGGCA
CAGGCAGCCATTGCGCGGGAATGCGCCGATGCTGGCCGTGCCGCGCCGCCCTTTGTGCTGGACGAATTGATTGGC
AAGGGCAGCTTTGGGCGCGTCTACAAGGCATCGGACACGGCTTGGGGCCGCCCCGTGGCGGTCAAGATTATCAGC
ATCGAGGAGGGCGATGCGCTGCAGCCAGGCACGGCCGACACGTTTGGCGACATCCTCAAGGAAATCAGCACGCTG
CAGCTGCTGAGCAACAGCAACGCGCGCAACATCAACAAGATTATCCATGCCTTTCTCGTTGGCCAGTCGGTGTGG
ATGGTGACGGACTATTGCGCCGGCGGCAGCGTCGCCTCGCTGATGCGTCCCACAAACGGCCTGGCGGAGCGCTGG
GTCATTCCCATTCTCAGAGAGGTGGCCGAGGCGATATACTGGGTCCACGGACAGGGCATCATCCATCGCGACATC
AAGTGCGCCAATGTCTTGGTCACGGACACGGGAGCCGTCCAGCTGTGTGATTTTGGCGTCGCCGGCATCATGGAG
ACGCGCTTCGATAAGCGAAGCACCGTCACCGGCACCCTCAACTGGATGGCCCCCGAGCTCTTTGATTCCACCGTC
TCGTACGGCATGGAGGTGGACATTTGGGCCTTTGGCTCCATGGCCTATGAAATGGCCTCGGGCCTGCCGCCAAAC
GCTGCCACAACCATTGACAGTCTGCCCAGCTTTGGCTCCTTTCTCAAGCAGTTTTGCCCCCGCCTCGACGGCCAA
CAGTACTCTGATGGCCTCAAGCATCTCATTGCCTTTTGCATGGTGGACGACCCTGTACAGCGTCCCACCATTGCC
AGGATCCAGGAGCATCCATACATCTTCAACACGCAGCTGAGGTATCCCATTGAGTCGCTCGCCCATCTCGTCAGC
GCCTACCGCCTCTGGGAGACGCAGGGCTGGTCCAGGCAGTCTCTCTTCTCGGCTGGCGGCGCCCAGGGCTTGTCC
AAGGAACAGAGCCCAACGGCAAACGACGAGTGGAACTTTAGCGACCAAGACCAGCCCAGCATGCCCGACGAGGAA
GCTTCAAGACAGGCACAGCAAGTCTATGACGCCTATCTCCCTGACTCGAGCGTATCCTCCATGCCCTCGTCGGGG
CAGCCTGCACGACGCCGCCGCCGCCCGCCAACCTTTAAAGAGCTCAAGGGCCCCTTGCAAAAGGTCTTTGACCCC
GACACCACCACCAACTACCACGACGATTCGCGCGTCTTTTACGGCAAGCGTAGTGCCTCTTGCACTTCCGACTTG
CCGCTGCGGGACAACACGCAAGAGACGTCGGTGCGAGAATCGCTCATTGACCTCGACGCAGCTCTGAGCCAGTCC
CCCAAGGGCAACACAATTGTTCGGCTTGCCGAGATTGACACGATACGGCCGGCGTCGAAGCAAATGCCCAGCAGC
ACTGCGAGCTCTGCCCAGCGCCGAACTCAGGACTGGACCTTTCCCTTGATGGGGGAGTCATCAGCAGGCCTCGAC
AGCAACGAGGAGGGGAGCAATAACGACTTGGTTGCCCCTCTCACCCTGGAGAGTGCCCAGCAGCTGCCAGCCGTT
GACGAGGCGCAGACATTTCCAAATCGATCATCGAGCCTGAGTCTGATTGACCTGGATGCGAGCTTGGTACAGCCG
ACCGAGGTGGCTCGCCCATCTACAGCCGGCTCTTCAATTGGCTCCAACACGACGCATCATACATTTCGGACCTCG
TTTGATACCATCAGGACGGAGCCGTATTCTGGCGTCACGAGCCCCACGACAACACGGCCTTCGACTGCGGGATCG
CATGCTACTAGCTCGAGCTCAGTCGCAGGCTCTGCCGTCTTTGATCTGGAGCTCGACACACAGCACCTGCCCGTG
CCGGAGCGAGAGGCGTCGCTGTATCAAGTCGACCAAGTCGCCACGGCGGAGGCGGCAACGGGCCCCGGGTCCGAC
GAGGCAAACGACGATGCCATTGCAACGCCAAGCCAAGACAATGCAAGCACAAGACAATCGCCGTCGTTTTTGCCG
CCGTTGCCGCGGATGCCGTCGGCGGCGGTGCTGCAAGGAAACTGCTCAGTCCAAGACTTTAAGCTGGAGCTGCAG
CACCTGGTTTCGAGCTTGCGGGATCATCTCGAAGCAACATCGCATTGTTTGGAAGGCTTGCAGTCGCCTGCAGAG
TAG
Gene >OphauB2|6035
ATGGCCAACGTGGAGCCCAAGGCTATGGACCTGACGGCCACCAAGAAGAAGGCGCTGCTAGATGCTCAAAAGGCA
CAGGCAGCCATTGCGCGGGAATGCGCCGATGCTGGCCGTGCCGCGCCGCCCTTTGTGCTGGACGAATTGATTGGC
AAGGGCAGCTTTGGGCGCGTCTACAAGGCATCGGACACGGCTTGGGGCCGCCCCGTGGCGGTCAAGATTATCAGC
ATCGAGGAGGGCGATGCGCTGCAGCCAGGCACGGCCGACACGTTTGGCGACATCCTCAAGGAAATCAGCACGCTG
CAGCTGCTGAGCAACAGCAACGCGCGCAACATCAACAAGATTATCCATGCCTTTCTCGTTGGCCAGTCGGTGTGG
ATGGTGACGGACTATTGCGCCGGCGGCAGCGTCGCCTCGCTGATGCGTCCCACAAACGGCCTGGCGGAGCGCTGG
GTCATTCCCATTCTCAGAGAGGTGGCCGAGGCGATATACTGGGTCCACGGACAGGGCATCATCCATCGCGACATC
AAGTGCGCCAATGTCTTGGTCACGGACACGGGAGCCGTCCAGCTGTGTGATTTTGGCGTCGCCGGCATCATGGAG
ACGCGCTTCGATAAGCGAAGCACCGTCACCGGCACCCTCAACTGGATGGCCCCCGAGCTCTTTGATTCCACCGTC
TCGTACGGCATGGAGGTGGACATTTGGGCCTTTGGCTCCATGGCCTATGAAATGGCCTCGGGCCTGCCGCCAAAC
GCTGCCACAACCATTGACAGTCTGCCCAGCTTTGGCTCCTTTCTCAAGCAGTTTTGCCCCCGCCTCGACGGCCAA
CAGTACTCTGATGGCCTCAAGCATCTCATTGCCTTTTGCATGGTGGACGACCCTGTACAGCGTCCCACCATTGCC
AGGATCCAGGAGCATCCATACATCTTCAACACGCAGCTGAGGTATCCCATTGAGTCGCTCGCCCATCTCGTCAGC
GCCTACCGCCTCTGGGAGACGCAGGGCTGGTCCAGGCAGTCTCTCTTCTCGGCTGGCGGCGCCCAGGGCTTGTCC
AAGGAACAGAGCCCAACGGCAAACGACGAGTGGAACTTTAGCGACCAAGACCAGCCCAGCATGCCCGACGAGGAA
GCTTCAAGACAGGCACAGCAAGTCTATGACGCCTATCTCCCTGACTCGAGCGTATCCTCCATGCCCTCGTCGGGG
CAGCCTGCACGACGCCGCCGCCGCCCGCCAACCTTTAAAGAGCTCAAGGGCCCCTTGCAAAAGGTCTTTGACCCC
GACACCACCACCAACTACCACGACGATTCGCGCGTCTTTTACGGCAAGCGTAGTGCCTCTTGCACTTCCGACTTG
CCGCTGCGGGACAACACGCAAGAGACGTCGGTGCGAGAATCGCTCATTGACCTCGACGCAGCTCTGAGCCAGTCC
CCCAAGGGCAACACAATTGTTCGGCTTGCCGAGATTGACACGATACGGCCGGCGTCGAAGCAAATGCCCAGCAGC
ACTGCGAGCTCTGCCCAGCGCCGAACTCAGGACTGGACCTTTCCCTTGATGGGGGAGTCATCAGCAGGCCTCGAC
AGCAACGAGGAGGGGAGCAATAACGACTTGGTTGCCCCTCTCACCCTGGAGAGTGCCCAGCAGCTGCCAGCCGTT
GACGAGGCGCAGACATTTCCAAATCGATCATCGAGCCTGAGTCTGATTGACCTGGATGCGAGCTTGGTACAGCCG
ACCGAGGTGGCTCGCCCATCTACAGCCGGCTCTTCAATTGGCTCCAACACGACGCATCATACATTTCGGACCTCG
TTTGATACCATCAGGACGGAGCCGTATTCTGGCGTCACGAGCCCCACGACAACACGGCCTTCGACTGCGGGATCG
CATGCTACTAGCTCGAGCTCAGTCGCAGGCTCTGCCGTCTTTGATCTGGAGCTCGACACACAGCACCTGCCCGTG
CCGGAGCGAGAGGCGTCGCTGTATCAAGTCGACCAAGTCGCCACGGCGGAGGCGGCAACGGGCCCCGGGTCCGAC
GAGGCAAACGACGATGCCATTGCAACGCCAAGCCAAGACAATGCAAGCACAAGACAATCGCCGTCGTTTTTGCCG
CCGTTGCCGCGGATGCCGTCGGCGGCGGTGCTGCAAGGAAACTGCTCAGTCCAAGACTTTAAGCTGGAGCTGCAG
CACCTGGTTTCGAGCTTGCGGGATCATCTCGAAGCAACATCGCATTGTTTGGAAGGCTTGCAGTCGCCTGCAGAG
TAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail