Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|6032
Gene name
LocationContig_505:360..1110
Strand+
Gene length (bp)750
Transcript length (bp)750
Coding sequence length (bp)750
Protein length (aa) 250

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00753 Lactamase_B Metallo-beta-lactamase superfamily 6.0E-15 3 146
PF17778 BLACT_WH Beta-lactamase associated winged helix domain 2.7E-13 198 242
PF12706 Lactamase_B_2 Beta-lactamase superfamily domain 1.1E-06 16 73

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q1LZ83|LACB2_BOVIN Beta-lactamase-like protein 2 OS=Bos taurus GN=LACTB2 PE=2 SV=1 1 239 2.0E-65
sp|Q9VLS9|LACB2_DROME Beta-lactamase-like protein 2 homolog OS=Drosophila melanogaster GN=CG12375 PE=2 SV=1 1 235 4.0E-64
sp|Q0V9A9|LACB2_XENTR Beta-lactamase-like protein 2 OS=Xenopus tropicalis GN=lactb2 PE=2 SV=1 1 237 1.0E-62
sp|Q561R9|LACB2_RAT Beta-lactamase-like protein 2 OS=Rattus norvegicus GN=Lactb2 PE=2 SV=1 1 236 5.0E-62
sp|Q5XGR8|LACB2_XENLA Beta-lactamase-like protein 2 OS=Xenopus laevis GN=lactb2 PE=2 SV=1 1 237 1.0E-61
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q1LZ83|LACB2_BOVIN Beta-lactamase-like protein 2 OS=Bos taurus GN=LACTB2 PE=2 SV=1 1 239 2.0E-65
sp|Q9VLS9|LACB2_DROME Beta-lactamase-like protein 2 homolog OS=Drosophila melanogaster GN=CG12375 PE=2 SV=1 1 235 4.0E-64
sp|Q0V9A9|LACB2_XENTR Beta-lactamase-like protein 2 OS=Xenopus tropicalis GN=lactb2 PE=2 SV=1 1 237 1.0E-62
sp|Q561R9|LACB2_RAT Beta-lactamase-like protein 2 OS=Rattus norvegicus GN=Lactb2 PE=2 SV=1 1 236 5.0E-62
sp|Q5XGR8|LACB2_XENLA Beta-lactamase-like protein 2 OS=Xenopus laevis GN=lactb2 PE=2 SV=1 1 237 1.0E-61
sp|Q99KR3|LACB2_MOUSE Beta-lactamase-like protein 2 OS=Mus musculus GN=Lactb2 PE=1 SV=1 1 234 4.0E-60
sp|Q53H82|LACB2_HUMAN Beta-lactamase-like protein 2 OS=Homo sapiens GN=LACTB2 PE=1 SV=2 1 243 1.0E-58
sp|Q6NYF0|LACB2_DANRE Beta-lactamase-like protein 2 OS=Danio rerio GN=lactb2 PE=2 SV=1 1 217 4.0E-58
sp|Q95Q18|LACB2_CAEEL Beta-lactamase-like protein 2 homolog OS=Caenorhabditis elegans GN=Y53F4B.39 PE=3 SV=1 1 236 1.0E-52
sp|B0TXY0|GLO2_FRAP2 Hydroxyacylglutathione hydrolase OS=Francisella philomiragia subsp. philomiragia (strain ATCC 25017) GN=gloB PE=3 SV=1 9 159 2.0E-15
sp|A0Q7M7|GLO2_FRATN Hydroxyacylglutathione hydrolase OS=Francisella tularensis subsp. novicida (strain U112) GN=gloB PE=3 SV=1 9 159 5.0E-15
sp|A7NB16|GLO2_FRATF Hydroxyacylglutathione hydrolase OS=Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA) GN=gloB PE=3 SV=1 9 159 3.0E-14
sp|Q2A4E2|GLO2_FRATH Hydroxyacylglutathione hydrolase OS=Francisella tularensis subsp. holarctica (strain LVS) GN=gloB PE=3 SV=1 9 159 3.0E-14
sp|Q0BMS2|GLO2_FRATO Hydroxyacylglutathione hydrolase OS=Francisella tularensis subsp. holarctica (strain OSU18) GN=gloB PE=3 SV=1 9 159 3.0E-14
sp|A4IWV0|GLO2_FRATW Hydroxyacylglutathione hydrolase OS=Francisella tularensis subsp. tularensis (strain WY96-3418) GN=gloB PE=3 SV=1 9 159 9.0E-13
sp|Q5NF43|GLO2_FRATT Hydroxyacylglutathione hydrolase OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=gloB PE=3 SV=1 9 159 9.0E-13
sp|B2SFR3|GLO2_FRATM Hydroxyacylglutathione hydrolase OS=Francisella tularensis subsp. mediasiatica (strain FSC147) GN=gloB PE=3 SV=1 9 159 9.0E-13
sp|Q14GJ6|GLO2_FRAT1 Hydroxyacylglutathione hydrolase OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=gloB PE=3 SV=1 9 159 9.0E-13
sp|Q87C74|GLO2_XYLFT Hydroxyacylglutathione hydrolase OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=gloB PE=3 SV=1 16 166 1.0E-11
sp|B2I5S5|GLO2_XYLF2 Hydroxyacylglutathione hydrolase OS=Xylella fastidiosa (strain M23) GN=gloB PE=3 SV=1 16 166 1.0E-11
sp|B0U365|GLO2_XYLFM Hydroxyacylglutathione hydrolase OS=Xylella fastidiosa (strain M12) GN=gloB PE=3 SV=1 16 166 1.0E-11
sp|Q9PBI4|GLO2_XYLFA Hydroxyacylglutathione hydrolase OS=Xylella fastidiosa (strain 9a5c) GN=gloB PE=3 SV=1 16 166 2.0E-11
sp|Q21C03|GLO2_RHOPB Hydroxyacylglutathione hydrolase OS=Rhodopseudomonas palustris (strain BisB18) GN=gloB PE=3 SV=1 20 159 3.0E-11
sp|Q3IIR9|GLO2_PSEHT Hydroxyacylglutathione hydrolase OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=gloB PE=3 SV=1 19 130 3.0E-10
sp|Q1QQZ1|GLO2_NITHX Hydroxyacylglutathione hydrolase OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=gloB PE=3 SV=1 37 159 5.0E-10
sp|Q5QZL0|GLO2_IDILO Hydroxyacylglutathione hydrolase OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=gloB PE=3 SV=1 16 130 2.0E-09
sp|Q13F06|GLO2_RHOPS Hydroxyacylglutathione hydrolase OS=Rhodopseudomonas palustris (strain BisB5) GN=gloB PE=3 SV=1 20 131 3.0E-09
sp|Q3SVQ1|GLO2_NITWN Hydroxyacylglutathione hydrolase OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=gloB PE=3 SV=1 20 159 4.0E-09
sp|Q07VA9|GLO2_RHOP5 Hydroxyacylglutathione hydrolase OS=Rhodopseudomonas palustris (strain BisA53) GN=gloB PE=3 SV=1 37 159 4.0E-09
sp|Q2J429|GLO2_RHOP2 Hydroxyacylglutathione hydrolase OS=Rhodopseudomonas palustris (strain HaA2) GN=gloB PE=3 SV=1 20 131 4.0E-09
sp|A1U0V1|GLO2_MARHV Hydroxyacylglutathione hydrolase OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=gloB PE=3 SV=1 16 130 6.0E-09
sp|A5GJK5|GLO2_SYNPW Hydroxyacylglutathione hydrolase OS=Synechococcus sp. (strain WH7803) GN=gloB PE=3 SV=1 3 159 7.0E-09
sp|A4SPI6|GLO2_AERS4 Hydroxyacylglutathione hydrolase OS=Aeromonas salmonicida (strain A449) GN=gloB PE=3 SV=1 18 131 1.0E-08
sp|A1SS88|GLO2_PSYIN Hydroxyacylglutathione hydrolase OS=Psychromonas ingrahamii (strain 37) GN=gloB PE=3 SV=1 18 131 2.0E-08
sp|Q21YF8|GLO2_RHOFT Hydroxyacylglutathione hydrolase OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=gloB PE=3 SV=2 18 131 4.0E-08
sp|Q8PBY0|GLO2_XANCP Hydroxyacylglutathione hydrolase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=gloB PE=3 SV=1 10 189 5.0E-08
sp|Q4URM1|GLO2_XANC8 Hydroxyacylglutathione hydrolase OS=Xanthomonas campestris pv. campestris (strain 8004) GN=gloB PE=3 SV=1 10 189 5.0E-08
sp|B0RTE9|GLO2_XANCB Hydroxyacylglutathione hydrolase OS=Xanthomonas campestris pv. campestris (strain B100) GN=gloB PE=3 SV=1 10 189 5.0E-08
sp|Q7VD23|GLO2_PROMA Hydroxyacylglutathione hydrolase OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=gloB PE=3 SV=1 18 156 7.0E-08
sp|Q6NC62|GLO2_RHOPA Hydroxyacylglutathione hydrolase OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=gloB PE=3 SV=1 20 131 9.0E-08
sp|A6T510|GLO2_KLEP7 Hydroxyacylglutathione hydrolase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=gloB PE=3 SV=1 16 131 9.0E-08
sp|B2FR57|GLO2_STRMK Hydroxyacylglutathione hydrolase OS=Stenotrophomonas maltophilia (strain K279a) GN=gloB PE=3 SV=1 18 150 1.0E-07
sp|B5Y1G4|GLO2_KLEP3 Hydroxyacylglutathione hydrolase OS=Klebsiella pneumoniae (strain 342) GN=gloB PE=3 SV=1 16 131 1.0E-07
sp|O24496|GLO2C_ARATH Hydroxyacylglutathione hydrolase cytoplasmic OS=Arabidopsis thaliana GN=GLX2-2 PE=1 SV=2 27 231 2.0E-07
sp|B1XQ70|GLO2_SYNP2 Hydroxyacylglutathione hydrolase OS=Synechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6) GN=gloB PE=3 SV=1 37 150 2.0E-07
sp|Q87MG0|GLO2_VIBPA Hydroxyacylglutathione hydrolase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=gloB PE=3 SV=1 16 201 2.0E-07
sp|Q89XT5|GLO2_BRADU Hydroxyacylglutathione hydrolase OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=gloB PE=3 SV=1 20 195 2.0E-07
sp|B6EJV4|GLO2_ALISL Hydroxyacylglutathione hydrolase OS=Aliivibrio salmonicida (strain LFI1238) GN=gloB PE=3 SV=1 18 131 2.0E-07
sp|Q0BWR4|GLO2_HYPNA Hydroxyacylglutathione hydrolase OS=Hyphomonas neptunium (strain ATCC 15444) GN=gloB PE=3 SV=1 12 230 3.0E-07
sp|Q8PNI0|GLO2_XANAC Hydroxyacylglutathione hydrolase OS=Xanthomonas axonopodis pv. citri (strain 306) GN=gloB PE=3 SV=1 16 156 3.0E-07
sp|A6WXE0|GLO2_OCHA4 Hydroxyacylglutathione hydrolase OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=gloB PE=3 SV=1 37 159 3.0E-07
sp|Q6D1V5|GLO2_PECAS Hydroxyacylglutathione hydrolase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=gloB PE=3 SV=1 3 131 4.0E-07
sp|A4YKS8|GLO2_BRASO Hydroxyacylglutathione hydrolase OS=Bradyrhizobium sp. (strain ORS278) GN=gloB PE=3 SV=1 35 159 4.0E-07
sp|Q47FN7|GLO2_DECAR Hydroxyacylglutathione hydrolase OS=Dechloromonas aromatica (strain RCB) GN=gloB PE=3 SV=1 9 131 5.0E-07
sp|Q3BWP5|GLO2_XANC5 Hydroxyacylglutathione hydrolase OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=gloB PE=3 SV=1 10 189 5.0E-07
sp|C6DC67|GLO2_PECCP Hydroxyacylglutathione hydrolase OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=gloB PE=3 SV=1 3 131 6.0E-07
sp|Q5ZLY2|HAGHL_CHICK Hydroxyacylglutathione hydrolase-like protein OS=Gallus gallus GN=HAGHL PE=2 SV=1 3 153 6.0E-07
sp|Q5E3G3|GLO2_VIBF1 Hydroxyacylglutathione hydrolase OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=gloB PE=3 SV=2 18 182 7.0E-07
sp|Q5N5S6|GLO2_SYNP6 Hydroxyacylglutathione hydrolase OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=gloB PE=3 SV=2 3 131 8.0E-07
sp|Q31ND6|GLO2_SYNE7 Hydroxyacylglutathione hydrolase OS=Synechococcus elongatus (strain PCC 7942) GN=gloB PE=3 SV=1 3 131 8.0E-07
sp|B4SLN7|GLO2_STRM5 Hydroxyacylglutathione hydrolase OS=Stenotrophomonas maltophilia (strain R551-3) GN=gloB PE=3 SV=1 18 150 1.0E-06
sp|A9BEI3|GLO2_PROM4 Hydroxyacylglutathione hydrolase OS=Prochlorococcus marinus (strain MIT 9211) GN=gloB PE=3 SV=1 27 178 1.0E-06
sp|Q46GM1|GLO2_PROMT Hydroxyacylglutathione hydrolase OS=Prochlorococcus marinus (strain NATL2A) GN=gloB PE=3 SV=2 27 159 2.0E-06
sp|A2C116|GLO2_PROM1 Hydroxyacylglutathione hydrolase OS=Prochlorococcus marinus (strain NATL1A) GN=gloB PE=3 SV=1 27 159 2.0E-06
sp|B7VIP5|GLO2_VIBTL Hydroxyacylglutathione hydrolase OS=Vibrio tasmaniensis (strain LGP32) GN=gloB PE=3 SV=1 9 131 2.0E-06
sp|C4K7Z9|GLO2_HAMD5 Hydroxyacylglutathione hydrolase OS=Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT) GN=gloB PE=3 SV=1 18 131 2.0E-06
sp|B5F9V3|GLO2_VIBFM Hydroxyacylglutathione hydrolase OS=Vibrio fischeri (strain MJ11) GN=gloB PE=3 SV=1 18 182 2.0E-06
sp|A4W6V2|GLO2_ENT38 Hydroxyacylglutathione hydrolase OS=Enterobacter sp. (strain 638) GN=gloB PE=3 SV=1 16 131 3.0E-06
sp|C5BEP2|GLO2_EDWI9 Hydroxyacylglutathione hydrolase OS=Edwardsiella ictaluri (strain 93-146) GN=gloB PE=3 SV=1 2 131 3.0E-06
sp|Q8DBD8|GLO2_VIBVU Hydroxyacylglutathione hydrolase OS=Vibrio vulnificus (strain CMCP6) GN=gloB PE=3 SV=1 16 156 3.0E-06
sp|Q7MII4|GLO22_VIBVY Hydroxyacylglutathione hydrolase 2 OS=Vibrio vulnificus (strain YJ016) GN=gloB2 PE=3 SV=1 16 156 3.0E-06
sp|Q7VM19|GLO2_HAEDU Hydroxyacylglutathione hydrolase OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=gloB PE=3 SV=1 3 159 3.0E-06
sp|Q5WX41|GLO2_LEGPL Hydroxyacylglutathione hydrolase OS=Legionella pneumophila (strain Lens) GN=gloB PE=3 SV=1 20 135 4.0E-06
sp|A7MY07|GLO2_VIBCB Hydroxyacylglutathione hydrolase OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=gloB PE=3 SV=1 16 156 4.0E-06
sp|A5IBE7|GLO2_LEGPC Hydroxyacylglutathione hydrolase OS=Legionella pneumophila (strain Corby) GN=gloB PE=3 SV=1 20 135 4.0E-06
sp|Q5ZVZ3|GLO2_LEGPH Hydroxyacylglutathione hydrolase OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=gloB PE=3 SV=1 20 135 4.0E-06
sp|C4LC58|GLO2_TOLAT Hydroxyacylglutathione hydrolase OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=gloB PE=3 SV=1 4 130 4.0E-06
sp|P71374|GLO2_HAEIN Hydroxyacylglutathione hydrolase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=gloB PE=3 SV=1 30 150 6.0E-06
sp|C3LPP0|GLO2_VIBCM Hydroxyacylglutathione hydrolase OS=Vibrio cholerae serotype O1 (strain M66-2) GN=gloB PE=3 SV=1 19 150 6.0E-06
sp|Q9KPX6|GLO2_VIBCH Hydroxyacylglutathione hydrolase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=gloB PE=3 SV=1 19 150 6.0E-06
sp|A5F635|GLO2_VIBC3 Hydroxyacylglutathione hydrolase OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=gloB PE=3 SV=1 19 150 6.0E-06
sp|Q8Z983|GLO2_SALTI Hydroxyacylglutathione hydrolase OS=Salmonella typhi GN=gloB PE=3 SV=1 16 131 7.0E-06
sp|Q6PII5|HAGHL_HUMAN Hydroxyacylglutathione hydrolase-like protein OS=Homo sapiens GN=HAGHL PE=2 SV=1 3 150 8.0E-06
sp|B3R1Y0|GLO2_CUPTR Hydroxyacylglutathione hydrolase OS=Cupriavidus taiwanensis (strain R1 / LMG 19424) GN=gloB PE=3 SV=1 19 150 8.0E-06
sp|A5UF43|GLO2_HAEIG Hydroxyacylglutathione hydrolase OS=Haemophilus influenzae (strain PittGG) GN=gloB PE=3 SV=1 30 150 9.0E-06
sp|A5ETG1|GLO2_BRASB Hydroxyacylglutathione hydrolase OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) GN=gloB PE=3 SV=1 35 159 9.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 26 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|6032
MTLQGTNTYLLGTGLRRILIDTGQGLPVWTARLRRILQQEGATVEMVLISHWHPDHIGGVEELLAVAPDAVVYKH
DPWPGQRPISDGQQFTTQGATLTAAHTPGHTQDHMVFILEDEDAMFTADNLLGHGTTVFDDLSLYMASLAKMCTL
FSGRAYPGHGAVIESGLAKIVEYIAHRRHREEQVLQVIRGDANRAWRAMDVVRAVYYDVPQELHAAACGGVLQVL
AKLQGEGWVKSDGDGGWRLMPSGT*
Coding >OphauB2|6032
ATGACACTACAGGGGACAAACACATACCTGCTGGGAACAGGCCTACGGCGCATTCTTATTGACACGGGTCAAGGT
CTGCCGGTGTGGACAGCTCGCCTTAGGCGAATCTTACAGCAAGAAGGTGCAACGGTCGAGATGGTTCTTATATCA
CACTGGCATCCAGACCATATCGGTGGTGTTGAGGAACTGCTCGCCGTTGCCCCTGATGCTGTTGTCTACAAGCAT
GACCCCTGGCCGGGCCAACGACCCATATCGGACGGGCAGCAATTCACGACTCAAGGCGCAACATTGACGGCCGCT
CACACTCCTGGCCACACGCAAGACCACATGGTTTTTATCCTTGAGGATGAAGATGCCATGTTCACAGCAGATAAC
TTGCTCGGCCACGGCACGACAGTCTTCGATGACTTGAGTCTCTACATGGCCAGTCTTGCCAAGATGTGCACCCTG
TTCTCTGGTCGCGCATATCCTGGTCATGGCGCCGTGATAGAGAGCGGCCTGGCTAAGATTGTCGAGTATATTGCG
CATAGGCGGCATCGTGAAGAGCAGGTGCTTCAAGTGATAAGAGGCGATGCGAACAGAGCATGGAGAGCCATGGAT
GTGGTTCGTGCTGTTTACTATGACGTGCCTCAAGAGTTGCATGCGGCGGCATGTGGTGGTGTCTTGCAAGTGCTC
GCAAAGCTACAGGGCGAGGGCTGGGTCAAAAGCGATGGTGATGGCGGCTGGCGACTAATGCCCTCTGGGACTTGA
Transcript >OphauB2|6032
ATGACACTACAGGGGACAAACACATACCTGCTGGGAACAGGCCTACGGCGCATTCTTATTGACACGGGTCAAGGT
CTGCCGGTGTGGACAGCTCGCCTTAGGCGAATCTTACAGCAAGAAGGTGCAACGGTCGAGATGGTTCTTATATCA
CACTGGCATCCAGACCATATCGGTGGTGTTGAGGAACTGCTCGCCGTTGCCCCTGATGCTGTTGTCTACAAGCAT
GACCCCTGGCCGGGCCAACGACCCATATCGGACGGGCAGCAATTCACGACTCAAGGCGCAACATTGACGGCCGCT
CACACTCCTGGCCACACGCAAGACCACATGGTTTTTATCCTTGAGGATGAAGATGCCATGTTCACAGCAGATAAC
TTGCTCGGCCACGGCACGACAGTCTTCGATGACTTGAGTCTCTACATGGCCAGTCTTGCCAAGATGTGCACCCTG
TTCTCTGGTCGCGCATATCCTGGTCATGGCGCCGTGATAGAGAGCGGCCTGGCTAAGATTGTCGAGTATATTGCG
CATAGGCGGCATCGTGAAGAGCAGGTGCTTCAAGTGATAAGAGGCGATGCGAACAGAGCATGGAGAGCCATGGAT
GTGGTTCGTGCTGTTTACTATGACGTGCCTCAAGAGTTGCATGCGGCGGCATGTGGTGGTGTCTTGCAAGTGCTC
GCAAAGCTACAGGGCGAGGGCTGGGTCAAAAGCGATGGTGATGGCGGCTGGCGACTAATGCCCTCTGGGACTTGA
Gene >OphauB2|6032
ATGACACTACAGGGGACAAACACATACCTGCTGGGAACAGGCCTACGGCGCATTCTTATTGACACGGGTCAAGGT
CTGCCGGTGTGGACAGCTCGCCTTAGGCGAATCTTACAGCAAGAAGGTGCAACGGTCGAGATGGTTCTTATATCA
CACTGGCATCCAGACCATATCGGTGGTGTTGAGGAACTGCTCGCCGTTGCCCCTGATGCTGTTGTCTACAAGCAT
GACCCCTGGCCGGGCCAACGACCCATATCGGACGGGCAGCAATTCACGACTCAAGGCGCAACATTGACGGCCGCT
CACACTCCTGGCCACACGCAAGACCACATGGTTTTTATCCTTGAGGATGAAGATGCCATGTTCACAGCAGATAAC
TTGCTCGGCCACGGCACGACAGTCTTCGATGACTTGAGTCTCTACATGGCCAGTCTTGCCAAGATGTGCACCCTG
TTCTCTGGTCGCGCATATCCTGGTCATGGCGCCGTGATAGAGAGCGGCCTGGCTAAGATTGTCGAGTATATTGCG
CATAGGCGGCATCGTGAAGAGCAGGTGCTTCAAGTGATAAGAGGCGATGCGAACAGAGCATGGAGAGCCATGGAT
GTGGTTCGTGCTGTTTACTATGACGTGCCTCAAGAGTTGCATGCGGCGGCATGTGGTGGTGTCTTGCAAGTGCTC
GCAAAGCTACAGGGCGAGGGCTGGGTCAAAAGCGATGGTGATGGCGGCTGGCGACTAATGCCCTCTGGGACTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail