Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|603
Gene name
LocationContig_11:230108..231601
Strand+
Gene length (bp)1493
Transcript length (bp)1032
Coding sequence length (bp)1032
Protein length (aa) 344

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01822 WSC WSC domain 7.7E-11 38 102

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P38739|WSC4_YEAST Cell wall integrity and stress response component 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=WSC4 PE=1 SV=1 10 115 6.0E-11

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

SignalP signal predicted Location Score
Yes 1 - 23 0.999423

Transmembrane Domains

Domain # Start End Length
1 220 242 22

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1794
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1241
Ophiocordyceps australis map64 (Brazil) OphauB2|603 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|06352
Ophiocordyceps camponoti-rufipedis Ophun1|656
Ophiocordyceps kimflemingae Ophio5|1683
Ophiocordyceps subramaniannii Hirsu2|1739

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|603
MASVLKRAPAAGSLLLMASVCAALDPSICASFNTATSMQPKNDIYQTNGLCHDYCISQNQAYAITQGNSCWCSNY
TPAKSKQVDTGSCDKPCPAYPSEMCGGNGLFSYIALNASPAGVRPEESKPSPSSPPPPPPSPSETSTSSTPTPTP
TDDANTSSSSSSSVERLPATSIVQTVTAGGTIRTVTVIPSPTDDVANSDSARSRNRDGDGGGGIGRGGVVGIVVG
CIVGVLSVAGAIMFWWLRRKRIAEQEAAGDDPSLRGSSSGMIGGRPEMAPGSPGSTGNRSSMLNIDPRMDPFKQG
LYARAGSHESVNTLRDEHDYSRRIHPAKVLRATNPDPVAGDDA*
Coding >OphauB2|603
ATGGCTTCTGTTTTGAAGAGGGCGCCCGCCGCGGGCAGCCTCTTGTTGATGGCGTCGGTGTGCGCAGCGCTGGAC
CCGAGCATCTGCGCCAGCTTCAACACTGCCACGTCTATGCAACCAAAAAACGACATTTACCAGACAAACGGCCTG
TGTCACGACTATTGCATATCACAAAACCAAGCCTATGCAATTACGCAGGGCAACTCGTGTTGGTGCTCAAACTAT
ACTCCCGCAAAGAGCAAGCAGGTCGACACTGGCTCTTGCGATAAGCCATGCCCGGCATACCCCTCAGAAATGTGC
GGCGGCAATGGACTCTTTAGCTATATTGCCCTCAATGCCTCGCCCGCCGGCGTGCGCCCCGAAGAGAGCAAACCT
TCACCTTCTTCTCCCCCGCCGCCCCCGCCGTCTCCTTCAGAGACGAGCACAAGCTCAACACCGACACCGACACCG
ACTGACGACGCCAACACGAGCAGCAGCAGCAGCAGCTCAGTGGAGCGTCTTCCCGCCACGTCGATTGTGCAAACG
GTGACTGCTGGCGGCACCATTCGCACTGTGACGGTTATTCCCTCGCCAACGGACGACGTGGCCAACAGTGACAGC
GCGCGATCTAGAAACCGCGACGGCGATGGCGGCGGCGGAATCGGCCGAGGCGGCGTCGTGGGCATTGTTGTTGGC
TGCATCGTGGGCGTCTTGAGCGTGGCGGGAGCCATCATGTTTTGGTGGCTACGACGCAAGCGAATTGCCGAACAA
GAGGCGGCGGGCGACGATCCCAGCCTCCGAGGCAGCTCTTCGGGCATGATTGGCGGCAGACCGGAAATGGCGCCC
GGCTCTCCAGGCTCGACGGGCAACCGCAGCAGCATGCTGAATATCGACCCCCGCATGGACCCCTTCAAGCAGGGT
CTCTATGCCCGTGCGGGCAGCCACGAAAGCGTCAATACGCTGCGCGACGAGCACGACTACTCTCGTCGCATCCAT
CCTGCAAAGGTGCTGCGAGCTACTAACCCAGATCCTGTTGCTGGCGATGACGCATAG
Transcript >OphauB2|603
ATGGCTTCTGTTTTGAAGAGGGCGCCCGCCGCGGGCAGCCTCTTGTTGATGGCGTCGGTGTGCGCAGCGCTGGAC
CCGAGCATCTGCGCCAGCTTCAACACTGCCACGTCTATGCAACCAAAAAACGACATTTACCAGACAAACGGCCTG
TGTCACGACTATTGCATATCACAAAACCAAGCCTATGCAATTACGCAGGGCAACTCGTGTTGGTGCTCAAACTAT
ACTCCCGCAAAGAGCAAGCAGGTCGACACTGGCTCTTGCGATAAGCCATGCCCGGCATACCCCTCAGAAATGTGC
GGCGGCAATGGACTCTTTAGCTATATTGCCCTCAATGCCTCGCCCGCCGGCGTGCGCCCCGAAGAGAGCAAACCT
TCACCTTCTTCTCCCCCGCCGCCCCCGCCGTCTCCTTCAGAGACGAGCACAAGCTCAACACCGACACCGACACCG
ACTGACGACGCCAACACGAGCAGCAGCAGCAGCAGCTCAGTGGAGCGTCTTCCCGCCACGTCGATTGTGCAAACG
GTGACTGCTGGCGGCACCATTCGCACTGTGACGGTTATTCCCTCGCCAACGGACGACGTGGCCAACAGTGACAGC
GCGCGATCTAGAAACCGCGACGGCGATGGCGGCGGCGGAATCGGCCGAGGCGGCGTCGTGGGCATTGTTGTTGGC
TGCATCGTGGGCGTCTTGAGCGTGGCGGGAGCCATCATGTTTTGGTGGCTACGACGCAAGCGAATTGCCGAACAA
GAGGCGGCGGGCGACGATCCCAGCCTCCGAGGCAGCTCTTCGGGCATGATTGGCGGCAGACCGGAAATGGCGCCC
GGCTCTCCAGGCTCGACGGGCAACCGCAGCAGCATGCTGAATATCGACCCCCGCATGGACCCCTTCAAGCAGGGT
CTCTATGCCCGTGCGGGCAGCCACGAAAGCGTCAATACGCTGCGCGACGAGCACGACTACTCTCGTCGCATCCAT
CCTGCAAAGGTGCTGCGAGCTACTAACCCAGATCCTGTTGCTGGCGATGACGCATAG
Gene >OphauB2|603
ATGGCTTCTGTTTTGAAGAGGGCGCCCGCCGCGGGCAGCCTCTTGTTGATGGCGTCGGTGTGCGCAGCGCTGGAC
CCGAGCATCTGCGCCAGCTTCAACACTGCCACGTCTATGCAACCAAGTAAGTCCTGTTGGCCGAAACGCACCTCG
AGGCTTGGGCTCATTGCTGGCAGAAAACGACATTTACCAGACAAACGGCCTGTGTCACGACTATTGCATATCACA
AAACCAAGCCTATGCAATTACGCAGGGCAACTCGTGTTGGTGCTCAAACTATACTCCCGCAAAGAGCAAGCAGGT
CGACACTGGCTCTTGCGATAAGCCATGCCCGGCATACCCCTCAGAAATGTGCGGCGGCAATGGACTCTTTAGCTA
TATTGCCCTCAATGCCTCGCCCGCCGGCGTGCGCCCCGAAGAGAGCAAACCTTCACCTTCTTCTCCCCCGCCGCC
CCCGCCGTCTCCTTCAGAGGTGAGTCTAGGATTGTCTTGTTTCTTGTCTTTATTCTCGTGTCTTCAACTACAAGT
GGAGTTTGTCGCTGGCGTTTATGTTTTGGCTTTTTTTTTTTCTCTCGTATTTTCCGCTCGACGCAAACAGGACCA
GACCTCGTTTGCAGTGTGCATCCGGCCTCGTGGAGGAACAAAGGGCTTAATTGTCTGCATGATTTCAGGCCGAAA
CCGCGACCGCGACAATGTGGAAGACTCAAACTGTGCAGGACACAGTGACTCAATCTGCTTCCCCTCCCCCTCCCC
CTCCACAAACTACTTCAAGCAGTAGTTCTACTTTAGTACGGTCACATTGCCCTATTTCCAAGGAGAAAAAGAATG
GCTTGCACTGGGAAGAGAGACGGCGAGGCGTGAGGCTAACTCTGGTGGTTTAGACGAGCACAAGCTCAACACCGA
CACCGACACCGACTGACGACGCCAACACGAGCAGCAGCAGCAGCAGCTCAGTGGAGCGTCTTCCCGCCACGTCGA
TTGTGCAAACGGTGACTGCTGGCGGCACCATTCGCACTGTGACGGTTATTCCCTCGCCAACGGACGACGTGGCCA
ACAGTGACAGCGCGCGATCTAGAAACCGCGACGGCGATGGCGGCGGCGGAATCGGCCGAGGCGGCGTCGTGGGCA
TTGTTGTTGGCTGCATCGTGGGCGTCTTGAGCGTGGCGGGAGCCATCATGTTTTGGTGGCTACGACGCAAGCGAA
TTGCCGAACAAGAGGCGGCGGGCGACGATCCCAGCCTCCGAGGCAGCTCTTCGGGCATGATTGGCGGCAGACCGG
AAATGGCGCCCGGCTCTCCAGGCTCGACGGGCAACCGCAGCAGCATGCTGAATATCGACCCCCGCATGGACCCCT
TCAAGCAGGGTCTCTATGCCCGTGCGGGCAGCCACGAAAGCGTCAATACGCTGCGCGACGAGCACGACTACTCTC
GTCGCATCCATCCTGCAAAGGTGCTGCGAGCTACTAACCCAGATCCTGTTGCTGGCGATGACGCATAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail