Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|6026
Gene name
LocationContig_50:113933..117942
Strand-
Gene length (bp)4009
Transcript length (bp)3885
Coding sequence length (bp)3885
Protein length (aa) 1295

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF16212 PhoLip_ATPase_C Phospholipid-translocating P-type ATPase C-terminal 1.4E-50 1058 1285
PF16209 PhoLip_ATPase_N Phospholipid-translocating ATPase N-terminal 2.4E-15 162 214
PF00702 Hydrolase haloacid dehalogenase-like hydrolase 4.0E-07 619 937
PF13246 Cation_ATPase Cation transport ATPase (P-type) 9.2E-06 710 820

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P40527|ATC7_YEAST Probable phospholipid-transporting ATPase NEO1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NEO1 PE=1 SV=1 1 1293 0.0E+00
sp|F1Q4S1|ATP9B_DANRE Probable phospholipid-transporting ATPase IIB OS=Danio rerio GN=atp9b PE=3 SV=1 94 1291 0.0E+00
sp|A1A4J6|ATP9B_BOVIN Probable phospholipid-transporting ATPase IIB OS=Bos taurus GN=ATP9B PE=2 SV=1 166 1291 0.0E+00
sp|O43861|ATP9B_HUMAN Probable phospholipid-transporting ATPase IIB OS=Homo sapiens GN=ATP9B PE=2 SV=4 166 1291 0.0E+00
sp|P98195|ATP9B_MOUSE Probable phospholipid-transporting ATPase IIB OS=Mus musculus GN=Atp9b PE=1 SV=4 66 1291 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P40527|ATC7_YEAST Probable phospholipid-transporting ATPase NEO1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NEO1 PE=1 SV=1 1 1293 0.0E+00
sp|F1Q4S1|ATP9B_DANRE Probable phospholipid-transporting ATPase IIB OS=Danio rerio GN=atp9b PE=3 SV=1 94 1291 0.0E+00
sp|A1A4J6|ATP9B_BOVIN Probable phospholipid-transporting ATPase IIB OS=Bos taurus GN=ATP9B PE=2 SV=1 166 1291 0.0E+00
sp|O43861|ATP9B_HUMAN Probable phospholipid-transporting ATPase IIB OS=Homo sapiens GN=ATP9B PE=2 SV=4 166 1291 0.0E+00
sp|P98195|ATP9B_MOUSE Probable phospholipid-transporting ATPase IIB OS=Mus musculus GN=Atp9b PE=1 SV=4 66 1291 0.0E+00
sp|D4ABB8|ATP9B_RAT Probable phospholipid-transporting ATPase IIB OS=Rattus norvegicus GN=Atp9b PE=3 SV=1 64 1291 0.0E+00
sp|O75110|ATP9A_HUMAN Probable phospholipid-transporting ATPase IIA OS=Homo sapiens GN=ATP9A PE=1 SV=3 166 1291 0.0E+00
sp|O70228|ATP9A_MOUSE Probable phospholipid-transporting ATPase IIA OS=Mus musculus GN=Atp9a PE=1 SV=3 166 1291 0.0E+00
sp|Q10309|YD56_SCHPO Putative phospholipid-transporting ATPase C6C3.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC6C3.06c PE=3 SV=1 290 1292 0.0E+00
sp|P98205|ALA2_ARATH Phospholipid-transporting ATPase 2 OS=Arabidopsis thaliana GN=ALA2 PE=1 SV=1 170 1292 2.0E-117
sp|Q9XIE6|ALA3_ARATH Phospholipid-transporting ATPase 3 OS=Arabidopsis thaliana GN=ALA3 PE=1 SV=2 161 1293 9.0E-113
sp|P98200|AT8A2_MOUSE Phospholipid-transporting ATPase IB OS=Mus musculus GN=Atp8a2 PE=1 SV=1 154 1171 3.0E-109
sp|O94296|YOOC_SCHPO Probable phospholipid-transporting ATPase C887.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC887.12 PE=3 SV=1 130 1293 4.0E-109
sp|Q9Y2Q0|AT8A1_HUMAN Phospholipid-transporting ATPase IA OS=Homo sapiens GN=ATP8A1 PE=1 SV=1 136 1174 9.0E-109
sp|P70704|AT8A1_MOUSE Phospholipid-transporting ATPase IA OS=Mus musculus GN=Atp8a1 PE=1 SV=2 136 1293 1.0E-108
sp|Q5BL50|AT8B1_XENTR Phospholipid-transporting ATPase IC OS=Xenopus tropicalis GN=atp8b1 PE=2 SV=1 163 1285 6.0E-108
sp|C7EXK4|AT8A2_BOVIN Phospholipid-transporting ATPase IB OS=Bos taurus GN=ATP8A2 PE=1 SV=4 154 1171 1.0E-107
sp|Q9NTI2|AT8A2_HUMAN Phospholipid-transporting ATPase IB OS=Homo sapiens GN=ATP8A2 PE=1 SV=2 154 1171 3.0E-107
sp|P98204|ALA1_ARATH Phospholipid-transporting ATPase 1 OS=Arabidopsis thaliana GN=ALA1 PE=2 SV=1 89 1289 6.0E-107
sp|Q29449|AT8A1_BOVIN Probable phospholipid-transporting ATPase IA OS=Bos taurus GN=ATP8A1 PE=1 SV=2 136 1293 2.0E-105
sp|P98199|AT8B2_MOUSE Phospholipid-transporting ATPase ID OS=Mus musculus GN=Atp8b2 PE=2 SV=2 166 1285 5.0E-102
sp|P57792|ALA12_ARATH Probable phospholipid-transporting ATPase 12 OS=Arabidopsis thaliana GN=ALA12 PE=2 SV=1 163 1175 2.0E-101
sp|P98198|AT8B2_HUMAN Phospholipid-transporting ATPase ID OS=Homo sapiens GN=ATP8B2 PE=1 SV=2 162 1285 9.0E-101
sp|Q9LVK9|ALA7_ARATH Probable phospholipid-transporting ATPase 7 OS=Arabidopsis thaliana GN=ALA7 PE=3 SV=3 166 1293 9.0E-101
sp|P39524|ATC3_YEAST Probable phospholipid-transporting ATPase DRS2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DRS2 PE=1 SV=2 167 1293 1.0E-100
sp|Q8TF62|AT8B4_HUMAN Probable phospholipid-transporting ATPase IM OS=Homo sapiens GN=ATP8B4 PE=1 SV=3 166 1285 4.0E-100
sp|Q9SLK6|ALA6_ARATH Phospholipid-transporting ATPase 6 OS=Arabidopsis thaliana GN=ALA6 PE=1 SV=2 166 1293 6.0E-100
sp|O36028|ATCZ_SCHPO Putative phospholipid-transporting ATPase C4F10.16c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC4F10.16c PE=3 SV=1 65 1285 7.0E-100
sp|P98196|AT11A_HUMAN Probable phospholipid-transporting ATPase IH OS=Homo sapiens GN=ATP11A PE=1 SV=3 166 1294 2.0E-99
sp|Q9Y2G3|AT11B_HUMAN Probable phospholipid-transporting ATPase IF OS=Homo sapiens GN=ATP11B PE=1 SV=2 144 1292 5.0E-98
sp|Q9SX33|ALA9_ARATH Putative phospholipid-transporting ATPase 9 OS=Arabidopsis thaliana GN=ALA9 PE=3 SV=1 167 1189 1.0E-97
sp|Q148W0|AT8B1_MOUSE Phospholipid-transporting ATPase IC OS=Mus musculus GN=Atp8b1 PE=1 SV=2 163 1292 4.0E-97
sp|A3FIN4|AT8B5_MOUSE Phospholipid-transporting ATPase FetA OS=Mus musculus GN=Atp8b5 PE=2 SV=1 167 1157 5.0E-97
sp|O43520|AT8B1_HUMAN Phospholipid-transporting ATPase IC OS=Homo sapiens GN=ATP8B1 PE=1 SV=3 163 1292 1.0E-96
sp|Q9SGG3|ALA5_ARATH Probable phospholipid-transporting ATPase 5 OS=Arabidopsis thaliana GN=ALA5 PE=3 SV=1 166 1293 1.0E-96
sp|P98197|AT11A_MOUSE Probable phospholipid-transporting ATPase IH OS=Mus musculus GN=Atp11a PE=1 SV=1 166 1293 2.0E-96
sp|Q9U280|TAT1_CAEEL Phospholipid-transporting ATPase tat-1 OS=Caenorhabditis elegans GN=tat-1 PE=3 SV=3 392 1246 2.0E-96
sp|Q9LK90|ALA8_ARATH Probable phospholipid-transporting ATPase 8 OS=Arabidopsis thaliana GN=ALA8 PE=3 SV=1 167 1274 2.0E-95
sp|Q9LI83|ALA10_ARATH Phospholipid-transporting ATPase 10 OS=Arabidopsis thaliana GN=ALA10 PE=3 SV=1 151 1292 3.0E-95
sp|P32660|ATC5_YEAST Phospholipid-transporting ATPase DNF1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DNF1 PE=1 SV=2 166 1180 9.0E-95
sp|Q9SAF5|ALA11_ARATH Probable phospholipid-transporting ATPase 11 OS=Arabidopsis thaliana GN=ALA11 PE=2 SV=1 147 1288 3.0E-94
sp|Q9N0Z4|AT11B_RABIT Probable phospholipid-transporting ATPase IF (Fragment) OS=Oryctolagus cuniculus GN=ATP11B PE=1 SV=2 153 1292 5.0E-94
sp|Q8NB49|AT11C_HUMAN Phospholipid-transporting ATPase IG OS=Homo sapiens GN=ATP11C PE=1 SV=3 154 1259 3.0E-91
sp|Q12675|ATC4_YEAST Phospholipid-transporting ATPase DNF2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DNF2 PE=1 SV=1 167 1293 4.0E-88
sp|Q6UQ17|AT8B3_MOUSE Phospholipid-transporting ATPase IK OS=Mus musculus GN=Atp8b3 PE=1 SV=1 166 1283 6.0E-88
sp|Q9LNQ4|ALA4_ARATH Probable phospholipid-transporting ATPase 4 OS=Arabidopsis thaliana GN=ALA4 PE=3 SV=2 316 1293 1.0E-87
sp|Q09891|ATCX_SCHPO Putative phospholipid-transporting ATPase C24B11.12c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC24B11.12c PE=3 SV=1 167 1216 1.0E-87
sp|Q9QZW0|AT11C_MOUSE Phospholipid-transporting ATPase 11C OS=Mus musculus GN=Atp11c PE=1 SV=2 154 1259 5.0E-86
sp|O60423|AT8B3_HUMAN Phospholipid-transporting ATPase IK OS=Homo sapiens GN=ATP8B3 PE=2 SV=4 163 1284 1.0E-68
sp|O94823|AT10B_HUMAN Probable phospholipid-transporting ATPase VB OS=Homo sapiens GN=ATP10B PE=2 SV=2 720 1237 9.0E-63
sp|Q9GKS6|AT10D_MACFA Probable phospholipid-transporting ATPase VD (Fragment) OS=Macaca fascicularis GN=ATP10D PE=2 SV=1 728 1180 1.0E-61
sp|Q9P241|AT10D_HUMAN Probable phospholipid-transporting ATPase VD OS=Homo sapiens GN=ATP10D PE=2 SV=3 728 1285 2.0E-61
sp|Q8K2X1|AT10D_MOUSE Probable phospholipid-transporting ATPase VD OS=Mus musculus GN=Atp10d PE=2 SV=2 728 1235 2.0E-58
sp|O54827|AT10A_MOUSE Probable phospholipid-transporting ATPase VA OS=Mus musculus GN=Atp10a PE=1 SV=4 715 1222 2.0E-56
sp|O60312|AT10A_HUMAN Probable phospholipid-transporting ATPase VA OS=Homo sapiens GN=ATP10A PE=2 SV=2 718 1222 3.0E-56
sp|Q12674|ATC8_YEAST Probable phospholipid-transporting ATPase DNF3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DNF3 PE=1 SV=1 837 1258 6.0E-52
sp|Q9UT43|YFRD_SCHPO Putative phospholipid-transporting ATPase C821.13c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC821.13c PE=1 SV=2 832 1285 2.0E-44
sp|Q9UT43|YFRD_SCHPO Putative phospholipid-transporting ATPase C821.13c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC821.13c PE=1 SV=2 170 820 4.0E-38
sp|Q12674|ATC8_YEAST Probable phospholipid-transporting ATPase DNF3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DNF3 PE=1 SV=1 167 645 4.0E-34
sp|Q10309|YD56_SCHPO Putative phospholipid-transporting ATPase C6C3.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC6C3.06c PE=3 SV=1 152 253 2.0E-27
sp|O54827|AT10A_MOUSE Probable phospholipid-transporting ATPase VA OS=Mus musculus GN=Atp10a PE=1 SV=4 151 649 6.0E-26
sp|O94823|AT10B_HUMAN Probable phospholipid-transporting ATPase VB OS=Homo sapiens GN=ATP10B PE=2 SV=2 166 648 4.0E-25
sp|O60312|AT10A_HUMAN Probable phospholipid-transporting ATPase VA OS=Homo sapiens GN=ATP10A PE=2 SV=2 170 700 3.0E-24
sp|Q9P241|AT10D_HUMAN Probable phospholipid-transporting ATPase VD OS=Homo sapiens GN=ATP10D PE=2 SV=3 170 648 6.0E-20
sp|Q9LF79|ACA8_ARATH Calcium-transporting ATPase 8, plasma membrane-type OS=Arabidopsis thaliana GN=ACA8 PE=1 SV=1 603 1091 1.0E-16
sp|P54678|ATC1_DICDI Calcium-transporting ATPase PAT1 OS=Dictyostelium discoideum GN=patA PE=2 SV=2 604 1091 8.0E-16
sp|O64806|ACA7_ARATH Putative calcium-transporting ATPase 7, plasma membrane-type OS=Arabidopsis thaliana GN=ACA7 PE=3 SV=2 603 1234 5.0E-15
sp|Q4VNC1|AT134_HUMAN Probable cation-transporting ATPase 13A4 OS=Homo sapiens GN=ATP13A4 PE=2 SV=3 615 1166 7.0E-15
sp|Q9SZR1|ACA10_ARATH Calcium-transporting ATPase 10, plasma membrane-type OS=Arabidopsis thaliana GN=ACA10 PE=1 SV=2 603 1091 2.0E-14
sp|O81108|ACA2_ARATH Calcium-transporting ATPase 2, plasma membrane-type OS=Arabidopsis thaliana GN=ACA2 PE=1 SV=1 603 1234 2.0E-14
sp|P22189|ATC3_SCHPO Calcium-transporting ATPase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cta3 PE=1 SV=1 524 1094 2.0E-14
sp|Q3TYU2|AT135_MOUSE Probable cation-transporting ATPase 13A5 OS=Mus musculus GN=Atp13a5 PE=2 SV=2 568 1098 7.0E-14
sp|Q9HDW7|ATC2_SCHPO Calcium-transporting ATPase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pmc1 PE=3 SV=1 568 1180 8.0E-14
sp|Q8K2X1|AT10D_MOUSE Probable phospholipid-transporting ATPase VD OS=Mus musculus GN=Atp10d PE=2 SV=2 319 648 1.0E-13
sp|Q9LU41|ACA9_ARATH Calcium-transporting ATPase 9, plasma membrane-type OS=Arabidopsis thaliana GN=ACA9 PE=2 SV=2 603 1279 2.0E-13
sp|Q2QMX9|ACA1_ORYSJ Calcium-transporting ATPase 1, plasma membrane-type OS=Oryza sativa subsp. japonica GN=Os12g0586600 PE=2 SV=1 603 1091 3.0E-13
sp|O34431|ATCL_BACSU Calcium-transporting ATPase OS=Bacillus subtilis (strain 168) GN=yloB PE=1 SV=1 603 1093 7.0E-13
sp|Q5XF90|AT134_MOUSE Probable cation-transporting ATPase 13A4 OS=Mus musculus GN=Atp13a4 PE=2 SV=1 774 1072 1.0E-12
sp|P58165|AT2B2_OREMO Plasma membrane calcium-transporting ATPase 2 (Fragment) OS=Oreochromis mossambicus GN=atp2b2 PE=2 SV=1 773 1282 2.0E-12
sp|Q9CTG6|AT132_MOUSE Probable cation-transporting ATPase 13A2 OS=Mus musculus GN=Atp13a2 PE=2 SV=3 770 1063 3.0E-12
sp|O74431|ATC9_SCHPO Probable cation-transporting ATPase C1672.11c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1672.11c PE=3 SV=1 774 1067 1.0E-11
sp|Q9NQ11|AT132_HUMAN Probable cation-transporting ATPase 13A2 OS=Homo sapiens GN=ATP13A2 PE=1 SV=2 615 1092 2.0E-11
sp|G5E829|AT2B1_MOUSE Plasma membrane calcium-transporting ATPase 1 OS=Mus musculus GN=Atp2b1 PE=1 SV=1 520 1282 2.0E-11
sp|Q92126|ATP4A_XENLA Potassium-transporting ATPase alpha chain 1 OS=Xenopus laevis GN=atp4a PE=2 SV=3 466 1061 4.0E-11
sp|P20020|AT2B1_HUMAN Plasma membrane calcium-transporting ATPase 1 OS=Homo sapiens GN=ATP2B1 PE=1 SV=3 890 1282 4.0E-11
sp|Q9EPE9|AT131_MOUSE Manganese-transporting ATPase 13A1 OS=Mus musculus GN=Atp13a1 PE=1 SV=2 615 1051 4.0E-11
sp|P11505|AT2B1_RAT Plasma membrane calcium-transporting ATPase 1 OS=Rattus norvegicus GN=Atp2b1 PE=1 SV=2 520 1282 5.0E-11
sp|Q9LT02|PDR2_ARATH Probable manganese-transporting ATPase PDR2 OS=Arabidopsis thaliana GN=PDR2 PE=1 SV=1 615 1052 7.0E-11
sp|Q9HD20|AT131_HUMAN Manganese-transporting ATPase 13A1 OS=Homo sapiens GN=ATP13A1 PE=1 SV=2 615 1051 8.0E-11
sp|P23220|AT2B1_PIG Plasma membrane calcium-transporting ATPase 1 OS=Sus scrofa GN=ATP2B1 PE=2 SV=1 890 1282 9.0E-11
sp|Q9U280|TAT1_CAEEL Phospholipid-transporting ATPase tat-1 OS=Caenorhabditis elegans GN=tat-1 PE=3 SV=3 162 257 3.0E-10
sp|Q6Q477|AT2B4_MOUSE Plasma membrane calcium-transporting ATPase 4 OS=Mus musculus GN=Atp2b4 PE=1 SV=1 773 1282 3.0E-10
sp|Q9TV52|AT12A_RABIT Potassium-transporting ATPase alpha chain 2 OS=Oryctolagus cuniculus GN=ATP12A PE=2 SV=1 474 1062 5.0E-10
sp|P38929|ATC2_YEAST Calcium-transporting ATPase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PMC1 PE=1 SV=1 773 1199 2.0E-09
sp|P54209|ATC1_DUNBI Cation-transporting ATPase CA1 OS=Dunaliella bioculata GN=CA1 PE=2 SV=1 603 1182 3.0E-09
sp|Q03669|AT2A2_CHICK Sarcoplasmic/endoplasmic reticulum calcium ATPase 2 OS=Gallus gallus GN=ATP2A2 PE=2 SV=2 483 1123 3.0E-09
sp|O14072|ATC4_SCHPO Manganese-transporting ATPase 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cta4 PE=3 SV=1 702 1050 3.0E-09
sp|P13587|ATN1_YEAST Sodium transport ATPase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ENA1 PE=1 SV=1 778 1061 4.0E-09
sp|Q01896|ATN2_YEAST Sodium transport ATPase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ENA2 PE=1 SV=1 778 1061 4.0E-09
sp|Q12691|ATN5_YEAST Sodium transport ATPase 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ENA5 PE=1 SV=1 778 1061 4.0E-09
sp|P35315|ATC_TRYBB Probable calcium-transporting ATPase OS=Trypanosoma brucei brucei GN=TBA1 PE=3 SV=1 886 1102 4.0E-09
sp|Q00804|AT2B1_RABIT Plasma membrane calcium-transporting ATPase 1 OS=Oryctolagus cuniculus GN=ATP2B1 PE=2 SV=2 888 1105 5.0E-09
sp|Q5ZKB7|AT134_CHICK Probable cation-transporting ATPase 13A4 OS=Gallus gallus GN=ATP13A4 PE=2 SV=1 772 1063 1.0E-08
sp|P90747|AT131_CAEEL Probable manganese-transporting ATPase catp-8 OS=Caenorhabditis elegans GN=catp-8 PE=3 SV=3 772 1049 2.0E-08
sp|Q5XF89|AT133_MOUSE Probable cation-transporting ATPase 13A3 OS=Mus musculus GN=Atp13a3 PE=1 SV=1 769 1063 3.0E-08
sp|Q9H7F0|AT133_HUMAN Probable cation-transporting ATPase 13A3 OS=Homo sapiens GN=ATP13A3 PE=1 SV=4 771 1063 3.0E-08
sp|Q64392|AT12A_CAVPO Potassium-transporting ATPase alpha chain 2 OS=Cavia porcellus GN=ATP12A PE=2 SV=1 474 1062 3.0E-08
sp|O22218|ACA4_ARATH Calcium-transporting ATPase 4, plasma membrane-type OS=Arabidopsis thaliana GN=ACA4 PE=1 SV=1 773 1271 2.0E-07
sp|P98194|AT2C1_HUMAN Calcium-transporting ATPase type 2C member 1 OS=Homo sapiens GN=ATP2C1 PE=1 SV=3 575 1091 2.0E-07
sp|Q9LNQ4|ALA4_ARATH Probable phospholipid-transporting ATPase 4 OS=Arabidopsis thaliana GN=ALA4 PE=3 SV=2 166 252 7.0E-07
sp|Q27533|YH2M_CAEEL Probable cation-transporting ATPase W08D2.5 OS=Caenorhabditis elegans GN=W08D2.5 PE=3 SV=2 615 1063 3.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 55 0.45

Transmembrane Domains

Domain # Start End Length
1 1121 1140 19
2 1170 1192 22
3 1197 1219 22
4 1226 1248 22
5 1252 1274 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|6026
MPSTPPYRPNEPPDSPSNDSDSDLDLDVHLDELDPIASNSQRRGKAAPEHRPSRIALRNLRMRGPRRSGNRSGRG
FSDGDDDASRHRDHDDVYKQQWSDGGGGEDDVPLLGGEPRPHARRGSRSSIRLPSFLAGPKKTGEADAQELEQDD
PSSSRLVTVGTHQTSRFPANIVSNAKYTALTFLPVTLYNEFSFFFNMYFLLVALSQAIPALRIGYLSTYVAPLAF
VLCITMGKEAYDDIERRRRDTEANSEEYKMLIFADPESRPATLRPRRPLKSDTLRRGARKSRSGRHDLSDIQEEE
QDQVPQPSSYVQQVSRKSKDLRVGDVLKLSKGQRVPADVVILQCCTSENLAALLPSKEPPGGQELLGLEESEQGP
SKGKQPAQEPSSSSHAAESGATGETFIRTDQLDGETDWKLRLASPLTQNLAPEEFVRLKVTGGKPDKKVNEFVGR
VELLPPRQGGLLRHDSPEHGDDDSSSTPLSIDNTAWANTVIASQGTTLAVIMYTGPQTRSALSTSPSRSKTGLLE
YEINSLTKILCALTLALSVILVALHGFETTGGNVWYIKIMRFLVLFSTIVPISLRVNLDMGKSAYSRFIQHDPGI
PGALVRTSTIPEDLGRIEYLLSDKTGTLTQNEMDMKKIHVGTVSYANEAMDEVSAYVRQGFHVQPTTDAASQSML
ITPSSTYSSTINVGTTRTRREIGARVRDVVLALALCHNVTPTEDTEDGRQVTSYQASSPDEIAIVKWTESVGLKL
AYRDRTSMSLESTDNHRVVVRVRILQVFPFTSDGKRMGIVVHFQEDANADKTDLASGEIWFYQKGADTVMSSIVA
SNDWLDEETANMAREGLRTLVVGRKKLTLQQYHEFSEQYQDASLSMMGRDAAMQRVVSHYLESDLELLGVTGVED
KLQKDVKPSLELLRNAGIKIWMLTGDKVETARCVAISSKLVARGQFIYTITKLKRESVQDHLDFLHSKRDACLLI
DGESLHLMLAHFRIDFISIAVLLPTVVACRCSPTQKADIAKLIKEYTKKRVLCIGDGGNDVSMIQAADVGVGIVG
KEGRQASLAADFSIEQFYHLVKLLVWHGRNSYKRSAKLAQFVIHRGLIIAVCQTFYSIALKFEPEGLYKDWLLVG
YATVYTAAPVLSLVLDKDVDENLANLYPELYKELTSGRSLSYRTFFVWVFVSIYQGGMIQGLSQILTEVDGPRMV
AVSYTVLVLNELIMVAIEITTWHPIMIISILGTFFVYVGSIPFLGGYFDLEFIITWGFLWRVLAIGAISLIPPYA
GKLIRRAIKPPSYRKVQDR*
Coding >OphauB2|6026
ATGCCTTCAACACCACCGTACCGCCCGAATGAGCCCCCCGATTCGCCCTCCAACGACTCCGATTCGGACCTTGAC
CTCGACGTCCATCTCGACGAGCTCGATCCCATCGCGTCGAATTCCCAGAGACGAGGGAAAGCCGCCCCCGAGCAT
CGGCCGTCAAGAATAGCTCTGAGAAACTTACGCATGCGAGGCCCTCGCCGTTCTGGCAACCGCAGTGGCCGCGGC
TTCTCGGATGGAGACGACGACGCCTCCCGACACCGCGACCATGATGATGTCTATAAACAACAGTGGTCAGATGGC
GGTGGTGGCGAGGACGATGTGCCGCTCTTGGGAGGCGAGCCCAGACCACATGCGCGTCGCGGCTCCCGGTCCAGC
ATTCGTCTTCCCAGCTTCCTCGCTGGCCCCAAGAAGACGGGAGAAGCGGATGCACAAGAGCTAGAGCAAGACGAT
CCATCGTCATCGAGACTGGTGACTGTTGGCACCCATCAGACGTCTAGGTTTCCGGCCAATATAGTCTCCAACGCA
AAGTACACGGCACTGACGTTTCTGCCCGTTACGCTATACAACGAGTTCTCCTTCTTCTTCAACATGTACTTTTTG
TTGGTTGCCCTCTCGCAGGCAATACCCGCGCTTCGCATAGGCTATCTCTCGACCTATGTGGCGCCCTTGGCTTTT
GTTCTCTGTATCACTATGGGGAAGGAGGCCTATGACGATATCGAGAGGCGGAGGAGAGACACCGAGGCCAACTCT
GAAGAGTACAAGATGCTCATTTTTGCTGACCCCGAGTCTCGTCCCGCCACGCTGCGTCCTCGCCGCCCTCTCAAG
TCTGACACGCTGAGGCGTGGGGCGCGCAAGTCGCGGAGTGGCCGGCATGATCTCTCTGACATTCAAGAGGAGGAA
CAAGACCAAGTGCCTCAGCCCTCGTCGTACGTGCAACAAGTCAGCCGCAAGTCCAAGGATCTTCGAGTTGGCGAT
GTGCTCAAGTTGAGCAAGGGCCAGCGGGTGCCTGCAGATGTTGTCATCTTGCAGTGCTGTACATCTGAAAATCTG
GCTGCTCTTTTGCCAAGCAAGGAACCCCCCGGCGGCCAAGAGCTCCTCGGGCTTGAAGAGAGCGAGCAGGGCCCG
TCAAAGGGCAAACAGCCTGCGCAAGAGCCTTCTTCCAGCAGCCACGCCGCCGAGTCGGGCGCCACTGGAGAAACC
TTTATCAGGACGGATCAGCTCGACGGCGAGACGGACTGGAAGCTGAGACTAGCTTCGCCCCTGACTCAAAATCTT
GCACCCGAAGAGTTTGTTCGGCTCAAGGTCACGGGCGGAAAGCCGGACAAGAAAGTCAATGAGTTTGTGGGAAGA
GTCGAGCTTCTTCCTCCCCGACAAGGTGGTTTGCTTCGTCATGACTCGCCCGAGCACGGCGATGACGATTCGAGC
TCGACGCCCTTGTCTATTGACAACACGGCGTGGGCCAACACAGTCATCGCCTCTCAGGGCACGACGCTGGCCGTC
ATCATGTATACGGGGCCGCAGACGCGCTCTGCCCTGTCCACCTCGCCCTCGCGCTCCAAAACGGGCCTGCTCGAG
TACGAAATCAACTCCCTGACCAAGATCCTGTGTGCCCTCACCTTGGCCTTGTCTGTTATTCTCGTCGCTCTCCAC
GGTTTCGAAACGACAGGAGGCAATGTATGGTACATTAAGATTATGCGCTTTCTTGTCCTCTTCTCGACAATTGTG
CCCATTAGTCTGCGCGTCAACCTGGACATGGGCAAAAGCGCCTACTCGAGGTTCATTCAGCATGACCCTGGCATC
CCTGGCGCTCTTGTGCGCACAAGCACGATACCAGAGGACCTTGGGCGCATCGAATACCTGCTGAGTGATAAGACG
GGAACGCTGACGCAAAATGAAATGGACATGAAGAAGATACACGTTGGCACCGTGTCATATGCCAACGAAGCCATG
GATGAGGTTTCTGCCTATGTTCGACAAGGCTTTCACGTCCAACCCACGACGGACGCGGCTTCTCAGTCTATGCTC
ATTACGCCTTCCTCGACGTATTCTTCCACCATCAACGTTGGCACAACTCGCACGCGGAGAGAGATTGGAGCGCGT
GTGCGCGATGTCGTTTTGGCTTTGGCTCTCTGCCACAACGTGACGCCGACGGAGGACACGGAAGATGGCAGGCAA
GTCACGTCTTACCAAGCCTCCTCGCCCGACGAAATCGCCATTGTCAAATGGACCGAGTCTGTGGGTCTCAAACTA
GCCTATCGCGACCGCACAAGCATGTCGCTCGAGTCGACAGATAATCACCGAGTCGTTGTCCGGGTTCGCATCCTG
CAGGTCTTTCCCTTTACTTCGGATGGCAAGCGCATGGGCATAGTGGTGCACTTTCAGGAGGATGCAAACGCAGAC
AAGACGGACCTGGCTAGCGGCGAGATTTGGTTCTACCAAAAGGGGGCCGACACAGTCATGAGCTCCATTGTTGCT
TCCAACGACTGGCTGGACGAAGAGACAGCCAACATGGCGCGCGAAGGGCTGCGCACCTTGGTCGTTGGTCGCAAA
AAGCTGACGTTGCAGCAGTATCACGAGTTTTCAGAACAGTACCAGGATGCTTCCCTGTCCATGATGGGCCGCGAC
GCCGCCATGCAGCGCGTTGTGTCGCATTATCTCGAGAGCGATCTCGAGTTGCTCGGCGTGACAGGCGTTGAAGAC
AAGCTGCAAAAGGACGTCAAGCCGTCTCTGGAGTTGCTGCGTAACGCGGGCATCAAGATATGGATGTTGACGGGT
GACAAGGTGGAAACGGCCAGATGCGTCGCCATTAGTTCCAAACTGGTGGCCAGAGGACAATTCATTTACACCATT
ACCAAGCTCAAACGGGAAAGCGTGCAAGACCATCTCGACTTTTTGCACAGCAAGAGGGATGCCTGTCTCCTCATT
GACGGCGAAAGCCTTCATTTAATGCTGGCCCATTTCCGCATCGACTTCATCTCGATTGCTGTGCTGCTCCCCACT
GTGGTTGCCTGTCGCTGCTCGCCCACGCAAAAGGCCGACATTGCCAAGCTCATCAAGGAGTACACCAAGAAGCGC
GTGCTTTGCATTGGCGACGGTGGCAATGACGTGTCCATGATCCAGGCTGCCGATGTGGGCGTGGGCATTGTGGGA
AAGGAGGGGCGCCAGGCCAGTCTGGCGGCAGACTTTTCCATTGAGCAGTTTTACCACTTGGTCAAGCTGCTAGTA
TGGCACGGACGCAACAGCTACAAACGCAGCGCCAAGTTGGCTCAATTTGTCATTCATCGCGGACTCATCATTGCC
GTATGCCAGACGTTTTATAGCATTGCCCTCAAGTTTGAACCAGAGGGCTTGTACAAGGATTGGCTTCTTGTGGGC
TACGCCACAGTCTATACTGCGGCTCCCGTACTGTCTCTGGTGCTTGACAAGGACGTGGATGAGAATCTGGCCAAC
CTGTACCCGGAGCTATACAAGGAGCTTACTTCGGGCCGGTCGCTCTCGTACCGCACCTTTTTCGTCTGGGTCTTT
GTGTCTATATACCAGGGTGGCATGATTCAGGGCCTCTCCCAGATCCTGACCGAGGTTGACGGGCCAAGAATGGTG
GCCGTCAGTTACACGGTCCTCGTGCTCAATGAGCTCATCATGGTGGCCATTGAGATTACCACGTGGCATCCAATC
ATGATAATCAGCATCCTCGGTACATTCTTTGTCTATGTTGGATCAATTCCTTTTCTCGGGGGTTATTTCGACCTG
GAATTCATCATAACATGGGGGTTCTTGTGGCGGGTCCTGGCAATTGGAGCCATATCACTTATCCCGCCGTATGCT
GGAAAGCTTATTAGAAGGGCCATTAAGCCTCCGTCTTATAGAAAAGTCCAGGACAGATGA
Transcript >OphauB2|6026
ATGCCTTCAACACCACCGTACCGCCCGAATGAGCCCCCCGATTCGCCCTCCAACGACTCCGATTCGGACCTTGAC
CTCGACGTCCATCTCGACGAGCTCGATCCCATCGCGTCGAATTCCCAGAGACGAGGGAAAGCCGCCCCCGAGCAT
CGGCCGTCAAGAATAGCTCTGAGAAACTTACGCATGCGAGGCCCTCGCCGTTCTGGCAACCGCAGTGGCCGCGGC
TTCTCGGATGGAGACGACGACGCCTCCCGACACCGCGACCATGATGATGTCTATAAACAACAGTGGTCAGATGGC
GGTGGTGGCGAGGACGATGTGCCGCTCTTGGGAGGCGAGCCCAGACCACATGCGCGTCGCGGCTCCCGGTCCAGC
ATTCGTCTTCCCAGCTTCCTCGCTGGCCCCAAGAAGACGGGAGAAGCGGATGCACAAGAGCTAGAGCAAGACGAT
CCATCGTCATCGAGACTGGTGACTGTTGGCACCCATCAGACGTCTAGGTTTCCGGCCAATATAGTCTCCAACGCA
AAGTACACGGCACTGACGTTTCTGCCCGTTACGCTATACAACGAGTTCTCCTTCTTCTTCAACATGTACTTTTTG
TTGGTTGCCCTCTCGCAGGCAATACCCGCGCTTCGCATAGGCTATCTCTCGACCTATGTGGCGCCCTTGGCTTTT
GTTCTCTGTATCACTATGGGGAAGGAGGCCTATGACGATATCGAGAGGCGGAGGAGAGACACCGAGGCCAACTCT
GAAGAGTACAAGATGCTCATTTTTGCTGACCCCGAGTCTCGTCCCGCCACGCTGCGTCCTCGCCGCCCTCTCAAG
TCTGACACGCTGAGGCGTGGGGCGCGCAAGTCGCGGAGTGGCCGGCATGATCTCTCTGACATTCAAGAGGAGGAA
CAAGACCAAGTGCCTCAGCCCTCGTCGTACGTGCAACAAGTCAGCCGCAAGTCCAAGGATCTTCGAGTTGGCGAT
GTGCTCAAGTTGAGCAAGGGCCAGCGGGTGCCTGCAGATGTTGTCATCTTGCAGTGCTGTACATCTGAAAATCTG
GCTGCTCTTTTGCCAAGCAAGGAACCCCCCGGCGGCCAAGAGCTCCTCGGGCTTGAAGAGAGCGAGCAGGGCCCG
TCAAAGGGCAAACAGCCTGCGCAAGAGCCTTCTTCCAGCAGCCACGCCGCCGAGTCGGGCGCCACTGGAGAAACC
TTTATCAGGACGGATCAGCTCGACGGCGAGACGGACTGGAAGCTGAGACTAGCTTCGCCCCTGACTCAAAATCTT
GCACCCGAAGAGTTTGTTCGGCTCAAGGTCACGGGCGGAAAGCCGGACAAGAAAGTCAATGAGTTTGTGGGAAGA
GTCGAGCTTCTTCCTCCCCGACAAGGTGGTTTGCTTCGTCATGACTCGCCCGAGCACGGCGATGACGATTCGAGC
TCGACGCCCTTGTCTATTGACAACACGGCGTGGGCCAACACAGTCATCGCCTCTCAGGGCACGACGCTGGCCGTC
ATCATGTATACGGGGCCGCAGACGCGCTCTGCCCTGTCCACCTCGCCCTCGCGCTCCAAAACGGGCCTGCTCGAG
TACGAAATCAACTCCCTGACCAAGATCCTGTGTGCCCTCACCTTGGCCTTGTCTGTTATTCTCGTCGCTCTCCAC
GGTTTCGAAACGACAGGAGGCAATGTATGGTACATTAAGATTATGCGCTTTCTTGTCCTCTTCTCGACAATTGTG
CCCATTAGTCTGCGCGTCAACCTGGACATGGGCAAAAGCGCCTACTCGAGGTTCATTCAGCATGACCCTGGCATC
CCTGGCGCTCTTGTGCGCACAAGCACGATACCAGAGGACCTTGGGCGCATCGAATACCTGCTGAGTGATAAGACG
GGAACGCTGACGCAAAATGAAATGGACATGAAGAAGATACACGTTGGCACCGTGTCATATGCCAACGAAGCCATG
GATGAGGTTTCTGCCTATGTTCGACAAGGCTTTCACGTCCAACCCACGACGGACGCGGCTTCTCAGTCTATGCTC
ATTACGCCTTCCTCGACGTATTCTTCCACCATCAACGTTGGCACAACTCGCACGCGGAGAGAGATTGGAGCGCGT
GTGCGCGATGTCGTTTTGGCTTTGGCTCTCTGCCACAACGTGACGCCGACGGAGGACACGGAAGATGGCAGGCAA
GTCACGTCTTACCAAGCCTCCTCGCCCGACGAAATCGCCATTGTCAAATGGACCGAGTCTGTGGGTCTCAAACTA
GCCTATCGCGACCGCACAAGCATGTCGCTCGAGTCGACAGATAATCACCGAGTCGTTGTCCGGGTTCGCATCCTG
CAGGTCTTTCCCTTTACTTCGGATGGCAAGCGCATGGGCATAGTGGTGCACTTTCAGGAGGATGCAAACGCAGAC
AAGACGGACCTGGCTAGCGGCGAGATTTGGTTCTACCAAAAGGGGGCCGACACAGTCATGAGCTCCATTGTTGCT
TCCAACGACTGGCTGGACGAAGAGACAGCCAACATGGCGCGCGAAGGGCTGCGCACCTTGGTCGTTGGTCGCAAA
AAGCTGACGTTGCAGCAGTATCACGAGTTTTCAGAACAGTACCAGGATGCTTCCCTGTCCATGATGGGCCGCGAC
GCCGCCATGCAGCGCGTTGTGTCGCATTATCTCGAGAGCGATCTCGAGTTGCTCGGCGTGACAGGCGTTGAAGAC
AAGCTGCAAAAGGACGTCAAGCCGTCTCTGGAGTTGCTGCGTAACGCGGGCATCAAGATATGGATGTTGACGGGT
GACAAGGTGGAAACGGCCAGATGCGTCGCCATTAGTTCCAAACTGGTGGCCAGAGGACAATTCATTTACACCATT
ACCAAGCTCAAACGGGAAAGCGTGCAAGACCATCTCGACTTTTTGCACAGCAAGAGGGATGCCTGTCTCCTCATT
GACGGCGAAAGCCTTCATTTAATGCTGGCCCATTTCCGCATCGACTTCATCTCGATTGCTGTGCTGCTCCCCACT
GTGGTTGCCTGTCGCTGCTCGCCCACGCAAAAGGCCGACATTGCCAAGCTCATCAAGGAGTACACCAAGAAGCGC
GTGCTTTGCATTGGCGACGGTGGCAATGACGTGTCCATGATCCAGGCTGCCGATGTGGGCGTGGGCATTGTGGGA
AAGGAGGGGCGCCAGGCCAGTCTGGCGGCAGACTTTTCCATTGAGCAGTTTTACCACTTGGTCAAGCTGCTAGTA
TGGCACGGACGCAACAGCTACAAACGCAGCGCCAAGTTGGCTCAATTTGTCATTCATCGCGGACTCATCATTGCC
GTATGCCAGACGTTTTATAGCATTGCCCTCAAGTTTGAACCAGAGGGCTTGTACAAGGATTGGCTTCTTGTGGGC
TACGCCACAGTCTATACTGCGGCTCCCGTACTGTCTCTGGTGCTTGACAAGGACGTGGATGAGAATCTGGCCAAC
CTGTACCCGGAGCTATACAAGGAGCTTACTTCGGGCCGGTCGCTCTCGTACCGCACCTTTTTCGTCTGGGTCTTT
GTGTCTATATACCAGGGTGGCATGATTCAGGGCCTCTCCCAGATCCTGACCGAGGTTGACGGGCCAAGAATGGTG
GCCGTCAGTTACACGGTCCTCGTGCTCAATGAGCTCATCATGGTGGCCATTGAGATTACCACGTGGCATCCAATC
ATGATAATCAGCATCCTCGGTACATTCTTTGTCTATGTTGGATCAATTCCTTTTCTCGGGGGTTATTTCGACCTG
GAATTCATCATAACATGGGGGTTCTTGTGGCGGGTCCTGGCAATTGGAGCCATATCACTTATCCCGCCGTATGCT
GGAAAGCTTATTAGAAGGGCCATTAAGCCTCCGTCTTATAGAAAAGTCCAGGACAGATGA
Gene >OphauB2|6026
ATGCCTTCAACACCACCGTACCGCCCGAATGAGCCCCCCGATTCGCCCTCCAACGACTCCGATTCGGACCTTGAC
CTCGACGTCCATCTCGACGAGCTCGATCCCATCGCGTCGAATTCCCAGAGACGAGGGAAAGCCGCCCCCGAGCAT
CGGCCGTCAAGAATAGCTCTGAGAAACTTACGCATGCGAGGCCCTCGCCGTTCTGGCAACCGCAGTGGCCGCGGC
TTCTCGGATGGAGACGACGACGCCTCCCGACACCGCGACCATGATGATGTCTATAAACAACAGTGGTCAGATGGC
GGTGGTGGCGAGGACGATGTGCCGCTCTTGGGAGGCGAGCCCAGACCACATGCGCGTCGCGGCTCCCGGTCCAGC
ATTCGTCTTCCCAGCTTCCTCGCTGGCCCCAAGAAGACGGGAGAAGCGGATGCACAAGAGCTAGAGCAAGACGAT
CCATCGTCATCGAGACTGGTGACTGTTGGCACCCATCAGACGTCTAGGTTTCCGGCCAATATAGTCTCCAACGCA
AAGTACACGGCACTGACGTTTCTGCCCGTTACGCTATACAACGAGTTCTCCTTCTTCTTCAACATGTACTTTTTG
TTGGTTGCCCTCTCGCAGGCAATACCCGCGCTTCGCATAGGCTATCTCTCGACCTATGTGGCGCCCTTGGCTTTT
GTTCTCTGTATCACTATGGGGAAGGAGGCCTATGACGATATCGAGAGGCGGAGGAGAGACACCGAGGCCAACTCT
GAAGAGTACAAGATGCTCATTTTTGCTGACCCCGAGTCTCGTCCCGCCACGCTGCGTCCTCGCCGCCCTCTCAAG
TCTGACACGCTGAGGCGTGGGGCGCGCAAGTCGCGGAGTGGCCGGCATGATCTCTCTGACATTCAAGAGGAGGAA
CAAGACCAAGTGCCTCAGCCCTCGTCGTACGTGCAACAAGTCAGCCGCAAGTCCAAGGATCTTCGAGTTGGCGAT
GTGCTCAAGTTGAGCAAGGGCCAGCGGGTGCCTGCAGATGTTGTCATCTTGCAGTGCTGTACATCTGAAAATCTG
GCTGCTCTTTTGCCAAGCAAGGAACCCCCCGGCGGCCAAGAGCTCCTCGGGCTTGAAGAGAGCGAGCAGGGCCCG
TCAAAGGGCAAACAGCCTGCGCAAGAGCCTTCTTCCAGCAGCCACGCCGCCGAGTCGGGCGCCACTGGAGAAACC
TTTATCAGGACGGATCAGCTCGACGGCGAGACGGACTGGAAGCTGAGACTAGCTTCGCCCCTGACTCAAAATCTT
GCACCCGAAGAGTTTGTTCGGCTCAAGGTCACGGGCGGAAAGCCGGACAAGAAAGTCAATGAGTTTGTGGGAAGA
GTCGAGCTTCTTCCTCCCCGACAAGGTGGTTTGCTTCGTCATGACTCGCCCGAGCACGGCGATGACGATTCGAGC
TCGACGCCCTTGTCTATTGACAACACGGCGTGGGCCAACACAGTCATCGCCTCTCAGGGCACGACGCTGGCCGTC
ATCATGTATACGGGGCCGCAGACGCGCTCTGCCCTGTCCACCTCGCCCTCGCGCTCCAAAACGGGCCTGCTCGAG
TACGAAATCAACTCCCTGACCAAGATCCTGTGTGCCCTCACCTTGGCCTTGTCTGTTATTCTCGTCGCTCTCCAC
GGTTTCGAAACGACAGGAGGCAATGTATGGTACATTAAGATTATGCGCTTTCTTGTCCTCTTCTCGACAATTGTG
CCCATTAGTCTGCGCGTCAACCTGGACATGGGCAAAAGCGCCTACTCGAGGTTCATTCAGCATGACCCTGGCATC
CCTGGCGCTCTTGTGCGCACAAGCACGATACCAGAGGACCTTGGGCGCATCGAATACCTGCTGAGTGATAAGACG
GGAACGCTGACGCAAAATGAAATGGACATGAAGAAGATACACGTTGGCACCGTGTCATATGCCAACGAAGCCATG
GATGAGGTTTCTGCCTATGTTCGACAAGGCTTTCACGTCCAACCCACGACGGACGCGGCTTCTCAGTCTATGCTC
ATTACGCCTTCCTCGACGTATTCTTCCACCATCAACGTTGGCACAACTCGCACGCGGAGAGAGATTGGAGCGCGT
GTGCGCGATGTCGTTTTGGCTTTGGCTCTCTGCCACAACGTGACGCCGACGGAGGACACGGAAGATGGCAGGCAA
GTCACGTCTTACCAAGCCTCCTCGCCCGACGAAATCGCCATTGTCAAATGGACCGAGTCTGTGGGTCTCAAACTA
GCCTATCGCGACCGCACAAGCATGTCGCTCGAGTCGACAGATAATCACCGAGTCGTTGTCCGGGTTCGCATCCTG
CAGGTCTTTCCCTTTACTTCGGATGGCAAGCGCATGGGCATAGTGGTGCACTTTCAGGAGGATGCAAACGCAGAC
AAGACGGACCTGGCTAGCGGCGAGATTTGGTTCTACCAAAAGGGGGCCGACACAGTCATGAGCTCCATTGTTGCT
TCCAACGACTGGCTGGACGAAGAGACAGCCAACATGGCGCGCGAAGGGCTGCGCACCTTGGTCGTTGGTCGCAAA
AAGCTGACGTTGCAGCAGTATCACGAGTTTTCAGAACAGTACCAGGATGCTTCCCTGTCCATGATGGGCCGCGAC
GCCGCCATGCAGCGCGTTGTGTCGCATTATCTCGAGAGCGATCTCGAGTTGCTCGGCGTGACAGGCGTTGAAGAC
AAGCTGCAAAAGGACGTCAAGCCGTCTCTGGAGTTGCTGCGTAACGCGGGCATCAAGATATGGATGTTGACGGGT
GACAAGGTGGAAACGGCCAGATGCGTCGCCATTAGTTCCAAACTGGTGGCCAGAGGACAATTCATTTACACCATT
ACCAAGCTCAAACGGGAAAGCGTGCAAGACCATCTCGACTTTTTGCACAGCAAGAGGGATGCCTGTCTCCTCATT
GACGGCGAAAGCCTTCATTTAATGCTGGCCCATTTCCGCATCGACTTCATCTCGATTGCTGTGCTGCTCCCCACT
GTGGTTGCCTGTCGCTGCTCGCCCACGCAAAAGGCCGACATTGCCAAGCTCATCAAGGAGTACACCAAGAAGCGC
GTGCTTTGCATTGGCGACGGTGGCAATGACGTGTCCATGATCCAGGCTGCCGATGTGGGCGTGGGCATTGTGGGA
AAGGAGGGGCGCCAGGCCAGTCTGGCGGCAGACTTTTCCATTGAGCAGTTTTACCACTTGGTCAAGCTGCTAGTA
TGGCACGGACGCAACAGCTACAAACGCAGCGCCAAGTTGGCTCAATTTGTCATTCATCGCGGACTCATCATTGCC
GTATGCCAGACGTTTTATAGCATTGCCCTCAAGTTTGAACCAGAGGGCTTGTACAAGGTGAGATGGCTGCCGAGC
CTATGCCCCTTGAGCGCAAAGGCTAAGTTTAGGGAAATAGGATTGGCTTCTTGTGGGCTACGCCACAGTCTATAC
TGCGGCTCCCGTACTGTCTCTGGTGCTTGACAAGGACGTGGATGAGAATCTGGCCAACCTGTACCCGGAGCTATA
CAAGGAGCTTACTTCGGGCCGGTCGCTCTCGTACCGCACCTTTTTCGTCTGGGTCTTTGTGTCTATATACCAGGG
TGGCATGATTCAGGGCCTCTCCCAGATCCTGACCGAGGTTGACGGGCCAAGAATGGTGGCCGTCAGTTACACGGT
CCTCGTGCTCAATGAGCTCATCATGGTGGCCATTGAGATTACCACGTGGCATCCAATCATGATAATCAGCATCCT
CGGTACATTCTTTGTCTATGTTGGATCAATTCCTTTTCTCGGGGGTTATTTCGACCTGGAATTCATCATAACATG
GTGAGTGTTGTTGAGCTGCTGCTTTTTCTTTCCCAAAAGATTTGAATCTAATAACAAGTGGCTCAGGGGGTTCTT
GTGGCGGGTCCTGGCAATTGGAGCCATATCACTTATCCCGCCGTATGCTGGAAAGCTTATTAGAAGGGCCATTAA
GCCTCCGTCTTATAGAAAAGTCCAGGACAGATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail