Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|6023
Gene name
LocationContig_50:107306..109686
Strand-
Gene length (bp)2380
Transcript length (bp)2298
Coding sequence length (bp)2298
Protein length (aa) 766

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01490 Aa_trans Transmembrane amino acid transporter protein 1.9E-85 364 746

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q10074|AVT3_SCHPO Vacuolar amino acid transporter 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=avt3 PE=1 SV=1 115 745 6.0E-163
sp|P36062|AVT3_YEAST Vacuolar amino acid transporter 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AVT3 PE=1 SV=1 186 750 1.0E-146
sp|P50944|AVT4_YEAST Vacuolar amino acid transporter 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AVT4 PE=1 SV=1 194 747 4.0E-128
sp|Q7Z2H8|S36A1_HUMAN Proton-coupled amino acid transporter 1 OS=Homo sapiens GN=SLC36A1 PE=1 SV=1 360 742 2.0E-36
sp|Q4KL91|S36A4_XENLA Proton-coupled amino acid transporter 4 OS=Xenopus laevis GN=slc36a4 PE=2 SV=1 269 746 3.0E-32
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q10074|AVT3_SCHPO Vacuolar amino acid transporter 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=avt3 PE=1 SV=1 115 745 6.0E-163
sp|P36062|AVT3_YEAST Vacuolar amino acid transporter 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AVT3 PE=1 SV=1 186 750 1.0E-146
sp|P50944|AVT4_YEAST Vacuolar amino acid transporter 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AVT4 PE=1 SV=1 194 747 4.0E-128
sp|Q7Z2H8|S36A1_HUMAN Proton-coupled amino acid transporter 1 OS=Homo sapiens GN=SLC36A1 PE=1 SV=1 360 742 2.0E-36
sp|Q4KL91|S36A4_XENLA Proton-coupled amino acid transporter 4 OS=Xenopus laevis GN=slc36a4 PE=2 SV=1 269 746 3.0E-32
sp|Q6YBV0|S36A4_HUMAN Proton-coupled amino acid transporter 4 OS=Homo sapiens GN=SLC36A4 PE=1 SV=1 326 755 8.0E-31
sp|Q924A5|S36A1_RAT Proton-coupled amino acid transporter 1 OS=Rattus norvegicus GN=Slc36a1 PE=2 SV=1 325 742 2.0E-30
sp|Q8K4D3|S36A1_MOUSE Proton-coupled amino acid transporter 1 OS=Mus musculus GN=Slc36a1 PE=2 SV=1 325 742 2.0E-30
sp|Q495N2|S36A3_HUMAN Proton-coupled amino acid transporter 3 OS=Homo sapiens GN=SLC36A3 PE=2 SV=2 360 734 2.0E-30
sp|Q811P0|S36A3_MOUSE Proton-coupled amino acid transporter 3 OS=Mus musculus GN=Slc36a3 PE=2 SV=1 374 742 5.0E-30
sp|Q4V8B1|S36A3_RAT Proton-coupled amino acid transporter 3 OS=Rattus norvegicus GN=Slc36a3 PE=2 SV=1 352 742 3.0E-29
sp|Q8CH36|S36A4_MOUSE Proton-coupled amino acid transporter 4 OS=Mus musculus GN=Slc36a4 PE=2 SV=1 307 712 7.0E-29
sp|Q495M3|S36A2_HUMAN Proton-coupled amino acid transporter 2 OS=Homo sapiens GN=SLC36A2 PE=1 SV=1 342 742 1.0E-28
sp|Q8BHK3|S36A2_MOUSE Proton-coupled amino acid transporter 2 OS=Mus musculus GN=Slc36a2 PE=1 SV=1 366 648 5.0E-28
sp|Q9SVG0|ANTL2_ARATH Amino acid transporter ANTL2 OS=Arabidopsis thaliana GN=At4g38250 PE=1 SV=1 347 742 2.0E-27
sp|Q8K415|S36A2_RAT Proton-coupled amino acid transporter 2 OS=Rattus norvegicus GN=Slc36a2 PE=1 SV=1 357 648 2.0E-27
sp|F4ILY9|ANTL1_ARATH Amino acid transporter ANTL1 OS=Arabidopsis thaliana GN=At2g42005 PE=2 SV=1 347 742 3.0E-26
sp|Q9FKY3|ANTL3_ARATH Amino acid transporter ANTL3 OS=Arabidopsis thaliana GN=At5g65990 PE=2 SV=1 340 742 3.0E-25
sp|Q9SF09|ANT1_ARATH Amino acid transporter ANT1 OS=Arabidopsis thaliana GN=ANT1 PE=1 SV=1 328 747 2.0E-23
sp|Q503G8|S38A6_DANRE Probable sodium-coupled neutral amino acid transporter 6 OS=Danio rerio GN=slc38a6 PE=2 SV=1 328 751 1.0E-12
sp|Q5XH90|S38A2_XENTR Sodium-coupled neutral amino acid transporter 2 OS=Xenopus tropicalis GN=slc38a2 PE=2 SV=1 346 753 3.0E-10
sp|Q5SPB1|S38A2_DANRE Sodium-coupled neutral amino acid transporter 2 OS=Danio rerio GN=slc38a2 PE=3 SV=1 353 753 7.0E-10
sp|Q99624|S38A3_HUMAN Sodium-coupled neutral amino acid transporter 3 OS=Homo sapiens GN=SLC38A3 PE=1 SV=1 311 758 1.0E-09
sp|Q9DCP2|S38A3_MOUSE Sodium-coupled neutral amino acid transporter 3 OS=Mus musculus GN=Slc38a3 PE=1 SV=1 349 758 2.0E-09
sp|Q9JHZ9|S38A3_RAT Sodium-coupled neutral amino acid transporter 3 OS=Rattus norvegicus GN=Slc38a3 PE=2 SV=1 334 758 4.0E-09
sp|P34479|SKAT1_CAEEL Probable amino acid transporter skat-1 OS=Caenorhabditis elegans GN=skat-1 PE=2 SV=2 370 756 3.0E-07
sp|Q6DEL1|S38A7_DANRE Putative sodium-coupled neutral amino acid transporter 7 OS=Danio rerio GN=slc38a7 PE=2 SV=1 332 649 6.0E-07
sp|Q6WWW3|S38A6_RAT Probable sodium-coupled neutral amino acid transporter 6 OS=Rattus norvegicus GN=Slc38a6 PE=2 SV=1 350 751 3.0E-06
sp|Q5EA97|S38AB_BOVIN Putative sodium-coupled neutral amino acid transporter 11 OS=Bos taurus GN=SLC38A11 PE=2 SV=1 346 753 4.0E-06
sp|Q28HE5|S38A6_XENTR Probable sodium-coupled neutral amino acid transporter 6 OS=Xenopus tropicalis GN=slc38a6 PE=2 SV=1 326 750 5.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 23 0.45

Transmembrane Domains

Domain # Start End Length
1 395 417 22
2 438 460 22
3 480 499 19
4 506 528 22
5 548 567 19
6 580 602 22
7 626 648 22
8 669 686 17
9 691 708 17
10 728 750 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|6023
MSSPQKTPSLTPRASSPSPALAALPSTLRSYSSSIPREELTARLAEPIPSQTPVHTDSPQPGISTPDHTIVGGSS
YNQGPGVSALAAALSDSLGQSSKRLGTPAARASSPTPPQPSHSPGPSAAPETSTNYGSVDSRSRFAGPASVGPYE
DPEIVKRHLVQPGEAETAPSEDSSMHGTARGKQPAEAVGAGLNDDEFSSLRLQGGDITRGIYRWTEQAEAKNKLQ
RSRSFDHARPEPAAEVLDINSIKVPGGFRRNHLRRTALSPSGHATSSGSGRGTDVESAPAEPRLFTSSFLEFLTI
YGHFAGEELEEDDEALGPNEEFWSGEDRDGRGDSDDGHEPMEDSALLPPSKKKRKRKARGGSGKNSAFNAALLLL
KSFVGTGVLFLPRAFLNGGMLFSNLVLLGVACLSYYCFVLLVTTRLNIEGSFGDMGGMLYGRWLRTAILTSIVIS
QIGFVAAYTVFTAENLQAFIHAVSQCRTNISIPVLILMQMVIFLPFSLLRDIGKLGFTALIADAFILIGLAYLFY
YDILTLCAEGLADIILFNQRDWTLFIGTAIFTFEGIGLIIPIQESMKQPQKFPRVLLLVMVIITVIFISMGALSY
AAYGSKTETVVLLNLPQDSKMVNVVQLLYSVAILLSTPLQIFPAIRIIETELFTRSGKYNPYIKWQKNVFRFFMV
MTCAAIAWGGADNLDKFVALVGNFACIPLVYIYPPLMHYKAVARSRARKISDVILCIFGIVVMVYATSLTIMSWA
NSSPKPPGYCYGKHP*
Coding >OphauB2|6023
ATGTCCTCGCCGCAAAAAACTCCCTCCCTGACGCCTAGGGCTTCGTCACCCTCTCCCGCCCTAGCAGCTCTGCCT
TCGACTCTGCGGTCCTACTCGTCTTCGATCCCACGAGAGGAGCTGACGGCTCGCTTGGCTGAGCCTATTCCATCC
CAAACTCCCGTGCATACCGACTCTCCCCAACCAGGCATCAGCACTCCCGACCACACTATCGTGGGTGGAAGCTCG
TACAACCAAGGACCCGGCGTGTCGGCTCTTGCCGCTGCCTTGTCTGACTCTCTTGGCCAGTCGTCGAAGCGTCTT
GGCACCCCCGCTGCTCGTGCGAGCTCGCCCACGCCTCCACAGCCGTCCCATAGCCCCGGCCCGTCTGCAGCACCC
GAGACATCGACCAACTATGGCTCCGTGGACTCTAGGAGCCGCTTTGCCGGTCCGGCAAGTGTTGGCCCTTATGAG
GACCCCGAGATTGTGAAGCGTCATCTGGTCCAGCCTGGGGAGGCAGAGACTGCGCCGTCTGAGGACTCGTCAATG
CATGGCACCGCTCGAGGCAAGCAGCCGGCGGAGGCGGTTGGCGCTGGACTCAATGACGACGAGTTTTCGAGTTTG
CGTCTCCAGGGCGGCGACATCACTCGCGGCATCTACAGGTGGACGGAGCAGGCAGAGGCCAAGAATAAATTGCAG
CGCAGCAGGAGCTTCGACCACGCACGACCCGAGCCTGCAGCCGAAGTGCTAGACATCAACTCAATCAAGGTACCA
GGTGGCTTCCGAAGAAACCATCTCCGTCGTACTGCCCTCAGTCCCAGTGGCCACGCAACCAGCAGTGGAAGCGGG
CGCGGGACTGATGTCGAGTCAGCGCCGGCGGAGCCACGCCTCTTTACGTCGAGCTTCCTCGAGTTTCTAACCATC
TACGGCCACTTTGCTGGCGAGGAGCTTGAAGAGGATGACGAGGCGCTGGGGCCAAACGAAGAGTTTTGGTCAGGA
GAAGACCGCGATGGACGCGGCGATAGCGATGACGGCCACGAGCCCATGGAAGACAGTGCACTCCTACCACCATCC
AAGAAGAAACGTAAGCGCAAGGCCCGCGGCGGCAGCGGCAAAAACAGTGCCTTCAACGCGGCACTATTGCTCCTC
AAGTCATTTGTCGGCACCGGCGTTCTCTTTCTCCCCCGAGCTTTTCTCAATGGCGGCATGTTGTTTAGCAATCTG
GTGCTGCTAGGTGTTGCCTGTCTGAGCTACTACTGCTTCGTTTTGCTCGTCACGACGCGTCTAAACATTGAGGGC
TCTTTTGGTGACATGGGGGGCATGCTGTATGGCCGCTGGCTGCGCACAGCAATTCTCACATCCATCGTCATTAGT
CAGATTGGCTTCGTTGCTGCCTACACCGTCTTTACGGCCGAAAACCTACAGGCCTTTATACATGCAGTGTCGCAA
TGCCGCACCAACATTAGCATTCCAGTGCTCATCTTGATGCAAATGGTCATCTTTCTACCCTTTTCTCTGTTACGC
GATATTGGCAAGCTTGGTTTTACGGCACTAATTGCAGATGCCTTTATCCTCATTGGGCTTGCCTACCTCTTTTAC
TACGACATCTTGACATTATGCGCCGAGGGCCTAGCAGACATTATCCTCTTCAACCAGCGAGACTGGACTCTCTTT
ATTGGAACGGCCATTTTCACCTTTGAAGGGATCGGTCTCATTATCCCAATACAGGAGTCGATGAAGCAGCCGCAA
AAGTTTCCGCGGGTGCTGCTCCTTGTCATGGTCATCATCACCGTCATTTTCATCAGCATGGGTGCCCTGTCGTAT
GCAGCATACGGGTCGAAGACGGAGACGGTGGTGCTGCTCAATTTGCCACAGGACAGCAAAATGGTCAACGTGGTA
CAGCTGCTGTACTCGGTCGCCATCCTGCTGTCGACGCCGCTGCAAATCTTCCCCGCCATTCGAATCATTGAGACG
GAGCTGTTTACGCGCAGTGGCAAGTACAACCCATACATCAAGTGGCAGAAAAATGTATTCCGCTTCTTCATGGTG
ATGACGTGTGCCGCCATTGCCTGGGGAGGTGCTGACAATCTCGACAAATTTGTTGCCCTTGTGGGCAATTTTGCA
TGCATCCCGCTCGTGTACATCTACCCGCCCTTGATGCACTACAAAGCTGTGGCACGCAGTCGAGCTCGGAAAATT
TCAGATGTTATATTATGTATATTCGGCATCGTCGTCATGGTGTATGCAACCAGTCTGACTATTATGAGCTGGGCA
AATTCGTCGCCCAAGCCACCGGGATACTGCTATGGGAAGCATCCATGA
Transcript >OphauB2|6023
ATGTCCTCGCCGCAAAAAACTCCCTCCCTGACGCCTAGGGCTTCGTCACCCTCTCCCGCCCTAGCAGCTCTGCCT
TCGACTCTGCGGTCCTACTCGTCTTCGATCCCACGAGAGGAGCTGACGGCTCGCTTGGCTGAGCCTATTCCATCC
CAAACTCCCGTGCATACCGACTCTCCCCAACCAGGCATCAGCACTCCCGACCACACTATCGTGGGTGGAAGCTCG
TACAACCAAGGACCCGGCGTGTCGGCTCTTGCCGCTGCCTTGTCTGACTCTCTTGGCCAGTCGTCGAAGCGTCTT
GGCACCCCCGCTGCTCGTGCGAGCTCGCCCACGCCTCCACAGCCGTCCCATAGCCCCGGCCCGTCTGCAGCACCC
GAGACATCGACCAACTATGGCTCCGTGGACTCTAGGAGCCGCTTTGCCGGTCCGGCAAGTGTTGGCCCTTATGAG
GACCCCGAGATTGTGAAGCGTCATCTGGTCCAGCCTGGGGAGGCAGAGACTGCGCCGTCTGAGGACTCGTCAATG
CATGGCACCGCTCGAGGCAAGCAGCCGGCGGAGGCGGTTGGCGCTGGACTCAATGACGACGAGTTTTCGAGTTTG
CGTCTCCAGGGCGGCGACATCACTCGCGGCATCTACAGGTGGACGGAGCAGGCAGAGGCCAAGAATAAATTGCAG
CGCAGCAGGAGCTTCGACCACGCACGACCCGAGCCTGCAGCCGAAGTGCTAGACATCAACTCAATCAAGGTACCA
GGTGGCTTCCGAAGAAACCATCTCCGTCGTACTGCCCTCAGTCCCAGTGGCCACGCAACCAGCAGTGGAAGCGGG
CGCGGGACTGATGTCGAGTCAGCGCCGGCGGAGCCACGCCTCTTTACGTCGAGCTTCCTCGAGTTTCTAACCATC
TACGGCCACTTTGCTGGCGAGGAGCTTGAAGAGGATGACGAGGCGCTGGGGCCAAACGAAGAGTTTTGGTCAGGA
GAAGACCGCGATGGACGCGGCGATAGCGATGACGGCCACGAGCCCATGGAAGACAGTGCACTCCTACCACCATCC
AAGAAGAAACGTAAGCGCAAGGCCCGCGGCGGCAGCGGCAAAAACAGTGCCTTCAACGCGGCACTATTGCTCCTC
AAGTCATTTGTCGGCACCGGCGTTCTCTTTCTCCCCCGAGCTTTTCTCAATGGCGGCATGTTGTTTAGCAATCTG
GTGCTGCTAGGTGTTGCCTGTCTGAGCTACTACTGCTTCGTTTTGCTCGTCACGACGCGTCTAAACATTGAGGGC
TCTTTTGGTGACATGGGGGGCATGCTGTATGGCCGCTGGCTGCGCACAGCAATTCTCACATCCATCGTCATTAGT
CAGATTGGCTTCGTTGCTGCCTACACCGTCTTTACGGCCGAAAACCTACAGGCCTTTATACATGCAGTGTCGCAA
TGCCGCACCAACATTAGCATTCCAGTGCTCATCTTGATGCAAATGGTCATCTTTCTACCCTTTTCTCTGTTACGC
GATATTGGCAAGCTTGGTTTTACGGCACTAATTGCAGATGCCTTTATCCTCATTGGGCTTGCCTACCTCTTTTAC
TACGACATCTTGACATTATGCGCCGAGGGCCTAGCAGACATTATCCTCTTCAACCAGCGAGACTGGACTCTCTTT
ATTGGAACGGCCATTTTCACCTTTGAAGGGATCGGTCTCATTATCCCAATACAGGAGTCGATGAAGCAGCCGCAA
AAGTTTCCGCGGGTGCTGCTCCTTGTCATGGTCATCATCACCGTCATTTTCATCAGCATGGGTGCCCTGTCGTAT
GCAGCATACGGGTCGAAGACGGAGACGGTGGTGCTGCTCAATTTGCCACAGGACAGCAAAATGGTCAACGTGGTA
CAGCTGCTGTACTCGGTCGCCATCCTGCTGTCGACGCCGCTGCAAATCTTCCCCGCCATTCGAATCATTGAGACG
GAGCTGTTTACGCGCAGTGGCAAGTACAACCCATACATCAAGTGGCAGAAAAATGTATTCCGCTTCTTCATGGTG
ATGACGTGTGCCGCCATTGCCTGGGGAGGTGCTGACAATCTCGACAAATTTGTTGCCCTTGTGGGCAATTTTGCA
TGCATCCCGCTCGTGTACATCTACCCGCCCTTGATGCACTACAAAGCTGTGGCACGCAGTCGAGCTCGGAAAATT
TCAGATGTTATATTATGTATATTCGGCATCGTCGTCATGGTGTATGCAACCAGTCTGACTATTATGAGCTGGGCA
AATTCGTCGCCCAAGCCACCGGGATACTGCTATGGGAAGCATCCATGA
Gene >OphauB2|6023
ATGTCCTCGCCGCAAAAAACTCCCTCCCTGACGCCTAGGGCTTCGTCACCCTCTCCCGCCCTAGCAGCTCTGCCT
TCGACTCTGCGGTCCTACTCGTCTTCGATCCCACGAGAGGAGCTGACGGCTCGCTTGGCTGAGCCTATTCCATCC
CAAACTCCCGTGCATACCGACTCTCCCCAACCAGGCATCAGCACTCCCGACCACACTATCGTGGGTGGAAGCTCG
TACAACCAAGGACCCGGCGTGTCGGCTCTTGCCGCTGCCTTGTCTGACTCTCTTGGCCAGTCGTCGAAGCGTCTT
GGCACCCCCGCTGCTCGTGCGAGCTCGCCCACGCCTCCACAGCCGTCCCATAGCCCCGGCCCGTCTGCAGCACCC
GAGACATCGACCAACTATGGCTCCGTGGACTCTAGGAGCCGCTTTGCCGGTCCGGCAAGTGTTGGCCCTTATGAG
GACCCCGAGATTGTGAAGCGTCATCTGGTCCAGCCTGGGGAGGCAGAGACTGCGCCGTCTGAGGACTCGTCAATG
CATGGCACCGCTCGAGGCAAGCAGCCGGCGGAGGCGGTTGGCGCTGGACTCAATGACGACGAGTTTTCGAGTTTG
CGTCTCCAGGGCGGCGACATCACTCGCGGCATCTACAGGTGGACGGAGCAGGCAGAGGCCAAGAATAAATTGCAG
CGCAGCAGGAGCTTCGACCACGCACGACCCGAGCCTGCAGCCGAAGTGCTAGACATCAACTCAATCAAGGTACCA
GGTGGCTTCCGAAGAAACCATCTCCGTCGTACTGCCCTCAGTCCCAGTGGCCACGCAACCAGCAGTGGAAGCGGG
CGCGGGACTGATGTCGAGTCAGCGCCGGCGGAGCCACGCCTCTTTACGTCGAGCTTCCTCGAGTTTCTAACCATC
TACGGCCACTTTGCTGGCGAGGAGCTTGAAGAGGATGACGAGGCGCTGGGGCCAAACGAAGAGTTTTGGTCAGGA
GAAGACCGCGATGGACGCGGCGATAGCGATGACGGCCACGAGCCCATGGAAGACAGTGCACTCCTACCACCATCC
AAGAAGAAACGTAAGCGCAAGGCCCGCGGCGGCAGCGGCAAAAACAGTGCCTTCAACGCGGCACTATTGCTCCTC
AAGTCATTTGTCGGCACCGGCGTTCTCTTTCTCCCCCGAGCTTTTCTCAATGGCGGCATGTTGTTTAGCAATCTG
GTGCTGCTAGGTGTTGCCTGTCTGAGCTACTACTGCTTCGTTTTGCTCGTCACGACGCGTCTAAACATTGAGGGC
TCTTTTGGTGACATGGGGGGCATGCTGTATGGCCGCTGGCTGCGCACAGCAATTCTCACATCCATCGTCATTAGT
CAGATTGGCTTCGTTGCTGCCTACACCGTCTTTACGGCCGAAAACCTACAGGCCTTTATACATGCAGTGTCGCAA
TGCCGCACCAACATTAGCATTCCAGTGCTCATCTTGATGCAAATGGTCATCTTTCTACCCTTTTCTCTGTTACGC
GATATTGGCAAGCTTGGTTTTACGGCACTAATTGCAGATGCCTTTATCCTCATTGGGCTTGCCTACCTCTTTTAC
TACGACATCTTGACATTATGCGCCGAGGGCCTAGCAGACATTATCCTCTTCAACCAGCGAGACTGGACTCTCTTT
ATTGGAACGGCCATTTTCACCTTTGAAGGGATCGGTCTCATTATCCCAATACAGGAGTCGATGAAGCAGCCGCAA
AAGTTTCCGCGGGTGCTGCTCCTTGTCATGGTCATCATCACCGTCATTTTCATCAGCATGGGTGCCCTGTCGTAT
GCAGCATACGGGTCGAAGACGGAGACGGTGGTGCTGCTCAATTTGCCACAGGACAGCAAAATGGTCAACGTGGTA
CAGCTGCTGTACTCGGTCGCCATCCTGCTGTCGACGCCGCTGCAAATCTTCCCCGCCATTCGAATCATTGAGACG
GAGCTGTTTACGCGCAGTGGCAAGTACAACCCATACATCAAGTGGCAGAAAAATGTATTCCGCTTCTTCATGGTG
ATGACGTGTGCCGCCATTGCCTGGGGAGGTGCTGACAATCTCGACAAATTTGTTGCCCTTGTGGGCAATTTTGCA
TGCATCCCGCTCGTGTACATCTACCCGGTACGTTTCTGACCTGTCGTGTTCCCCTACATCCTACTACTCGGTCAA
AAAAACTTGGTCATGTCGCTAACCACGTGCAAAGCCCTTGATGCACTACAAAGCTGTGGCACGCAGTCGAGCTCG
GAAAATTTCAGATGTTATATTATGTATATTCGGCATCGTCGTCATGGTGTATGCAACCAGTCTGACTATTATGAG
CTGGGCAAATTCGTCGCCCAAGCCACCGGGATACTGCTATGGGAAGCATCCATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail