Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|6020
Gene name
LocationContig_50:100777..101860
Strand+
Gene length (bp)1083
Transcript length (bp)1083
Coding sequence length (bp)1083
Protein length (aa) 361

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02492 cobW CobW/HypB/UreG, nucleotide-binding domain 1.4E-39 5 180

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P24203|YJIA_ECOLI Uncharacterized GTP-binding protein YjiA OS=Escherichia coli (strain K12) GN=yjiA PE=1 SV=3 1 273 6.0E-21
sp|P29937|COBW_PSEDE Protein CobW OS=Pseudomonas denitrificans GN=cobW PE=3 SV=3 5 272 2.0E-19
sp|Q9HZQ2|COBW_PSEAE Protein CobW OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=cobW PE=3 SV=1 1 201 4.0E-15
sp|O74310|YOG5_SCHPO COBW domain-containing protein C15D4.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC15D4.05 PE=3 SV=1 1 159 1.0E-12
sp|P53729|YN8H_YEAST Uncharacterized protein YNR029C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YNR029C PE=1 SV=1 5 162 9.0E-12
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P24203|YJIA_ECOLI Uncharacterized GTP-binding protein YjiA OS=Escherichia coli (strain K12) GN=yjiA PE=1 SV=3 1 273 6.0E-21
sp|P29937|COBW_PSEDE Protein CobW OS=Pseudomonas denitrificans GN=cobW PE=3 SV=3 5 272 2.0E-19
sp|Q9HZQ2|COBW_PSEAE Protein CobW OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=cobW PE=3 SV=1 1 201 4.0E-15
sp|O74310|YOG5_SCHPO COBW domain-containing protein C15D4.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC15D4.05 PE=3 SV=1 1 159 1.0E-12
sp|P53729|YN8H_YEAST Uncharacterized protein YNR029C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YNR029C PE=1 SV=1 5 162 9.0E-12
sp|Q869Q0|Y4527_DICDI COBW domain-containing protein DDB_G0274527 OS=Dictyostelium discoideum GN=DDB_G0274527 PE=3 SV=1 5 135 1.0E-11
sp|P94400|YCIC_BACSU Putative metal chaperone YciC OS=Bacillus subtilis (strain 168) GN=yciC PE=2 SV=1 1 270 3.0E-11
sp|Q8VEH6|CBWD1_MOUSE COBW domain-containing protein 1 OS=Mus musculus GN=Cbwd1 PE=1 SV=1 1 272 4.0E-11
sp|Q8IUF1|CBWD2_HUMAN COBW domain-containing protein 2 OS=Homo sapiens GN=CBWD2 PE=1 SV=1 2 131 1.0E-10
sp|P33030|YEIR_ECOLI Zinc-binding GTPase YeiR OS=Escherichia coli (strain K12) GN=yeiR PE=1 SV=2 4 104 1.0E-10
sp|Q99MB4|CBWD1_RAT COBW domain-containing protein 1 OS=Rattus norvegicus GN=Cbwd1 PE=2 SV=2 5 272 2.0E-10
sp|Q9BRT8|CBWD1_HUMAN COBW domain-containing protein 1 OS=Homo sapiens GN=CBWD1 PE=1 SV=1 2 131 2.0E-10
sp|Q5JTY5|CBWD3_HUMAN COBW domain-containing protein 3 OS=Homo sapiens GN=CBWD3 PE=2 SV=1 2 131 3.0E-09
sp|Q4V339|CBWD6_HUMAN COBW domain-containing protein 6 OS=Homo sapiens GN=CBWD6 PE=3 SV=1 2 131 4.0E-09
sp|Q5RIA9|CBWD5_HUMAN COBW domain-containing protein 5 OS=Homo sapiens GN=CBWD5 PE=2 SV=1 2 131 1.0E-08
sp|P22042|YTR2_SPIAU Uncharacterized protein in trpE 3'region (Fragment) OS=Spirochaeta aurantia PE=4 SV=1 4 56 2.0E-08
sp|P31521|P47K_PSECL 47 kDa protein OS=Pseudomonas chlororaphis PE=3 SV=1 5 169 1.0E-07
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2012
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1345
Ophiocordyceps australis map64 (Brazil) OphauB2|6020 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|05377
Ophiocordyceps camponoti-rufipedis Ophun1|4327
Ophiocordyceps kimflemingae Ophio5|2351
Ophiocordyceps subramaniannii Hirsu2|2261

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|6020
MAPTPITIVTGFLGSGKTTLILNLVPQLRAKNPEYRLALVKNEFGDFAVDSQLASSSAVSGVSELLNGCICCNLV
GQLAPALAQLQDSIAPHRIVIETSGSAFPATLALEVNRLARETGRYVLDAVVSVIDVENWKGYEDTSYTAKIQAR
YTDLIVFNKWETAGEDRYEECLDRVGDLEVDVAKVKSDRGRVDVDVVFGVDGGLARDLTLHDVDHDANHSHHQQE
VEVLSIQLKGSQTAAAVATEKLLCLLRTAPKDEVYRIKALLTLSSAPTNSDADIAQPEPQSNGRYILNWAFGRWT
FTPVAPAQQEHVSSDGLVLRMTMILARHESNRWQKKLQAGDLLQLQQDAAEQQLSVTRVL*
Coding >OphauB2|6020
ATGGCCCCAACCCCCATCACCATAGTCACCGGCTTCCTTGGCTCGGGCAAAACAACCCTCATCCTCAACCTCGTT
CCTCAACTACGCGCCAAAAACCCCGAGTACCGGCTCGCCCTAGTCAAGAACGAATTCGGCGACTTTGCCGTAGAC
TCGCAGCTTGCGTCGAGCTCGGCCGTGTCTGGCGTCTCAGAATTGCTCAATGGGTGCATCTGCTGCAACCTGGTT
GGCCAGCTGGCTCCCGCCCTCGCCCAGCTCCAAGACAGCATTGCGCCGCATCGTATAGTCATTGAGACGAGTGGC
TCTGCCTTTCCCGCTACCCTGGCCCTTGAAGTAAATCGCCTGGCTCGAGAGACGGGTCGCTACGTGCTTGACGCT
GTCGTCAGTGTCATTGATGTCGAGAACTGGAAAGGTTACGAGGACACCAGCTACACGGCCAAGATTCAGGCCCGC
TACACCGACCTGATTGTCTTTAACAAGTGGGAGACGGCTGGCGAAGACAGGTACGAAGAGTGTCTGGATCGAGTG
GGCGACTTGGAGGTGGATGTGGCCAAGGTCAAGAGCGATAGAGGCCGCGTTGACGTCGATGTCGTTTTCGGTGTC
GATGGGGGCCTCGCTCGCGACTTGACACTGCATGACGTGGACCATGACGCAAATCACAGCCACCACCAGCAAGAG
GTCGAGGTTCTGTCCATTCAACTCAAGGGCTCCCAAACCGCCGCCGCCGTAGCAACAGAAAAGCTGCTCTGTCTG
CTACGCACAGCCCCCAAGGATGAAGTCTATCGCATCAAGGCCCTTCTCACCCTCTCTTCTGCCCCCACAAACTCA
GATGCCGACATAGCCCAGCCAGAGCCCCAGTCAAACGGCCGCTACATACTCAATTGGGCCTTTGGTCGCTGGACT
TTTACGCCTGTTGCCCCAGCACAGCAAGAACACGTTTCCAGTGACGGCCTTGTGCTACGCATGACAATGATTCTG
GCTAGACACGAGAGCAACCGTTGGCAAAAAAAACTGCAAGCTGGAGATCTGCTGCAGCTGCAACAAGACGCAGCC
GAGCAACAGTTGAGTGTGACGCGTGTACTATAG
Transcript >OphauB2|6020
ATGGCCCCAACCCCCATCACCATAGTCACCGGCTTCCTTGGCTCGGGCAAAACAACCCTCATCCTCAACCTCGTT
CCTCAACTACGCGCCAAAAACCCCGAGTACCGGCTCGCCCTAGTCAAGAACGAATTCGGCGACTTTGCCGTAGAC
TCGCAGCTTGCGTCGAGCTCGGCCGTGTCTGGCGTCTCAGAATTGCTCAATGGGTGCATCTGCTGCAACCTGGTT
GGCCAGCTGGCTCCCGCCCTCGCCCAGCTCCAAGACAGCATTGCGCCGCATCGTATAGTCATTGAGACGAGTGGC
TCTGCCTTTCCCGCTACCCTGGCCCTTGAAGTAAATCGCCTGGCTCGAGAGACGGGTCGCTACGTGCTTGACGCT
GTCGTCAGTGTCATTGATGTCGAGAACTGGAAAGGTTACGAGGACACCAGCTACACGGCCAAGATTCAGGCCCGC
TACACCGACCTGATTGTCTTTAACAAGTGGGAGACGGCTGGCGAAGACAGGTACGAAGAGTGTCTGGATCGAGTG
GGCGACTTGGAGGTGGATGTGGCCAAGGTCAAGAGCGATAGAGGCCGCGTTGACGTCGATGTCGTTTTCGGTGTC
GATGGGGGCCTCGCTCGCGACTTGACACTGCATGACGTGGACCATGACGCAAATCACAGCCACCACCAGCAAGAG
GTCGAGGTTCTGTCCATTCAACTCAAGGGCTCCCAAACCGCCGCCGCCGTAGCAACAGAAAAGCTGCTCTGTCTG
CTACGCACAGCCCCCAAGGATGAAGTCTATCGCATCAAGGCCCTTCTCACCCTCTCTTCTGCCCCCACAAACTCA
GATGCCGACATAGCCCAGCCAGAGCCCCAGTCAAACGGCCGCTACATACTCAATTGGGCCTTTGGTCGCTGGACT
TTTACGCCTGTTGCCCCAGCACAGCAAGAACACGTTTCCAGTGACGGCCTTGTGCTACGCATGACAATGATTCTG
GCTAGACACGAGAGCAACCGTTGGCAAAAAAAACTGCAAGCTGGAGATCTGCTGCAGCTGCAACAAGACGCAGCC
GAGCAACAGTTGAGTGTGACGCGTGTACTATAG
Gene >OphauB2|6020
ATGGCCCCAACCCCCATCACCATAGTCACCGGCTTCCTTGGCTCGGGCAAAACAACCCTCATCCTCAACCTCGTT
CCTCAACTACGCGCCAAAAACCCCGAGTACCGGCTCGCCCTAGTCAAGAACGAATTCGGCGACTTTGCCGTAGAC
TCGCAGCTTGCGTCGAGCTCGGCCGTGTCTGGCGTCTCAGAATTGCTCAATGGGTGCATCTGCTGCAACCTGGTT
GGCCAGCTGGCTCCCGCCCTCGCCCAGCTCCAAGACAGCATTGCGCCGCATCGTATAGTCATTGAGACGAGTGGC
TCTGCCTTTCCCGCTACCCTGGCCCTTGAAGTAAATCGCCTGGCTCGAGAGACGGGTCGCTACGTGCTTGACGCT
GTCGTCAGTGTCATTGATGTCGAGAACTGGAAAGGTTACGAGGACACCAGCTACACGGCCAAGATTCAGGCCCGC
TACACCGACCTGATTGTCTTTAACAAGTGGGAGACGGCTGGCGAAGACAGGTACGAAGAGTGTCTGGATCGAGTG
GGCGACTTGGAGGTGGATGTGGCCAAGGTCAAGAGCGATAGAGGCCGCGTTGACGTCGATGTCGTTTTCGGTGTC
GATGGGGGCCTCGCTCGCGACTTGACACTGCATGACGTGGACCATGACGCAAATCACAGCCACCACCAGCAAGAG
GTCGAGGTTCTGTCCATTCAACTCAAGGGCTCCCAAACCGCCGCCGCCGTAGCAACAGAAAAGCTGCTCTGTCTG
CTACGCACAGCCCCCAAGGATGAAGTCTATCGCATCAAGGCCCTTCTCACCCTCTCTTCTGCCCCCACAAACTCA
GATGCCGACATAGCCCAGCCAGAGCCCCAGTCAAACGGCCGCTACATACTCAATTGGGCCTTTGGTCGCTGGACT
TTTACGCCTGTTGCCCCAGCACAGCAAGAACACGTTTCCAGTGACGGCCTTGTGCTACGCATGACAATGATTCTG
GCTAGACACGAGAGCAACCGTTGGCAAAAAAAACTGCAAGCTGGAGATCTGCTGCAGCTGCAACAAGACGCAGCC
GAGCAACAGTTGAGTGTGACGCGTGTACTATAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail