Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|602
Gene name
LocationContig_11:224477..225731
Strand-
Gene length (bp)1254
Transcript length (bp)1254
Coding sequence length (bp)1254
Protein length (aa) 418

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P34024|PLC_LISMO 1-phosphatidylinositol phosphodiesterase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=plcA PE=1 SV=1 93 392 7.0E-29
sp|P14262|PLC_BACCE 1-phosphatidylinositol phosphodiesterase OS=Bacillus cereus PE=1 SV=1 35 274 3.0E-13
sp|P08954|PLC_BACTU 1-phosphatidylinositol phosphodiesterase OS=Bacillus thuringiensis PE=1 SV=1 35 214 5.0E-12

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 69 0.5

Transmembrane Domains

Domain # Start End Length
1 44 66 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|602
MGATDEAERLLSPSADAFASISPAAATASCSPPRSSKPKRLTTLIAVTMISTLVIALWLLVFLAQTHGSASYHGY
RSVFSFDSAADIPAYSAWQAQLDDTTPLAALSLPGTHDTMTYAMDTDQLQCQNEALATQLRAGLRYFDIRLRIRL
DGANGPELCVYHANGFTGFCFDQVLREMAAFLVDEPSEALVVRVKQEGSPVGGSADASSAPSFEGLLQRSIAKEE
VAPHIYSAKLAPGLGRGNASFPIPTLGALRSRILMLQDFPAAAGPATYGPAWDGPQMALEDDWITMDLFHLADKW
VAIRNALVSAAMAMAGSNTSSRLFVAHISASVGVLPIAAAAGPKELDITGLNDMTGQYLDYFGSFADVRGVGIVI
FDFPGRKAIRAVIDMNKAPEKRCSLSKTPNCGRNILELAAAN*
Coding >OphauB2|602
ATGGGTGCCACGGACGAGGCGGAGCGGCTTCTGTCGCCCTCTGCCGACGCCTTTGCCTCCATCTCGCCCGCCGCA
GCGACAGCCTCTTGCTCGCCACCACGCTCCTCCAAGCCCAAGCGACTGACGACGCTCATTGCCGTCACCATGATT
TCCACCCTCGTCATTGCCCTCTGGCTCCTCGTATTTCTTGCGCAGACGCATGGCTCGGCCTCGTACCACGGCTAC
CGCAGCGTCTTTAGCTTCGACTCTGCCGCCGACATTCCCGCCTACTCGGCCTGGCAGGCCCAGCTCGACGACACG
ACGCCGCTGGCGGCTCTCAGCCTGCCCGGCACGCACGACACCATGACGTATGCCATGGACACGGACCAGCTGCAG
TGCCAAAACGAGGCGCTGGCCACGCAGCTGCGGGCGGGGCTGCGCTACTTTGACATTCGGCTGCGCATCCGCCTC
GACGGCGCCAATGGGCCTGAGCTGTGTGTCTATCACGCCAATGGCTTTACCGGCTTTTGCTTTGACCAGGTGCTG
CGCGAAATGGCGGCCTTTCTCGTCGACGAGCCTTCAGAGGCGCTCGTGGTGCGCGTCAAGCAAGAGGGCTCTCCA
GTGGGCGGCTCGGCAGACGCGTCGTCGGCGCCGTCGTTTGAAGGCCTCTTGCAGCGCTCCATTGCCAAGGAAGAG
GTGGCGCCGCATATTTACAGCGCAAAGCTTGCGCCTGGCCTCGGTCGCGGCAATGCCTCGTTTCCCATTCCCACG
CTTGGCGCGCTTCGCTCCCGCATTCTCATGCTGCAAGATTTTCCCGCCGCTGCGGGCCCAGCTACCTATGGCCCC
GCGTGGGACGGGCCGCAAATGGCCCTCGAGGACGATTGGATCACCATGGATCTCTTCCACCTGGCCGACAAGTGG
GTAGCCATTCGCAATGCTCTCGTCAGTGCCGCCATGGCCATGGCCGGCTCAAACACGTCGTCGCGCCTCTTTGTC
GCTCACATTTCGGCCTCTGTGGGCGTCTTGCCCATTGCGGCGGCCGCGGGGCCCAAGGAGCTGGACATTACCGGG
CTCAATGACATGACGGGCCAGTACCTCGATTACTTTGGCTCCTTTGCCGATGTGCGCGGCGTCGGCATTGTCATT
TTTGACTTTCCTGGCCGCAAAGCCATTCGCGCCGTCATTGACATGAACAAGGCTCCCGAGAAGCGCTGCAGCTTG
AGCAAGACGCCCAATTGTGGCAGAAATATCCTCGAGCTGGCTGCTGCAAACTAG
Transcript >OphauB2|602
ATGGGTGCCACGGACGAGGCGGAGCGGCTTCTGTCGCCCTCTGCCGACGCCTTTGCCTCCATCTCGCCCGCCGCA
GCGACAGCCTCTTGCTCGCCACCACGCTCCTCCAAGCCCAAGCGACTGACGACGCTCATTGCCGTCACCATGATT
TCCACCCTCGTCATTGCCCTCTGGCTCCTCGTATTTCTTGCGCAGACGCATGGCTCGGCCTCGTACCACGGCTAC
CGCAGCGTCTTTAGCTTCGACTCTGCCGCCGACATTCCCGCCTACTCGGCCTGGCAGGCCCAGCTCGACGACACG
ACGCCGCTGGCGGCTCTCAGCCTGCCCGGCACGCACGACACCATGACGTATGCCATGGACACGGACCAGCTGCAG
TGCCAAAACGAGGCGCTGGCCACGCAGCTGCGGGCGGGGCTGCGCTACTTTGACATTCGGCTGCGCATCCGCCTC
GACGGCGCCAATGGGCCTGAGCTGTGTGTCTATCACGCCAATGGCTTTACCGGCTTTTGCTTTGACCAGGTGCTG
CGCGAAATGGCGGCCTTTCTCGTCGACGAGCCTTCAGAGGCGCTCGTGGTGCGCGTCAAGCAAGAGGGCTCTCCA
GTGGGCGGCTCGGCAGACGCGTCGTCGGCGCCGTCGTTTGAAGGCCTCTTGCAGCGCTCCATTGCCAAGGAAGAG
GTGGCGCCGCATATTTACAGCGCAAAGCTTGCGCCTGGCCTCGGTCGCGGCAATGCCTCGTTTCCCATTCCCACG
CTTGGCGCGCTTCGCTCCCGCATTCTCATGCTGCAAGATTTTCCCGCCGCTGCGGGCCCAGCTACCTATGGCCCC
GCGTGGGACGGGCCGCAAATGGCCCTCGAGGACGATTGGATCACCATGGATCTCTTCCACCTGGCCGACAAGTGG
GTAGCCATTCGCAATGCTCTCGTCAGTGCCGCCATGGCCATGGCCGGCTCAAACACGTCGTCGCGCCTCTTTGTC
GCTCACATTTCGGCCTCTGTGGGCGTCTTGCCCATTGCGGCGGCCGCGGGGCCCAAGGAGCTGGACATTACCGGG
CTCAATGACATGACGGGCCAGTACCTCGATTACTTTGGCTCCTTTGCCGATGTGCGCGGCGTCGGCATTGTCATT
TTTGACTTTCCTGGCCGCAAAGCCATTCGCGCCGTCATTGACATGAACAAGGCTCCCGAGAAGCGCTGCAGCTTG
AGCAAGACGCCCAATTGTGGCAGAAATATCCTCGAGCTGGCTGCTGCAAACTAG
Gene >OphauB2|602
ATGGGTGCCACGGACGAGGCGGAGCGGCTTCTGTCGCCCTCTGCCGACGCCTTTGCCTCCATCTCGCCCGCCGCA
GCGACAGCCTCTTGCTCGCCACCACGCTCCTCCAAGCCCAAGCGACTGACGACGCTCATTGCCGTCACCATGATT
TCCACCCTCGTCATTGCCCTCTGGCTCCTCGTATTTCTTGCGCAGACGCATGGCTCGGCCTCGTACCACGGCTAC
CGCAGCGTCTTTAGCTTCGACTCTGCCGCCGACATTCCCGCCTACTCGGCCTGGCAGGCCCAGCTCGACGACACG
ACGCCGCTGGCGGCTCTCAGCCTGCCCGGCACGCACGACACCATGACGTATGCCATGGACACGGACCAGCTGCAG
TGCCAAAACGAGGCGCTGGCCACGCAGCTGCGGGCGGGGCTGCGCTACTTTGACATTCGGCTGCGCATCCGCCTC
GACGGCGCCAATGGGCCTGAGCTGTGTGTCTATCACGCCAATGGCTTTACCGGCTTTTGCTTTGACCAGGTGCTG
CGCGAAATGGCGGCCTTTCTCGTCGACGAGCCTTCAGAGGCGCTCGTGGTGCGCGTCAAGCAAGAGGGCTCTCCA
GTGGGCGGCTCGGCAGACGCGTCGTCGGCGCCGTCGTTTGAAGGCCTCTTGCAGCGCTCCATTGCCAAGGAAGAG
GTGGCGCCGCATATTTACAGCGCAAAGCTTGCGCCTGGCCTCGGTCGCGGCAATGCCTCGTTTCCCATTCCCACG
CTTGGCGCGCTTCGCTCCCGCATTCTCATGCTGCAAGATTTTCCCGCCGCTGCGGGCCCAGCTACCTATGGCCCC
GCGTGGGACGGGCCGCAAATGGCCCTCGAGGACGATTGGATCACCATGGATCTCTTCCACCTGGCCGACAAGTGG
GTAGCCATTCGCAATGCTCTCGTCAGTGCCGCCATGGCCATGGCCGGCTCAAACACGTCGTCGCGCCTCTTTGTC
GCTCACATTTCGGCCTCTGTGGGCGTCTTGCCCATTGCGGCGGCCGCGGGGCCCAAGGAGCTGGACATTACCGGG
CTCAATGACATGACGGGCCAGTACCTCGATTACTTTGGCTCCTTTGCCGATGTGCGCGGCGTCGGCATTGTCATT
TTTGACTTTCCTGGCCGCAAAGCCATTCGCGCCGTCATTGACATGAACAAGGCTCCCGAGAAGCGCTGCAGCTTG
AGCAAGACGCCCAATTGTGGCAGAAATATCCTCGAGCTGGCTGCTGCAAACTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail