Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|6012
Gene name
LocationContig_50:86906..88160
Strand-
Gene length (bp)1254
Transcript length (bp)1194
Coding sequence length (bp)1194
Protein length (aa) 398

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF16131 Torus Torus domain 2.4E-42 51 156
PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) 3.2E-07 191 239

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q51TF7|CWC2_MAGO7 Pre-mRNA-splicing factor CWC2 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=CWC2 PE=3 SV=2 23 397 0.0E+00
sp|Q5BB35|CWC2_EMENI Pre-mRNA-splicing factor cwc2 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=cwc2 PE=3 SV=1 55 397 4.0E-173
sp|Q4WU07|CWC2_ASPFU Pre-mRNA-splicing factor cwc2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=cwc2 PE=3 SV=1 55 397 4.0E-166
sp|Q6T412|CWC2_LEPMC Pre-mRNA-splicing factor CWC2 OS=Leptosphaeria maculans GN=CWC2 PE=3 SV=1 55 397 3.0E-152
sp|Q6C007|CWC2_YARLI Pre-mRNA-splicing factor CWC2 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=CWC2 PE=3 SV=1 53 317 9.0E-121
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q51TF7|CWC2_MAGO7 Pre-mRNA-splicing factor CWC2 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=CWC2 PE=3 SV=2 23 397 0.0E+00
sp|Q5BB35|CWC2_EMENI Pre-mRNA-splicing factor cwc2 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=cwc2 PE=3 SV=1 55 397 4.0E-173
sp|Q4WU07|CWC2_ASPFU Pre-mRNA-splicing factor cwc2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=cwc2 PE=3 SV=1 55 397 4.0E-166
sp|Q6T412|CWC2_LEPMC Pre-mRNA-splicing factor CWC2 OS=Leptosphaeria maculans GN=CWC2 PE=3 SV=1 55 397 3.0E-152
sp|Q6C007|CWC2_YARLI Pre-mRNA-splicing factor CWC2 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=CWC2 PE=3 SV=1 53 317 9.0E-121
sp|P87126|CWC2_SCHPO Pre-mRNA-splicing factor cwf2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cwf2 PE=1 SV=2 63 397 4.0E-120
sp|Q6BLU8|CWC2_DEBHA Pre-mRNA-splicing factor CWC2 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=CWC2 PE=3 SV=2 50 290 2.0E-81
sp|P0CR14|CWC2_CRYNJ Pre-mRNA-splicing factor CWC2 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=CWC2 PE=3 SV=1 49 282 2.0E-78
sp|P0CR15|CWC2_CRYNB Pre-mRNA-splicing factor CWC2 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=CWC2 PE=3 SV=1 49 282 2.0E-78
sp|Q4PA86|CWC2_USTMA Pre-mRNA-splicing factor CWC2 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=CWC2 PE=3 SV=2 70 302 7.0E-60
sp|Q59W50|CWC2_CANAL Pre-mRNA-splicing factor CWC2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CWC2 PE=3 SV=1 53 280 8.0E-59
sp|Q6CT50|CWC2_KLULA Pre-mRNA-splicing factor CWC2 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=CWC2 PE=3 SV=1 51 299 9.0E-55
sp|Q54PH5|CWC2_DICDI Pre-mRNA-splicing factor cwc2 OS=Dictyostelium discoideum GN=cwc2 PE=3 SV=1 53 277 1.0E-51
sp|Q12046|CWC2_YEAST Pre-mRNA-splicing factor CWC2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CWC2 PE=1 SV=1 53 260 5.0E-47
sp|Q6FNR8|CWC2_CANGA Pre-mRNA-splicing factor CWC2 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=CWC2 PE=3 SV=1 51 278 1.0E-41
sp|Q9ZW36|C3H25_ARATH Zinc finger CCCH domain-containing protein 25 OS=Arabidopsis thaliana GN=At2g29580 PE=2 SV=1 117 255 2.0E-12
sp|Q9LNV5|C3H4_ARATH Zinc finger CCCH domain-containing protein 4 OS=Arabidopsis thaliana GN=At1g07360 PE=2 SV=1 117 254 3.0E-12
sp|Q6Z358|C3H49_ORYSJ Zinc finger CCCH domain-containing protein 49 OS=Oryza sativa subsp. japonica GN=Os07g0281000 PE=2 SV=1 91 255 1.0E-10
sp|Q5SNN4|C3H40_ORYSJ Zinc finger CCCH domain-containing protein 40 OS=Oryza sativa subsp. japonica GN=Os06g0170500 PE=2 SV=1 91 255 3.0E-10
sp|Q7ZXB5|RBM22_XENLA Pre-mRNA-splicing factor RBM22 OS=Xenopus laevis GN=rbm22 PE=2 SV=1 102 249 2.0E-06
sp|Q6P616|RBM22_XENTR Pre-mRNA-splicing factor RBM22 OS=Xenopus tropicalis GN=rbm22 PE=2 SV=1 102 249 3.0E-06
sp|Q5RAY5|RBM22_PONAB Pre-mRNA-splicing factor RBM22 OS=Pongo abelii GN=RBM22 PE=2 SV=1 102 249 6.0E-06
sp|Q8BHS3|RBM22_MOUSE Pre-mRNA-splicing factor RBM22 OS=Mus musculus GN=Rbm22 PE=1 SV=1 102 249 6.0E-06
sp|Q4R4J1|RBM22_MACFA Pre-mRNA-splicing factor RBM22 OS=Macaca fascicularis GN=RBM22 PE=2 SV=1 102 249 6.0E-06
sp|Q9NW64|RBM22_HUMAN Pre-mRNA-splicing factor RBM22 OS=Homo sapiens GN=RBM22 PE=1 SV=1 102 249 6.0E-06
sp|Q5ZM16|RBM22_CHICK Pre-mRNA-splicing factor RBM22 OS=Gallus gallus GN=RBM22 PE=2 SV=1 102 249 6.0E-06
sp|Q3B7L8|RBM22_BOVIN Pre-mRNA-splicing factor RBM22 OS=Bos taurus GN=RBM22 PE=2 SV=1 102 249 8.0E-06
sp|Q4V7D7|RBM22_RAT Pre-mRNA-splicing factor RBM22 OS=Rattus norvegicus GN=Rbm22 PE=2 SV=1 102 249 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0003723 RNA binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No
GO:1901363 heterocyclic compound binding No
GO:0097159 organic cyclic compound binding No
GO:0003676 nucleic acid binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 64 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|6012
MADVEEAPTQVAPPIEDDHDKDDSSALVTTNTQVAAPAADSKKVKKLVRKKRRAARVQLDPAEISTEPPPQTGTV
YNIWYNKWAGGDREAYQQTQAKGRCNIARDSGYTRADKVVGSYFCLHFARGVCSQGQDCNYLHRLPTTYDLFSPN
VDCFGREKFSDYRDDMGGVGSFMRQNRTIYVGRIHSTEDIEEIVSRHFAEWGQIERIRVLNSRGVAFITYTNEAN
AQFAREAMAHQALDHDETLNVRWATPDPNPMAQAREARRVEEQAAEAIRRALPAEFVAEIEGKDVDARKRRKIEG
SYGLQGYEAPDQIHFARGPSAVNPRGREGYQSQQDQPLMIETSQQAAVDNAFPGRGEGIFSGGTLAALNKAKVAV
ATKPKQEAAGPLVAYNSDSDDD*
Coding >OphauB2|6012
ATGGCCGACGTTGAAGAAGCCCCTACGCAAGTGGCGCCCCCGATTGAAGATGACCACGACAAGGACGATAGCAGC
GCCCTGGTAACAACAAATACTCAAGTGGCCGCGCCCGCCGCCGACTCCAAAAAGGTCAAGAAGCTGGTGCGCAAA
AAGCGTCGTGCCGCACGCGTCCAACTCGACCCTGCCGAAATCTCCACGGAACCTCCTCCGCAAACGGGCACCGTC
TACAACATCTGGTACAACAAATGGGCCGGCGGCGATCGCGAAGCCTACCAGCAGACCCAGGCCAAGGGCCGCTGC
AACATTGCGCGAGACTCGGGCTACACGCGCGCCGACAAGGTTGTTGGCAGCTATTTCTGCCTACACTTTGCCCGA
GGCGTTTGCTCTCAGGGCCAGGACTGCAATTACCTCCACCGTTTGCCAACCACATACGACTTGTTTAGCCCCAAT
GTCGATTGCTTTGGGCGGGAAAAGTTCTCAGACTATCGCGACGACATGGGCGGCGTGGGAAGCTTCATGAGGCAA
AATAGGACCATCTACGTTGGCAGAATACACTCAACCGAAGACATTGAGGAAATTGTATCCCGTCATTTTGCAGAA
TGGGGGCAAATCGAGAGAATTCGCGTGCTGAATTCAAGAGGCGTGGCCTTTATTACCTACACCAACGAAGCAAAT
GCCCAGTTTGCCAGAGAAGCCATGGCGCACCAGGCTCTAGATCACGACGAGACACTCAATGTCAGATGGGCAACG
CCAGACCCAAACCCCATGGCACAGGCGCGAGAGGCGCGCCGGGTAGAGGAGCAGGCAGCCGAAGCAATAAGGAGG
GCACTCCCCGCTGAGTTTGTGGCTGAGATTGAGGGCAAGGATGTCGATGCGAGAAAACGGAGAAAGATTGAAGGT
AGCTACGGGCTTCAAGGCTACGAGGCGCCAGACCAAATACACTTTGCTCGGGGTCCCAGTGCCGTCAACCCGCGG
GGTCGCGAGGGATACCAGTCACAGCAGGACCAGCCGTTGATGATTGAGACTTCGCAACAAGCGGCGGTGGACAAT
GCATTTCCAGGTAGGGGGGAGGGCATTTTTTCAGGCGGCACACTGGCCGCTCTCAACAAGGCCAAGGTAGCAGTG
GCTACCAAGCCCAAGCAAGAAGCGGCAGGGCCGCTTGTAGCATACAACAGCGATAGCGATGACGACTAG
Transcript >OphauB2|6012
ATGGCCGACGTTGAAGAAGCCCCTACGCAAGTGGCGCCCCCGATTGAAGATGACCACGACAAGGACGATAGCAGC
GCCCTGGTAACAACAAATACTCAAGTGGCCGCGCCCGCCGCCGACTCCAAAAAGGTCAAGAAGCTGGTGCGCAAA
AAGCGTCGTGCCGCACGCGTCCAACTCGACCCTGCCGAAATCTCCACGGAACCTCCTCCGCAAACGGGCACCGTC
TACAACATCTGGTACAACAAATGGGCCGGCGGCGATCGCGAAGCCTACCAGCAGACCCAGGCCAAGGGCCGCTGC
AACATTGCGCGAGACTCGGGCTACACGCGCGCCGACAAGGTTGTTGGCAGCTATTTCTGCCTACACTTTGCCCGA
GGCGTTTGCTCTCAGGGCCAGGACTGCAATTACCTCCACCGTTTGCCAACCACATACGACTTGTTTAGCCCCAAT
GTCGATTGCTTTGGGCGGGAAAAGTTCTCAGACTATCGCGACGACATGGGCGGCGTGGGAAGCTTCATGAGGCAA
AATAGGACCATCTACGTTGGCAGAATACACTCAACCGAAGACATTGAGGAAATTGTATCCCGTCATTTTGCAGAA
TGGGGGCAAATCGAGAGAATTCGCGTGCTGAATTCAAGAGGCGTGGCCTTTATTACCTACACCAACGAAGCAAAT
GCCCAGTTTGCCAGAGAAGCCATGGCGCACCAGGCTCTAGATCACGACGAGACACTCAATGTCAGATGGGCAACG
CCAGACCCAAACCCCATGGCACAGGCGCGAGAGGCGCGCCGGGTAGAGGAGCAGGCAGCCGAAGCAATAAGGAGG
GCACTCCCCGCTGAGTTTGTGGCTGAGATTGAGGGCAAGGATGTCGATGCGAGAAAACGGAGAAAGATTGAAGGT
AGCTACGGGCTTCAAGGCTACGAGGCGCCAGACCAAATACACTTTGCTCGGGGTCCCAGTGCCGTCAACCCGCGG
GGTCGCGAGGGATACCAGTCACAGCAGGACCAGCCGTTGATGATTGAGACTTCGCAACAAGCGGCGGTGGACAAT
GCATTTCCAGGTAGGGGGGAGGGCATTTTTTCAGGCGGCACACTGGCCGCTCTCAACAAGGCCAAGGTAGCAGTG
GCTACCAAGCCCAAGCAAGAAGCGGCAGGGCCGCTTGTAGCATACAACAGCGATAGCGATGACGACTAG
Gene >OphauB2|6012
ATGGCCGACGTTGAAGAAGCCCCTACGCAAGTGGCGCCCCCGATTGAAGATGACCACGACAAGGACGATAGCAGC
GCCCTGGTAACAACAAATACTCAAGTGGCCGCGCCCGCCGCCGACTCCAAAAAGGTCAAGAAGCTGGTGCGCAAA
AAGCGTCGTGCCGCACGCGTCCAACTCGACCCTGCCGAAATCTCCACGGAACCTCCTCCGCAAACGGGCACCGTC
TACAACATCTGGTACAACAAATGGGCCGGCGGCGATCGCGAAGCCTACCAGCAGACCCAGGCCAAGGGCCGCTGC
AACATTGCGCGAGACTCGGGCTACACGCGCGCCGACAAGGTTGTTGGCAGCTATTTCTGCCTACACTTTGCCCGA
GGCGTTTGCTCTCAGGGCCAGGACTGCAATTACCTCCACCGTTTGCCAACCACATACGACTTGTTTAGCCCCAAT
GTCGATTGCTTTGGGCGGGAAAAGTTCTCAGACTATCGCGACGACATGGGCGGCGTGGGAAGCTTCATGAGGCAA
AATAGGACCATCTACGTTGGCAGAATACACTCAACCGAAGACATTGAGGAAATTGTATCCCGTCATTTTGCAGAA
TGGGGGCAAATCGAGAGAAGTAAGCATAACCGCTCTGCATCTTGGCCTGGGGCCAACTGACGGTTTGTCCAATGT
GCAGTTCGCGTGCTGAATTCAAGAGGCGTGGCCTTTATTACCTACACCAACGAAGCAAATGCCCAGTTTGCCAGA
GAAGCCATGGCGCACCAGGCTCTAGATCACGACGAGACACTCAATGTCAGATGGGCAACGCCAGACCCAAACCCC
ATGGCACAGGCGCGAGAGGCGCGCCGGGTAGAGGAGCAGGCAGCCGAAGCAATAAGGAGGGCACTCCCCGCTGAG
TTTGTGGCTGAGATTGAGGGCAAGGATGTCGATGCGAGAAAACGGAGAAAGATTGAAGGTAGCTACGGGCTTCAA
GGCTACGAGGCGCCAGACCAAATACACTTTGCTCGGGGTCCCAGTGCCGTCAACCCGCGGGGTCGCGAGGGATAC
CAGTCACAGCAGGACCAGCCGTTGATGATTGAGACTTCGCAACAAGCGGCGGTGGACAATGCATTTCCAGGTAGG
GGGGAGGGCATTTTTTCAGGCGGCACACTGGCCGCTCTCAACAAGGCCAAGGTAGCAGTGGCTACCAAGCCCAAG
CAAGAAGCGGCAGGGCCGCTTGTAGCATACAACAGCGATAGCGATGACGACTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail