Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|6011
Gene name
LocationContig_50:85628..86779
Strand+
Gene length (bp)1151
Transcript length (bp)930
Coding sequence length (bp)930
Protein length (aa) 310

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01730 UreF UreF 2.3E-18 97 262

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O14016|UREF_SCHPO Uncharacterized urease accessory protein UreF-like OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC29A4.13 PE=3 SV=1 57 309 3.0E-44
sp|Q0E3L5|UREF_ORYSJ Urease accessory protein F OS=Oryza sativa subsp. japonica GN=UREF PE=2 SV=2 54 307 1.0E-21
sp|E0ZS46|UREF_ORYSI Urease accessory protein F OS=Oryza sativa subsp. indica GN=UREF PE=2 SV=1 54 307 1.0E-21
sp|Q9XHZ3|UREF_ARATH Urease accessory protein F OS=Arabidopsis thaliana GN=UREF PE=2 SV=1 51 309 2.0E-15

GO

GO Term Description Terminal node
GO:0006807 nitrogen compound metabolic process Yes
GO:0016151 nickel cation binding Yes
GO:0046872 metal ion binding No
GO:0003674 molecular_function No
GO:0008152 metabolic process No
GO:0005488 binding No
GO:0008150 biological_process No
GO:0043167 ion binding No
GO:0046914 transition metal ion binding No
GO:0043169 cation binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 57 0.45

Transmembrane Domains

Domain # Start End Length
1 214 236 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|6011
MPLSQSVSEIESEIEQLEARLAVAKAHLRTASDSDGSVSFPSPLSPRAAPSSCSLSTHFLLLLSDSALPLGAFAF
SSGLESFLAHNPRGPTFSSFLPLSLSSFAATTLPFVLAAHRRPADLAALDDELDATVVCTVGRRASIAQGRALLS
IWERSFRPALCPPAATAPRPASSLVSSSSSTLLAEGDDMLRAFAALLKNTAARDIPSVSAHLAPLFGAICAFVGL
GLAQTAYVFLLSHVKALISAAVRASMFGPYQAQKIVAGQQVQRLIDDLVQREWNTPVHEAGQSVPVMDLWIGRHE
LLYSRIFNS*
Coding >OphauB2|6011
ATGCCACTGAGCCAGAGTGTGAGCGAGATTGAAAGCGAGATTGAGCAGCTCGAGGCCCGTCTGGCGGTGGCCAAG
GCTCACTTGCGCACTGCCAGCGACAGCGATGGCTCAGTCTCTTTTCCGAGTCCCTTGTCGCCAAGAGCTGCGCCC
TCGTCTTGCTCCCTCTCGACGCACTTTTTGCTGCTCCTGTCCGACTCGGCCCTGCCTCTTGGCGCCTTTGCCTTT
AGCAGCGGACTCGAGTCCTTTCTGGCTCACAATCCGCGCGGCCCCACCTTTTCTTCCTTTCTCCCCCTCTCGCTC
TCGTCGTTTGCCGCCACGACGCTGCCCTTTGTCCTGGCCGCCCATCGCCGCCCCGCTGACTTGGCTGCTCTCGAC
GACGAGCTCGACGCCACCGTTGTTTGCACTGTCGGCCGTCGCGCCAGCATTGCCCAGGGCCGCGCCCTCTTGAGC
ATCTGGGAACGCTCCTTTCGCCCGGCTCTCTGTCCACCTGCCGCTACTGCGCCGCGCCCTGCTTCGTCTCTTGTA
TCCTCGTCGTCGTCGACTTTGCTGGCAGAGGGCGATGACATGTTGCGCGCTTTTGCTGCGCTGCTCAAAAACACG
GCCGCCCGCGATATTCCCTCCGTCTCGGCCCATCTGGCGCCGCTCTTTGGCGCCATTTGCGCCTTTGTTGGTCTT
GGCCTCGCCCAAACCGCCTATGTCTTTTTGCTCAGCCATGTCAAGGCCCTCATCTCGGCTGCTGTGCGTGCCAGC
ATGTTTGGCCCCTACCAGGCTCAAAAGATTGTCGCTGGCCAACAGGTTCAGCGCTTGATTGATGACCTGGTCCAA
CGGGAATGGAACACGCCAGTCCATGAGGCGGGTCAGAGCGTGCCCGTCATGGATCTCTGGATTGGTCGCCACGAA
CTCCTTTATTCGCGCATCTTCAACAGCTAG
Transcript >OphauB2|6011
ATGCCACTGAGCCAGAGTGTGAGCGAGATTGAAAGCGAGATTGAGCAGCTCGAGGCCCGTCTGGCGGTGGCCAAG
GCTCACTTGCGCACTGCCAGCGACAGCGATGGCTCAGTCTCTTTTCCGAGTCCCTTGTCGCCAAGAGCTGCGCCC
TCGTCTTGCTCCCTCTCGACGCACTTTTTGCTGCTCCTGTCCGACTCGGCCCTGCCTCTTGGCGCCTTTGCCTTT
AGCAGCGGACTCGAGTCCTTTCTGGCTCACAATCCGCGCGGCCCCACCTTTTCTTCCTTTCTCCCCCTCTCGCTC
TCGTCGTTTGCCGCCACGACGCTGCCCTTTGTCCTGGCCGCCCATCGCCGCCCCGCTGACTTGGCTGCTCTCGAC
GACGAGCTCGACGCCACCGTTGTTTGCACTGTCGGCCGTCGCGCCAGCATTGCCCAGGGCCGCGCCCTCTTGAGC
ATCTGGGAACGCTCCTTTCGCCCGGCTCTCTGTCCACCTGCCGCTACTGCGCCGCGCCCTGCTTCGTCTCTTGTA
TCCTCGTCGTCGTCGACTTTGCTGGCAGAGGGCGATGACATGTTGCGCGCTTTTGCTGCGCTGCTCAAAAACACG
GCCGCCCGCGATATTCCCTCCGTCTCGGCCCATCTGGCGCCGCTCTTTGGCGCCATTTGCGCCTTTGTTGGTCTT
GGCCTCGCCCAAACCGCCTATGTCTTTTTGCTCAGCCATGTCAAGGCCCTCATCTCGGCTGCTGTGCGTGCCAGC
ATGTTTGGCCCCTACCAGGCTCAAAAGATTGTCGCTGGCCAACAGGTTCAGCGCTTGATTGATGACCTGGTCCAA
CGGGAATGGAACACGCCAGTCCATGAGGCGGGTCAGAGCGTGCCCGTCATGGATCTCTGGATTGGTCGCCACGAA
CTCCTTTATTCGCGCATCTTCAACAGCTAG
Gene >OphauB2|6011
ATGCCACTGAGCCAGAGTGTGAGCGAGATTGAAAGCGAGATTGAGCAGCTCGAGGCCCGTCTGGCGGTGGCCAAG
GCTCACTTGCGCACTGCCAGCGACAGCGATGGCTCAGTCTCTTTTCCGAGTCCCTTGTCGCCAAGAGGTGAGTTT
CTGCCTGTTGCCCCCCTCCTCCGCCTCCCTCTTCTCTACCTAGTCTTTCTGGCCTCTTCTCTACCCTAGTAGCCT
TTCTGGCCTCTTCTCTACCCTAGTAGCCTTTCTGGCCTCTTCTCTACCCTAGTAGCCTTTCTGGCCTCTCCTCTA
CCTTGACAAAGCAGCCTCGACGCCATGGCGCCTGTGTCCATTTTCACTCATGCCTGTTGCCAGCTGCGCCCTCGT
CTTGCTCCCTCTCGACGCACTTTTTGCTGCTCCTGTCCGACTCGGCCCTGCCTCTTGGCGCCTTTGCCTTTAGCA
GCGGACTCGAGTCCTTTCTGGCTCACAATCCGCGCGGCCCCACCTTTTCTTCCTTTCTCCCCCTCTCGCTCTCGT
CGTTTGCCGCCACGACGCTGCCCTTTGTCCTGGCCGCCCATCGCCGCCCCGCTGACTTGGCTGCTCTCGACGACG
AGCTCGACGCCACCGTTGTTTGCACTGTCGGCCGTCGCGCCAGCATTGCCCAGGGCCGCGCCCTCTTGAGCATCT
GGGAACGCTCCTTTCGCCCGGCTCTCTGTCCACCTGCCGCTACTGCGCCGCGCCCTGCTTCGTCTCTTGTATCCT
CGTCGTCGTCGACTTTGCTGGCAGAGGGCGATGACATGTTGCGCGCTTTTGCTGCGCTGCTCAAAAACACGGCCG
CCCGCGATATTCCCTCCGTCTCGGCCCATCTGGCGCCGCTCTTTGGCGCCATTTGCGCCTTTGTTGGTCTTGGCC
TCGCCCAAACCGCCTATGTCTTTTTGCTCAGCCATGTCAAGGCCCTCATCTCGGCTGCTGTGCGTGCCAGCATGT
TTGGCCCCTACCAGGCTCAAAAGATTGTCGCTGGCCAACAGGTTCAGCGCTTGATTGATGACCTGGTCCAACGGG
AATGGAACACGCCAGTCCATGAGGCGGGTCAGAGCGTGCCCGTCATGGATCTCTGGATTGGTCGCCACGAACTCC
TTTATTCGCGCATCTTCAACAGCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail