Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|6009
Gene name
LocationContig_50:77319..82629
Strand-
Gene length (bp)5310
Transcript length (bp)4989
Coding sequence length (bp)4989
Protein length (aa) 1663

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12745 HGTP_anticodon2 Anticodon binding domain of tRNAs 9.2E-74 1419 1659
PF00069 Pkinase Protein kinase domain 7.5E-21 303 530
PF00069 Pkinase Protein kinase domain 5.1E-12 585 653
PF00069 Pkinase Protein kinase domain 5.4E-33 826 1022
PF07714 PK_Tyr_Ser-Thr Protein tyrosine and serine/threonine kinase 4.7E-15 307 491
PF07714 PK_Tyr_Ser-Thr Protein tyrosine and serine/threonine kinase 3.6E-05 589 651
PF07714 PK_Tyr_Ser-Thr Protein tyrosine and serine/threonine kinase 9.0E-19 826 1021
PF13393 tRNA-synt_His Histidyl-tRNA synthetase 1.3E-14 1102 1396
PF05773 RWD RWD domain 6.1E-14 35 144

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P15442|GCN2_YEAST Serine/threonine-protein kinase GCN2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GCN2 PE=1 SV=3 827 1653 6.0E-121
sp|Q9HGN1|GCN2_SCHPO Serine/threonine-protein kinase gcn2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gcn2 PE=2 SV=2 802 1658 4.0E-111
sp|Q9QZ05|E2AK4_MOUSE Eukaryotic translation initiation factor 2-alpha kinase 4 OS=Mus musculus GN=Eif2ak4 PE=1 SV=2 830 1518 2.0E-74
sp|Q550L8|IFKB_DICDI Probable serine/threonine-protein kinase ifkB OS=Dictyostelium discoideum GN=ifkB PE=2 SV=1 829 1499 3.0E-72
sp|Q9P2K8|E2AK4_HUMAN Eukaryotic translation initiation factor 2-alpha kinase 4 OS=Homo sapiens GN=EIF2AK4 PE=1 SV=3 830 1525 6.0E-71
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P15442|GCN2_YEAST Serine/threonine-protein kinase GCN2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GCN2 PE=1 SV=3 827 1653 6.0E-121
sp|Q9HGN1|GCN2_SCHPO Serine/threonine-protein kinase gcn2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gcn2 PE=2 SV=2 802 1658 4.0E-111
sp|Q9QZ05|E2AK4_MOUSE Eukaryotic translation initiation factor 2-alpha kinase 4 OS=Mus musculus GN=Eif2ak4 PE=1 SV=2 830 1518 2.0E-74
sp|Q550L8|IFKB_DICDI Probable serine/threonine-protein kinase ifkB OS=Dictyostelium discoideum GN=ifkB PE=2 SV=1 829 1499 3.0E-72
sp|Q9P2K8|E2AK4_HUMAN Eukaryotic translation initiation factor 2-alpha kinase 4 OS=Homo sapiens GN=EIF2AK4 PE=1 SV=3 830 1525 6.0E-71
sp|Q558U1|IFKA_DICDI Probable serine/threonine-protein kinase ifkA OS=Dictyostelium discoideum GN=ifkA PE=2 SV=1 829 1499 7.0E-71
sp|P15442|GCN2_YEAST Serine/threonine-protein kinase GCN2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GCN2 PE=1 SV=3 29 655 6.0E-56
sp|Q9HGN1|GCN2_SCHPO Serine/threonine-protein kinase gcn2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gcn2 PE=2 SV=2 35 723 5.0E-53
sp|Q9LX30|GCN2_ARATH Probable serine/threonine-protein kinase GCN2 OS=Arabidopsis thaliana GN=GCN2 PE=2 SV=2 828 1396 2.0E-50
sp|Q63185|E2AK1_RAT Eukaryotic translation initiation factor 2-alpha kinase 1 OS=Rattus norvegicus GN=Eif2ak1 PE=1 SV=2 565 1023 4.0E-45
sp|Q4R8E0|E2AK1_MACFA Eukaryotic translation initiation factor 2-alpha kinase 1 OS=Macaca fascicularis GN=EIF2AK1 PE=2 SV=1 565 1023 1.0E-42
sp|Q9BQI3|E2AK1_HUMAN Eukaryotic translation initiation factor 2-alpha kinase 1 OS=Homo sapiens GN=EIF2AK1 PE=1 SV=2 565 1023 3.0E-42
sp|Q9Z2R9|E2AK1_MOUSE Eukaryotic translation initiation factor 2-alpha kinase 1 OS=Mus musculus GN=Eif2ak1 PE=1 SV=2 565 1023 5.0E-42
sp|P33279|E2AK1_RABIT Eukaryotic translation initiation factor 2-alpha kinase 1 OS=Oryctolagus cuniculus GN=EIF2AK1 PE=1 SV=1 565 1023 1.0E-40
sp|D0Z5N4|E2AKB_CAEEL Eukaryotic translation initiation factor 2-alpha kinase gcn-2 OS=Caenorhabditis elegans GN=gcn-2 PE=1 SV=2 830 1614 7.0E-35
sp|Q9Z1Z1|E2AK3_RAT Eukaryotic translation initiation factor 2-alpha kinase 3 OS=Rattus norvegicus GN=Eif2ak3 PE=1 SV=1 571 1063 6.0E-34
sp|Q9NZJ5|E2AK3_HUMAN Eukaryotic translation initiation factor 2-alpha kinase 3 OS=Homo sapiens GN=EIF2AK3 PE=1 SV=3 571 1024 2.0E-33
sp|Q63184|E2AK2_RAT Interferon-induced, double-stranded RNA-activated protein kinase OS=Rattus norvegicus GN=Eif2ak2 PE=1 SV=1 821 1023 1.0E-22
sp|P19525|E2AK2_HUMAN Interferon-induced, double-stranded RNA-activated protein kinase OS=Homo sapiens GN=EIF2AK2 PE=1 SV=2 824 1023 8.0E-20
sp|Q6P3R8|NEK5_HUMAN Serine/threonine-protein kinase Nek5 OS=Homo sapiens GN=NEK5 PE=2 SV=1 830 1022 3.0E-18
sp|Q03963|E2AK2_MOUSE Interferon-induced, double-stranded RNA-activated protein kinase OS=Mus musculus GN=Eif2ak2 PE=1 SV=2 821 982 4.0E-18
sp|Q9UTE5|E2AK2_SCHPO Eukaryotic translation initiation factor 2-alpha kinase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hri2 PE=1 SV=1 826 1026 6.0E-18
sp|P48479|NIM1_NEUCR G2-specific protein kinase nim-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nim-1 PE=2 SV=2 830 965 6.0E-17
sp|Q8NG66|NEK11_HUMAN Serine/threonine-protein kinase Nek11 OS=Homo sapiens GN=NEK11 PE=1 SV=2 811 1046 9.0E-17
sp|Q75JN1|IFKC_DICDI Probable serine/threonine-protein kinase ifkC OS=Dictyostelium discoideum GN=ifkC PE=3 SV=1 927 1103 9.0E-17
sp|P51954|NEK1_MOUSE Serine/threonine-protein kinase Nek1 OS=Mus musculus GN=Nek1 PE=1 SV=2 829 1024 1.0E-16
sp|F4IYF8|SYHC_ARATH Histidine--tRNA ligase, cytoplasmic OS=Arabidopsis thaliana GN=At3g02760 PE=2 SV=1 1055 1486 2.0E-16
sp|P47355|PKNS_MYCGE Putative serine/threonine-protein kinase OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=MG109 PE=3 SV=2 773 965 3.0E-16
sp|Q96PY6|NEK1_HUMAN Serine/threonine-protein kinase Nek1 OS=Homo sapiens GN=NEK1 PE=1 SV=2 829 1024 4.0E-16
sp|P50528|PLO1_SCHPO Serine/threonine-protein kinase plo1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=plo1 PE=1 SV=1 828 1021 7.0E-16
sp|Q8WNU8|NEK11_MACFA Serine/threonine-protein kinase Nek11 OS=Macaca fascicularis GN=NEK11 PE=2 SV=1 811 1022 7.0E-16
sp|Q54RZ7|Y1199_DICDI Probable serine/threonine-protein kinase DDB_G0282895 OS=Dictyostelium discoideum GN=DDB_G0282895 PE=3 SV=1 824 964 8.0E-16
sp|Q9UTE5|E2AK2_SCHPO Eukaryotic translation initiation factor 2-alpha kinase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hri2 PE=1 SV=1 578 650 1.0E-15
sp|Q1ZXR2|Y7566_DICDI Probable serine/threonine-protein kinase DDB_G0267566 OS=Dictyostelium discoideum GN=DDB_G0267566 PE=3 SV=1 793 1025 3.0E-15
sp|Q7TSC3|NEK5_MOUSE Serine/threonine-protein kinase Nek5 OS=Mus musculus GN=Nek5 PE=2 SV=1 830 1022 3.0E-15
sp|Q54RP7|Y0652_DICDI Probable serine/threonine-protein kinase DDB_G0283065 OS=Dictyostelium discoideum GN=DDB_G0283065 PE=3 SV=1 823 988 3.0E-15
sp|O34507|PRKC_BACSU Serine/threonine-protein kinase PrkC OS=Bacillus subtilis (strain 168) GN=prkC PE=1 SV=1 831 965 4.0E-15
sp|O13889|E2AK1_SCHPO Eukaryotic translation initiation factor 2-alpha kinase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hri1 PE=1 SV=1 829 1024 4.0E-15
sp|O13889|E2AK1_SCHPO Eukaryotic translation initiation factor 2-alpha kinase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hri1 PE=1 SV=1 578 650 4.0E-15
sp|P51956|NEK3_HUMAN Serine/threonine-protein kinase Nek3 OS=Homo sapiens GN=NEK3 PE=1 SV=2 830 1024 5.0E-15
sp|P93101|CDC2_OXYRB Cell division control protein 2 homolog OS=Oxybasis rubra GN=CDC2 PE=2 SV=1 814 984 9.0E-15
sp|Q9R0A5|NEK3_MOUSE Serine/threonine-protein kinase Nek3 OS=Mus musculus GN=Nek3 PE=1 SV=2 830 1036 1.0E-14
sp|Q12263|GIN4_YEAST Serine/threonine-protein kinase GIN4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GIN4 PE=1 SV=1 819 1036 1.0E-14
sp|P51955|NEK2_HUMAN Serine/threonine-protein kinase Nek2 OS=Homo sapiens GN=NEK2 PE=1 SV=1 816 965 1.0E-14
sp|Q8C0Q4|NEK11_MOUSE Serine/threonine-protein kinase Nek11 OS=Mus musculus GN=Nek11 PE=2 SV=2 811 1023 1.0E-14
sp|P43063|CDK1_CANAL Cyclin-dependent kinase 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CDC28 PE=1 SV=1 821 984 1.0E-14
sp|Q8AYC9|CHK1_CHICK Serine/threonine-protein kinase Chk1 OS=Gallus gallus GN=CHEK1 PE=1 SV=1 818 964 1.0E-14
sp|O35942|NEK2_MOUSE Serine/threonine-protein kinase Nek2 OS=Mus musculus GN=Nek2 PE=1 SV=2 828 965 2.0E-14
sp|P41676|PK2_NPVAC Probable serine/threonine-protein kinase 2 OS=Autographa californica nuclear polyhedrosis virus GN=PK2 PE=3 SV=1 814 1022 2.0E-14
sp|Q05006|CDC22_MEDSA Cell division control protein 2 homolog 2 OS=Medicago sativa GN=CDC2B PE=2 SV=1 814 966 2.0E-14
sp|P25389|KCC4_YEAST Probable serine/threonine-protein kinase KCC4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KCC4 PE=1 SV=3 828 965 2.0E-14
sp|Q23356|MIG15_CAEEL Serine/threonine-protein kinase mig-15 OS=Caenorhabditis elegans GN=mig-15 PE=2 SV=3 830 1039 2.0E-14
sp|Q9N2L7|PLK2_CAEEL Serine/threonine-protein kinase plk-2 OS=Caenorhabditis elegans GN=plk-2 PE=2 SV=1 818 1030 3.0E-14
sp|Q55F45|Y8642_DICDI Probable serine/threonine-protein kinase DDB_G0268642 OS=Dictyostelium discoideum GN=DDB_G0268642 PE=3 SV=1 827 906 4.0E-14
sp|Q59W62|GIN4_CANAL Serine/threonine-protein kinase GIN4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=GIN4 PE=1 SV=1 792 964 4.0E-14
sp|P75524|PKNS_MYCPN Putative serine/threonine-protein kinase OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=MPN_248 PE=3 SV=1 829 965 5.0E-14
sp|O14757|CHK1_HUMAN Serine/threonine-protein kinase Chk1 OS=Homo sapiens GN=CHEK1 PE=1 SV=2 818 964 7.0E-14
sp|P00546|CDK1_YEAST Cyclin-dependent kinase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC28 PE=1 SV=1 821 984 7.0E-14
sp|Q99759|M3K3_HUMAN Mitogen-activated protein kinase kinase kinase 3 OS=Homo sapiens GN=MAP3K3 PE=1 SV=2 812 1021 8.0E-14
sp|Q8SWM6|CDC5_ENCCU Probable cell cycle serine/threonine-protein kinase CDC5 homolog OS=Encephalitozoon cuniculi (strain GB-M1) GN=CDC5 PE=3 SV=2 824 1021 9.0E-14
sp|P29618|CDKA1_ORYSJ Cyclin-dependent kinase A-1 OS=Oryza sativa subsp. japonica GN=CDKA-1 PE=1 SV=1 814 984 1.0E-13
sp|P29619|CDKA2_ORYSJ Cyclin-dependent kinase A-2 OS=Oryza sativa subsp. japonica GN=CDKA-2 PE=2 SV=1 814 966 1.0E-13
sp|Q8R9T6|PKN1_CALS4 Probable serine/threonine-protein kinase Sps1 OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=sps1 PE=3 SV=1 831 965 1.0E-13
sp|Q41639|CDC2_VIGAC Cell division control protein 2 homolog OS=Vigna aconitifolia GN=CDC2 PE=2 SV=1 814 984 1.0E-13
sp|Q621J7|ZYG1_CAEBR Probable serine/threonine-protein kinase zyg-1 OS=Caenorhabditis briggsae GN=zyg-1 PE=3 SV=1 818 968 1.0E-13
sp|Q9CAU7|NEK2_ARATH Serine/threonine-protein kinase Nek2 OS=Arabidopsis thaliana GN=NEK2 PE=2 SV=1 818 1062 1.0E-13
sp|Q91ZN7|CHK1_RAT Serine/threonine-protein kinase Chk1 OS=Rattus norvegicus GN=Chek1 PE=2 SV=1 818 964 1.0E-13
sp|P52389|CDC2_VIGUN Cell division control protein 2 homolog OS=Vigna unguiculata GN=CDC2 PE=2 SV=1 814 984 1.0E-13
sp|P24100|CDKA1_ARATH Cyclin-dependent kinase A-1 OS=Arabidopsis thaliana GN=CDKA-1 PE=1 SV=1 820 965 1.0E-13
sp|Q19192|E2AKA_CAEEL Eukaryotic translation initiation factor 2-alpha kinase pek-1 OS=Caenorhabditis elegans GN=pek-1 PE=1 SV=2 812 1017 1.0E-13
sp|Q9QZ05|E2AK4_MOUSE Eukaryotic translation initiation factor 2-alpha kinase 4 OS=Mus musculus GN=Eif2ak4 PE=1 SV=2 371 658 2.0E-13
sp|Q558U1|IFKA_DICDI Probable serine/threonine-protein kinase ifkA OS=Dictyostelium discoideum GN=ifkA PE=2 SV=1 578 651 2.0E-13
sp|Q9UKE5|TNIK_HUMAN TRAF2 and NCK-interacting protein kinase OS=Homo sapiens GN=TNIK PE=1 SV=1 830 1022 2.0E-13
sp|Q61084|M3K3_MOUSE Mitogen-activated protein kinase kinase kinase 3 OS=Mus musculus GN=Map3k3 PE=1 SV=1 812 1021 2.0E-13
sp|P83510|TNIK_MOUSE Traf2 and NCK-interacting protein kinase OS=Mus musculus GN=Tnik PE=1 SV=2 830 1022 2.0E-13
sp|Q8G6P9|PKNB_BIFLO Probable serine/threonine-protein kinase PknB OS=Bifidobacterium longum (strain NCC 2705) GN=pknB PE=3 SV=1 810 964 2.0E-13
sp|O35280|CHK1_MOUSE Serine/threonine-protein kinase Chk1 OS=Mus musculus GN=Chek1 PE=1 SV=2 819 964 2.0E-13
sp|Q9SLI2|NEK1_ARATH Serine/threonine-protein kinase Nek1 OS=Arabidopsis thaliana GN=NEK1 PE=2 SV=2 818 1066 2.0E-13
sp|P52304|POLO_DROME Serine/threonine-protein kinase polo OS=Drosophila melanogaster GN=polo PE=1 SV=2 805 1035 2.0E-13
sp|Q8LG64|CKB22_ARATH Cyclin-dependent kinase B2-2 OS=Arabidopsis thaliana GN=CDKB2-2 PE=1 SV=2 820 988 3.0E-13
sp|Q8LF80|CKB21_ARATH Cyclin-dependent kinase B2-1 OS=Arabidopsis thaliana GN=CDKB2-1 PE=1 SV=2 827 965 3.0E-13
sp|Q23023|UNC51_CAEEL Serine/threonine-protein kinase unc-51 OS=Caenorhabditis elegans GN=unc-51 PE=1 SV=1 812 1045 3.0E-13
sp|Q9XF67|PDPK1_ARATH 3-phosphoinositide-dependent protein kinase 1 OS=Arabidopsis thaliana GN=PDPK1 PE=1 SV=1 828 1017 3.0E-13
sp|P51957|NEK4_HUMAN Serine/threonine-protein kinase Nek4 OS=Homo sapiens GN=NEK4 PE=1 SV=2 830 1022 4.0E-13
sp|P93422|SYHC_ORYSJ Histidine--tRNA ligase, cytoplasmic OS=Oryza sativa subsp. japonica GN=Os05g0150900 PE=2 SV=2 1091 1501 4.0E-13
sp|Q2TA25|PLK1_BOVIN Serine/threonine-protein kinase PLK1 OS=Bos taurus GN=PLK1 PE=2 SV=2 830 1035 4.0E-13
sp|E9Q3S4|M3K19_MOUSE Mitogen-activated protein kinase kinase kinase 19 OS=Mus musculus GN=Map3k19 PE=3 SV=1 827 1022 4.0E-13
sp|Q7ZZC8|NEK9_XENLA Serine/threonine-protein kinase Nek9 OS=Xenopus laevis GN=nek9 PE=2 SV=1 814 964 5.0E-13
sp|P23111|CDC2_MAIZE Cell division control protein 2 homolog OS=Zea mays GN=CDC2 PE=2 SV=1 814 984 5.0E-13
sp|P25323|MYLKA_DICDI Myosin light chain kinase A OS=Dictyostelium discoideum GN=mlkA PE=1 SV=2 830 968 5.0E-13
sp|Q09136|AAPK1_PIG 5'-AMP-activated protein kinase catalytic subunit alpha-1 (Fragments) OS=Sus scrofa GN=PRKAA1 PE=1 SV=2 812 964 5.0E-13
sp|Q8N568|DCLK2_HUMAN Serine/threonine-protein kinase DCLK2 OS=Homo sapiens GN=DCLK2 PE=2 SV=4 828 968 5.0E-13
sp|D2I3C6|DCLK2_AILME Serine/threonine-protein kinase DCLK2 OS=Ailuropoda melanoleuca GN=DCLK2 PE=3 SV=1 828 968 5.0E-13
sp|Q95ZQ4|AAPK2_CAEEL 5'-AMP-activated protein kinase catalytic subunit alpha-2 OS=Caenorhabditis elegans GN=aak-2 PE=1 SV=2 812 964 6.0E-13
sp|Q38774|CDC2C_ANTMA Cell division control protein 2 homolog C OS=Antirrhinum majus GN=CDC2C PE=2 SV=1 813 964 7.0E-13
sp|Q9GT24|ZYG1_CAEEL Probable serine/threonine-protein kinase zyg-1 OS=Caenorhabditis elegans GN=zyg-1 PE=1 SV=1 819 967 7.0E-13
sp|Q54E34|Y6398_DICDI Probable protein kinase DDB_G0291842 OS=Dictyostelium discoideum GN=DDB_G0291842 PE=3 SV=1 830 1026 7.0E-13
sp|Q2VWQ3|STE20_TALMA Serine/threonine-protein kinase pakA OS=Talaromyces marneffei GN=pakA PE=3 SV=1 287 561 7.0E-13
sp|Q8K1R7|NEK9_MOUSE Serine/threonine-protein kinase Nek9 OS=Mus musculus GN=Nek9 PE=1 SV=2 814 964 7.0E-13
sp|Q94CU5|NEK5_ORYSJ Serine/threonine-protein kinase Nek5 OS=Oryza sativa subsp. japonica GN=NEK5 PE=3 SV=1 830 1026 7.0E-13
sp|Q5MPA9|DCLK2_RAT Serine/threonine-protein kinase DCLK2 OS=Rattus norvegicus GN=Dclk2 PE=1 SV=2 828 968 7.0E-13
sp|Q0WPH8|NEK5_ARATH Serine/threonine-protein kinase Nek5 OS=Arabidopsis thaliana GN=NEK5 PE=1 SV=1 830 1052 7.0E-13
sp|Q39008|M3K1_ARATH Mitogen-activated protein kinase kinase kinase 1 OS=Arabidopsis thaliana GN=MEKK1 PE=1 SV=2 814 1021 8.0E-13
sp|Q8TD19|NEK9_HUMAN Serine/threonine-protein kinase Nek9 OS=Homo sapiens GN=NEK9 PE=1 SV=2 814 964 8.0E-13
sp|P24923|CDC21_MEDSA Cell division control protein 2 homolog 1 (Fragment) OS=Medicago sativa GN=CDC2A PE=2 SV=1 814 966 9.0E-13
sp|Q5RDH5|AAPK1_PONAB 5'-AMP-activated protein kinase catalytic subunit alpha-1 (Fragment) OS=Pongo abelii GN=PRKAA1 PE=2 SV=2 812 1055 9.0E-13
sp|P54645|AAPK1_RAT 5'-AMP-activated protein kinase catalytic subunit alpha-1 OS=Rattus norvegicus GN=Prkaa1 PE=1 SV=2 812 1055 9.0E-13
sp|Q9P2K8|E2AK4_HUMAN Eukaryotic translation initiation factor 2-alpha kinase 4 OS=Homo sapiens GN=EIF2AK4 PE=1 SV=3 577 658 1.0E-12
sp|P54119|CDK1_AJECA Cyclin-dependent kinase 1 OS=Ajellomyces capsulatus GN=CDC2 PE=3 SV=1 848 965 1.0E-12
sp|Q4V3C8|PDPK2_ARATH 3-phosphoinositide-dependent protein kinase 2 OS=Arabidopsis thaliana GN=PDPK2 PE=1 SV=1 829 1017 1.0E-12
sp|Q5EG47|AAPK1_MOUSE 5'-AMP-activated protein kinase catalytic subunit alpha-1 OS=Mus musculus GN=Prkaa1 PE=1 SV=2 812 1055 1.0E-12
sp|Q8RX66|NEK3_ARATH Serine/threonine-protein kinase Nek3 OS=Arabidopsis thaliana GN=NEK3 PE=2 SV=1 818 1043 1.0E-12
sp|Q0D541|WNK5_ORYSJ Probable serine/threonine-protein kinase WNK5 OS=Oryza sativa subsp. japonica GN=WNK5 PE=2 SV=1 814 1022 1.0E-12
sp|Q13131|AAPK1_HUMAN 5'-AMP-activated protein kinase catalytic subunit alpha-1 OS=Homo sapiens GN=PRKAA1 PE=1 SV=4 812 1055 1.0E-12
sp|P53351|PLK2_MOUSE Serine/threonine-protein kinase PLK2 OS=Mus musculus GN=Plk2 PE=1 SV=1 827 1022 1.0E-12
sp|Q38773|CDC2B_ANTMA Cell division control protein 2 homolog B (Fragment) OS=Antirrhinum majus GN=CDC2B PE=2 SV=1 820 964 1.0E-12
sp|Q84UI5|MPK1_ORYSJ Mitogen-activated protein kinase 1 OS=Oryza sativa subsp. japonica GN=MPK1 PE=1 SV=1 824 980 1.0E-12
sp|Q9R012|PLK2_RAT Serine/threonine-protein kinase PLK2 OS=Rattus norvegicus GN=Plk2 PE=1 SV=1 827 1022 1.0E-12
sp|Q6P0Q8|MAST2_HUMAN Microtubule-associated serine/threonine-protein kinase 2 OS=Homo sapiens GN=MAST2 PE=1 SV=2 827 1014 1.0E-12
sp|P50527|STE20_SCHPO Serine/threonine-protein kinase shk1/pak1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=shk1 PE=1 SV=2 826 1022 1.0E-12
sp|Q6YY75|NEK6_ORYSJ Serine/threonine-protein kinase Nek6 OS=Oryza sativa subsp. japonica GN=NEK6 PE=3 SV=2 818 1022 1.0E-12
sp|Q38772|CDC2A_ANTMA Cell division control protein 2 homolog A OS=Antirrhinum majus GN=CDC2A PE=2 SV=2 814 966 1.0E-12
sp|O22040|ANP1_ARATH Mitogen-activated protein kinase kinase kinase ANP1 OS=Arabidopsis thaliana GN=ANP1 PE=1 SV=2 271 492 1.0E-12
sp|Q13546|RIPK1_HUMAN Receptor-interacting serine/threonine-protein kinase 1 OS=Homo sapiens GN=RIPK1 PE=1 SV=3 832 964 1.0E-12
sp|Q9NYY3|PLK2_HUMAN Serine/threonine-protein kinase PLK2 OS=Homo sapiens GN=PLK2 PE=1 SV=3 827 1022 1.0E-12
sp|Q5R4L1|PLK2_PONAB Serine/threonine-protein kinase PLK2 OS=Pongo abelii GN=PLK2 PE=3 SV=1 827 1022 2.0E-12
sp|Q8BWQ5|DCLK3_MOUSE Serine/threonine-protein kinase DCLK3 OS=Mus musculus GN=Dclk3 PE=2 SV=2 819 968 2.0E-12
sp|Q4FZD7|PLK5_MOUSE Inactive serine/threonine-protein kinase PLK5 OS=Mus musculus GN=Plk5 PE=1 SV=1 818 1022 2.0E-12
sp|Q60592|MAST2_MOUSE Microtubule-associated serine/threonine-protein kinase 2 OS=Mus musculus GN=Mast2 PE=1 SV=1 827 1014 2.0E-12
sp|Q39026|MPK6_ARATH Mitogen-activated protein kinase 6 OS=Arabidopsis thaliana GN=MPK6 PE=1 SV=1 823 980 2.0E-12
sp|P32562|CDC5_YEAST Cell cycle serine/threonine-protein kinase CDC5/MSD2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC5 PE=1 SV=1 828 1021 2.0E-12
sp|Q8TDC3|BRSK1_HUMAN Serine/threonine-protein kinase BRSK1 OS=Homo sapiens GN=BRSK1 PE=1 SV=2 818 964 2.0E-12
sp|Q9Y6R4|M3K4_HUMAN Mitogen-activated protein kinase kinase kinase 4 OS=Homo sapiens GN=MAP3K4 PE=1 SV=2 826 1021 2.0E-12
sp|A0QNG1|PKNB_MYCS2 Serine/threonine-protein kinase PknB OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=pknB PE=1 SV=1 831 989 2.0E-12
sp|B2DD29|BRSK1_RAT Serine/threonine-protein kinase BRSK1 OS=Rattus norvegicus GN=Brsk1 PE=1 SV=1 818 964 2.0E-12
sp|P24381|US03_SUHVN Serine/threonine-protein kinase US3 homolog OS=Suid herpesvirus 1 (strain NIA-3) GN=PK PE=3 SV=2 811 1029 2.0E-12
sp|Q5RJI5|BRSK1_MOUSE Serine/threonine-protein kinase BRSK1 OS=Mus musculus GN=Brsk1 PE=1 SV=1 818 964 2.0E-12
sp|Q4P5N0|STE20_USTMA Serine/threonine-protein kinase SMU1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SMU1 PE=3 SV=1 827 965 2.0E-12
sp|B2MVY4|CDK4_SHEEP Cyclin-dependent kinase 4 OS=Ovis aries PE=2 SV=1 860 964 2.0E-12
sp|Q32KY4|CDK4_BOVIN Cyclin-dependent kinase 4 OS=Bos taurus GN=CDK4 PE=2 SV=1 860 964 2.0E-12
sp|O08648|M3K4_MOUSE Mitogen-activated protein kinase kinase kinase 4 OS=Mus musculus GN=Map3k4 PE=1 SV=2 826 994 2.0E-12
sp|P11802|CDK4_HUMAN Cyclin-dependent kinase 4 OS=Homo sapiens GN=CDK4 PE=1 SV=2 860 964 2.0E-12
sp|Q94CG0|CIPKL_ARATH CBL-interacting serine/threonine-protein kinase 21 OS=Arabidopsis thaliana GN=CIPK21 PE=1 SV=1 818 1028 3.0E-12
sp|P35426|CDK4_RAT Cyclin-dependent kinase 4 OS=Rattus norvegicus GN=Cdk4 PE=1 SV=1 860 964 3.0E-12
sp|P79432|CDK4_PIG Cyclin-dependent kinase 4 OS=Sus scrofa GN=CDK4 PE=3 SV=1 860 964 3.0E-12
sp|O75460|ERN1_HUMAN Serine/threonine-protein kinase/endoribonuclease IRE1 OS=Homo sapiens GN=ERN1 PE=1 SV=2 818 1022 3.0E-12
sp|P30285|CDK4_MOUSE Cyclin-dependent kinase 4 OS=Mus musculus GN=Cdk4 PE=1 SV=1 860 964 3.0E-12
sp|Q86AD7|MYLKB_DICDI Probable myosin light chain kinase DDB_G0271550 OS=Dictyostelium discoideum GN=DDB_G0271550 PE=3 SV=1 830 1022 3.0E-12
sp|Q54VI1|FHKE_DICDI Probable serine/threonine-protein kinase fhkE OS=Dictyostelium discoideum GN=fhkE PE=3 SV=1 821 983 3.0E-12
sp|Q56UN5|M3K19_HUMAN Mitogen-activated protein kinase kinase kinase 19 OS=Homo sapiens GN=MAP3K19 PE=2 SV=1 827 1022 3.0E-12
sp|P51166|CDK5_XENLA Cyclin-dependent-like kinase 5 OS=Xenopus laevis GN=cdk5 PE=2 SV=1 814 967 4.0E-12
sp|Q0VD22|STK33_BOVIN Serine/threonine-protein kinase 33 OS=Bos taurus GN=STK33 PE=2 SV=1 830 985 4.0E-12
sp|F4I1N8|ATG1T_ARATH Serine/threonine-protein kinase ATG1t OS=Arabidopsis thaliana GN=At1g49180 PE=2 SV=1 814 983 4.0E-12
sp|Q03114|CDK5_RAT Cyclin-dependent-like kinase 5 OS=Rattus norvegicus GN=Cdk5 PE=1 SV=1 814 967 4.0E-12
sp|Q10056|SHK2_SCHPO Serine/threonine-protein kinase shk2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=shk2 PE=3 SV=1 830 964 4.0E-12
sp|Q07832|PLK1_MOUSE Serine/threonine-protein kinase PLK1 OS=Mus musculus GN=Plk1 PE=1 SV=2 830 1055 4.0E-12
sp|Q9LT35|NEK6_ARATH Serine/threonine-protein kinase Nek6 OS=Arabidopsis thaliana GN=NEK6 PE=3 SV=1 827 1022 4.0E-12
sp|Q4WHP3|STE20_ASPFU Serine/threonine-protein kinase ste20 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=ste20 PE=3 SV=2 276 561 4.0E-12
sp|Q6PGN3|DCLK2_MOUSE Serine/threonine-protein kinase DCLK2 OS=Mus musculus GN=Dclk2 PE=1 SV=1 828 968 5.0E-12
sp|O08875|DCLK1_RAT Serine/threonine-protein kinase DCLK1 OS=Rattus norvegicus GN=Dclk1 PE=1 SV=1 828 968 5.0E-12
sp|Q8TDX7|NEK7_HUMAN Serine/threonine-protein kinase Nek7 OS=Homo sapiens GN=NEK7 PE=1 SV=1 857 1018 5.0E-12
sp|P53350|PLK1_HUMAN Serine/threonine-protein kinase PLK1 OS=Homo sapiens GN=PLK1 PE=1 SV=1 830 1035 5.0E-12
sp|Q9HFF4|PPK1_SCHPO Serine/threonine-protein kinase ppk1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppk1 PE=1 SV=2 832 1004 5.0E-12
sp|G5EFM9|NEKL3_CAEEL Serine/threonine-protein kinase nekl-3 OS=Caenorhabditis elegans GN=nekl-3 PE=1 SV=1 857 1022 5.0E-12
sp|Q9C098|DCLK3_HUMAN Serine/threonine-protein kinase DCLK3 OS=Homo sapiens GN=DCLK3 PE=2 SV=2 819 968 5.0E-12
sp|Q9Z1J2|NEK4_MOUSE Serine/threonine-protein kinase Nek4 OS=Mus musculus GN=Nek4 PE=1 SV=1 830 1022 5.0E-12
sp|O14047|PPK11_SCHPO Serine/threonine-protein kinase ppk11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppk11 PE=3 SV=1 830 1075 6.0E-12
sp|Q9C562|CIPKA_ARATH CBL-interacting serine/threonine-protein kinase 10 OS=Arabidopsis thaliana GN=CIPK10 PE=1 SV=1 827 962 6.0E-12
sp|O01775|NEKL2_CAEEL Serine/threonine-protein kinase nekl-2 OS=Caenorhabditis elegans GN=nekl-2 PE=2 SV=1 830 1021 6.0E-12
sp|Q54CY9|MYLKD_DICDI Probable myosin light chain kinase DDB_G0292624 OS=Dictyostelium discoideum GN=DDB_G0292624 PE=3 SV=1 819 968 6.0E-12
sp|Q54JG7|DST4_DICDI Serine/threonine-protein kinase dst4 OS=Dictyostelium discoideum GN=dst4 PE=3 SV=1 827 1021 7.0E-12
sp|Q9STV4|CIPK8_ARATH CBL-interacting serine/threonine-protein kinase 8 OS=Arabidopsis thaliana GN=CIPK8 PE=1 SV=1 827 1017 7.0E-12
sp|Q4G3H4|IKKA_DANRE Inhibitor of nuclear factor kappa-B kinase subunit alpha OS=Danio rerio GN=chuk PE=1 SV=1 832 965 7.0E-12
sp|Q55GV3|PAKC_DICDI Serine/threonine-protein kinase pakC OS=Dictyostelium discoideum GN=pakC PE=1 SV=2 830 1022 7.0E-12
sp|Q86I06|NEK3_DICDI Probable serine/threonine-protein kinase nek3 OS=Dictyostelium discoideum GN=nek3 PE=3 SV=1 814 1021 7.0E-12
sp|Q6BNF3|STE20_DEBHA Serine/threonine-protein kinase STE20 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=STE20 PE=3 SV=2 290 562 7.0E-12
sp|P17613|KR1_SUHVK Serine/threonine-protein kinase OS=Suid herpesvirus 1 (strain Kaplan) GN=PK PE=3 SV=1 811 1029 7.0E-12
sp|O14299|WIS4_SCHPO MAP kinase kinase kinase wis4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=wis4 PE=3 SV=1 826 1021 7.0E-12
sp|Q6C3D7|STE20_YARLI Serine/threonine-protein kinase STE20 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=STE20 PE=3 SV=1 826 964 7.0E-12
sp|A0AUV4|SMKY_MOUSE Sperm motility kinase Y OS=Mus musculus GN=Gm7168 PE=2 SV=1 827 1022 7.0E-12
sp|Q38775|CDC2D_ANTMA Cell division control protein 2 homolog D OS=Antirrhinum majus GN=CDC2D PE=2 SV=1 827 965 8.0E-12
sp|Q55FS2|STK4L_DICDI Serine/threonine-protein kinase 4 homolog B OS=Dictyostelium discoideum GN=krsB PE=3 SV=1 829 1043 8.0E-12
sp|Q55BN8|NEK2_DICDI Probable serine/threonine-protein kinase nek2 OS=Dictyostelium discoideum GN=nek2 PE=1 SV=1 812 1021 8.0E-12
sp|Q38997|KIN10_ARATH SNF1-related protein kinase catalytic subunit alpha KIN10 OS=Arabidopsis thaliana GN=KIN10 PE=1 SV=2 828 995 8.0E-12
sp|Q54SJ5|MYLKC_DICDI Probable myosin light chain kinase DDB_G0282429 OS=Dictyostelium discoideum GN=DDB_G0282429 PE=3 SV=1 859 1014 8.0E-12
sp|Q54RJ4|IKSA_DICDI Probable serine/threonine-protein kinase iksA OS=Dictyostelium discoideum GN=iksA PE=3 SV=1 829 969 8.0E-12
sp|Q00646|CDK1_EMENI Cyclin-dependent kinase 1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=nimX PE=2 SV=1 846 984 8.0E-12
sp|Q9JLM8|DCLK1_MOUSE Serine/threonine-protein kinase DCLK1 OS=Mus musculus GN=Dclk1 PE=1 SV=1 828 968 8.0E-12
sp|P23437|CDK2_XENLA Cyclin-dependent kinase 2 OS=Xenopus laevis GN=cdk2 PE=1 SV=3 830 964 8.0E-12
sp|Q5BBL3|STE20_EMENI Serine/threonine-protein kinase ste20 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=ste20 PE=3 SV=1 287 561 9.0E-12
sp|Q07176|MMK1_MEDSA Mitogen-activated protein kinase homolog MMK1 OS=Medicago sativa GN=MMK1 PE=1 SV=1 830 980 9.0E-12
sp|O15075|DCLK1_HUMAN Serine/threonine-protein kinase DCLK1 OS=Homo sapiens GN=DCLK1 PE=1 SV=2 828 968 9.0E-12
sp|P54744|PKNB_MYCLE Serine/threonine-protein kinase PknB OS=Mycobacterium leprae (strain TN) GN=pknB PE=3 SV=3 831 1014 9.0E-12
sp|Q9LX30|GCN2_ARATH Probable serine/threonine-protein kinase GCN2 OS=Arabidopsis thaliana GN=GCN2 PE=2 SV=2 578 655 1.0E-11
sp|Q6DE87|CHK1_XENLA Serine/threonine-protein kinase Chk1 OS=Xenopus laevis GN=chek1 PE=1 SV=2 831 964 1.0E-11
sp|Q2KI84|SYHC_BOVIN Histidine--tRNA ligase, cytoplasmic OS=Bos taurus GN=HARS PE=2 SV=1 1062 1456 1.0E-11
sp|Q2QY53|CIPKW_ORYSJ CBL-interacting protein kinase 32 OS=Oryza sativa subsp. japonica GN=CIPK32 PE=2 SV=2 818 989 1.0E-11
sp|Q6VAB6|KSR2_HUMAN Kinase suppressor of Ras 2 OS=Homo sapiens GN=KSR2 PE=1 SV=2 721 1021 1.0E-11
sp|P49615|CDK5_MOUSE Cyclin-dependent-like kinase 5 OS=Mus musculus GN=Cdk5 PE=1 SV=1 814 967 1.0E-11
sp|Q02399|CDK5_BOVIN Cyclin-dependent-like kinase 5 OS=Bos taurus GN=CDK5 PE=1 SV=2 814 967 1.0E-11
sp|Q54XX5|Y9849_DICDI Probable serine/threonine-protein kinase DDB_G0278535 OS=Dictyostelium discoideum GN=DDB_G0278535 PE=3 SV=1 830 1023 1.0E-11
sp|Q2RAX3|CIPKX_ORYSJ CBL-interacting protein kinase 33 OS=Oryza sativa subsp. japonica GN=CIPK33 PE=2 SV=1 818 989 1.0E-11
sp|Q9FZ36|M3K2_ARATH Mitogen-activated protein kinase kinase kinase 2 OS=Arabidopsis thaliana GN=ANP2 PE=2 SV=1 271 492 1.0E-11
sp|Q4KM47|CDK10_RAT Cyclin-dependent kinase 10 OS=Rattus norvegicus GN=Cdk10 PE=2 SV=1 820 970 1.0E-11
sp|Q06060|MPK_PEA Mitogen-activated protein kinase homolog D5 OS=Pisum sativum PE=2 SV=1 830 980 1.0E-11
sp|Q00535|CDK5_HUMAN Cyclin-dependent-like kinase 5 OS=Homo sapiens GN=CDK5 PE=1 SV=3 814 967 1.0E-11
sp|Q6FKD4|PHO85_CANGA Negative regulator of the PHO system OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PHO85 PE=3 SV=1 818 964 1.0E-11
sp|Q9BYT3|STK33_HUMAN Serine/threonine-protein kinase 33 OS=Homo sapiens GN=STK33 PE=1 SV=1 830 985 1.0E-11
sp|Q62673|PLK1_RAT Serine/threonine-protein kinase PLK1 OS=Rattus norvegicus GN=Plk1 PE=2 SV=2 830 1035 1.0E-11
sp|Q9USS2|PPK29_SCHPO Serine/threonine-protein kinase ppk29 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppk29 PE=1 SV=1 834 1021 1.0E-11
sp|P34331|PLK1_CAEEL Serine/threonine-protein kinase plk-1 OS=Caenorhabditis elegans GN=plk-1 PE=1 SV=3 829 1073 1.0E-11
sp|Q7RZD3|STE20_NEUCR Serine/threonine-protein kinase ste20 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=stk-4 PE=3 SV=1 830 964 1.0E-11
sp|Q5RD00|AAPK2_PONAB 5'-AMP-activated protein kinase catalytic subunit alpha-2 OS=Pongo abelii GN=PRKAA2 PE=2 SV=1 812 1003 1.0E-11
sp|O88866|HUNK_MOUSE Hormonally up-regulated neu tumor-associated kinase OS=Mus musculus GN=Hunk PE=2 SV=1 827 964 1.0E-11
sp|Q2V452|CIPK3_ARATH CBL-interacting serine/threonine-protein kinase 3 OS=Arabidopsis thaliana GN=CIPK3 PE=1 SV=2 827 962 1.0E-11
sp|Q2ULU3|STE20_ASPOR Serine/threonine-protein kinase ste20 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=ste20 PE=3 SV=1 287 561 1.0E-11
sp|Q97IC2|PKN2_CLOAB Probable serine/threonine-protein kinase CA_C1728 OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=CA_C1728 PE=3 SV=1 831 965 1.0E-11
sp|P92199|ROCK_CAEEL Rho-associated protein kinase let-502 OS=Caenorhabditis elegans GN=let-502 PE=1 SV=1 830 964 1.0E-11
sp|Q60DG4|NEK4_ORYSJ Serine/threonine-protein kinase Nek4 OS=Oryza sativa subsp. japonica GN=NEK4 PE=2 SV=1 830 1026 1.0E-11
sp|Q9LVL5|WNK4_ARATH Probable serine/threonine-protein kinase WNK4 OS=Arabidopsis thaliana GN=WNK4 PE=1 SV=1 814 1057 1.0E-11
sp|O95819|M4K4_HUMAN Mitogen-activated protein kinase kinase kinase kinase 4 OS=Homo sapiens GN=MAP4K4 PE=1 SV=2 825 972 1.0E-11
sp|Q8IYT8|ULK2_HUMAN Serine/threonine-protein kinase ULK2 OS=Homo sapiens GN=ULK2 PE=1 SV=3 322 492 1.0E-11
sp|O80673|CAMK1_ARATH CDPK-related kinase 1 OS=Arabidopsis thaliana GN=CRK1 PE=1 SV=1 829 1021 1.0E-11
sp|Q3UMM4|CDK10_MOUSE Cyclin-dependent kinase 10 OS=Mus musculus GN=Cdk10 PE=1 SV=1 820 970 1.0E-11
sp|Q2TBL8|CDK10_BOVIN Cyclin-dependent kinase 10 OS=Bos taurus GN=CDK10 PE=2 SV=1 820 970 1.0E-11
sp|P70032|PLK1_XENLA Serine/threonine-protein kinase PLK1 OS=Xenopus laevis GN=plk1 PE=1 SV=1 830 1035 2.0E-11
sp|P97820|M4K4_MOUSE Mitogen-activated protein kinase kinase kinase kinase 4 OS=Mus musculus GN=Map4k4 PE=1 SV=1 825 972 2.0E-11
sp|A8WVU9|ROCK_CAEBR Rho-associated protein kinase let-502 OS=Caenorhabditis briggsae GN=let-502 PE=3 SV=2 830 964 2.0E-11
sp|P34112|CDK1_DICDI Cyclin-dependent kinase 1 OS=Dictyostelium discoideum GN=cdk1 PE=2 SV=1 830 984 2.0E-11
sp|Q10KY3|CAMK1_ORYSJ Calcium/calmodulin-dependent serine/threonine-protein kinase 1 OS=Oryza sativa subsp. japonica GN=CAMK1 PE=1 SV=1 782 1021 2.0E-11
sp|Q9Y2U5|M3K2_HUMAN Mitogen-activated protein kinase kinase kinase 2 OS=Homo sapiens GN=MAP3K2 PE=1 SV=2 818 1022 2.0E-11
sp|Q28948|AAPK2_PIG 5'-AMP-activated protein kinase catalytic subunit alpha-2 OS=Sus scrofa GN=PRKAA2 PE=2 SV=2 812 1003 2.0E-11
sp|Q9ES74|NEK7_MOUSE Serine/threonine-protein kinase Nek7 OS=Mus musculus GN=Nek7 PE=1 SV=1 857 1015 2.0E-11
sp|Q8IWQ3|BRSK2_HUMAN Serine/threonine-protein kinase BRSK2 OS=Homo sapiens GN=BRSK2 PE=1 SV=3 818 964 2.0E-11
sp|Q01389|BCK1_YEAST Serine/threonine-protein kinase BCK1/SLK1/SSP31 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BCK1 PE=1 SV=1 289 541 2.0E-11
sp|P43450|CDK2_CARAU Cyclin-dependent kinase 2 OS=Carassius auratus GN=cdk2 PE=2 SV=1 818 964 2.0E-11
sp|Q61035|SYHC_MOUSE Histidine--tRNA ligase, cytoplasmic OS=Mus musculus GN=Hars PE=1 SV=2 1062 1456 2.0E-11
sp|Q09137|AAPK2_RAT 5'-AMP-activated protein kinase catalytic subunit alpha-2 OS=Rattus norvegicus GN=Prkaa2 PE=1 SV=1 812 990 2.0E-11
sp|D3ZBE5|NEK7_RAT Serine/threonine-protein kinase Nek7 OS=Rattus norvegicus GN=Nek7 PE=2 SV=1 857 1015 2.0E-11
sp|P34208|CHK1_SCHPO Serine/threonine-protein kinase chk1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=chk1 PE=1 SV=2 819 964 2.0E-11
sp|P57058|HUNK_HUMAN Hormonally up-regulated neu tumor-associated kinase OS=Homo sapiens GN=HUNK PE=1 SV=1 827 964 2.0E-11
sp|Q68UT7|HUNK_PANTR Hormonally up-regulated neu tumor-associated kinase OS=Pan troglodytes GN=HUNK PE=3 SV=1 827 964 2.0E-11
sp|Q15131|CDK10_HUMAN Cyclin-dependent kinase 10 OS=Homo sapiens GN=CDK10 PE=1 SV=1 820 970 2.0E-11
sp|Q10N20|MPK5_ORYSJ Mitogen-activated protein kinase 5 OS=Oryza sativa subsp. japonica GN=MPK5 PE=1 SV=1 830 964 2.0E-11
sp|A2XFC8|MPK5_ORYSI Mitogen-activated protein kinase 5 OS=Oryza sativa subsp. indica GN=MPK5 PE=1 SV=2 830 964 2.0E-11
sp|P54646|AAPK2_HUMAN 5'-AMP-activated protein kinase catalytic subunit alpha-2 OS=Homo sapiens GN=PRKAA2 PE=1 SV=2 812 1003 2.0E-11
sp|Q9SG12|CAMK6_ARATH CDPK-related kinase 6 OS=Arabidopsis thaliana GN=CRK6 PE=1 SV=1 829 986 2.0E-11
sp|P70218|M4K1_MOUSE Mitogen-activated protein kinase kinase kinase kinase 1 OS=Mus musculus GN=Map4k1 PE=1 SV=1 814 1021 2.0E-11
sp|Q69Z98|BRSK2_MOUSE Serine/threonine-protein kinase BRSK2 OS=Mus musculus GN=Brsk2 PE=1 SV=2 818 964 2.0E-11
sp|Q9Z2E3|ERN2_MOUSE Serine/threonine-protein kinase/endoribonuclease IRE2 OS=Mus musculus GN=Ern2 PE=2 SV=2 818 962 2.0E-11
sp|O61122|SVKA_DICDI Serine/threonine-protein kinase svkA OS=Dictyostelium discoideum GN=svkA PE=1 SV=1 830 1022 2.0E-11
sp|A2BD05|NEK6_PIG Serine/threonine-protein kinase Nek6 OS=Sus scrofa GN=NEK6 PE=3 SV=1 857 989 3.0E-11
sp|Q54RR9|Y9844_DICDI Probable serine/threonine-protein kinase DDB_G0282963 OS=Dictyostelium discoideum GN=DDB_G0282963 PE=3 SV=1 830 1021 3.0E-11
sp|A6QGC0|PRKC_STAAE Serine/threonine-protein kinase PrkC OS=Staphylococcus aureus (strain Newman) GN=prkC PE=1 SV=1 831 965 3.0E-11
sp|Q8KY50|STKP1_STRPN Serine/threonine-protein kinase StkP OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=stkP PE=1 SV=1 831 971 3.0E-11
sp|Q54F40|Y1133_DICDI Probable protein kinase DDB_G0291133 OS=Dictyostelium discoideum GN=DDB_G0291133 PE=3 SV=1 819 1021 3.0E-11
sp|Q02723|RKIN1_SECCE Carbon catabolite-derepressing protein kinase OS=Secale cereale GN=RKIN1 PE=2 SV=1 830 989 3.0E-11
sp|P25390|SSK22_YEAST Serine/threonine-protein kinase SSK22 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SSK22 PE=1 SV=2 826 964 3.0E-11
sp|Q8BRK8|AAPK2_MOUSE 5'-AMP-activated protein kinase catalytic subunit alpha-2 OS=Mus musculus GN=Prkaa2 PE=1 SV=3 812 964 3.0E-11
sp|Q9H0K1|SIK2_HUMAN Serine/threonine-protein kinase SIK2 OS=Homo sapiens GN=SIK2 PE=1 SV=1 827 967 3.0E-11
sp|D3ZML2|BRSK2_RAT Serine/threonine-protein kinase BRSK2 OS=Rattus norvegicus GN=Brsk2 PE=1 SV=1 818 964 3.0E-11
sp|Q9ES70|NEK6_MOUSE Serine/threonine-protein kinase Nek6 OS=Mus musculus GN=Nek6 PE=1 SV=1 857 989 3.0E-11
sp|Q39023|MPK3_ARATH Mitogen-activated protein kinase 3 OS=Arabidopsis thaliana GN=MPK3 PE=1 SV=2 823 980 3.0E-11
sp|P59895|NEK6_RAT Serine/threonine-protein kinase Nek6 OS=Rattus norvegicus GN=Nek6 PE=1 SV=1 857 989 3.0E-11
sp|Q40532|NTF4_TOBAC Mitogen-activated protein kinase homolog NTF4 OS=Nicotiana tabacum GN=NTF4 PE=2 SV=1 830 980 3.0E-11
sp|P54666|CC2H3_TRYBB Cell division control protein 2 homolog 3 OS=Trypanosoma brucei brucei GN=CRK3 PE=3 SV=1 830 970 3.0E-11
sp|P12081|SYHC_HUMAN Histidine--tRNA ligase, cytoplasmic OS=Homo sapiens GN=HARS PE=1 SV=2 1045 1456 3.0E-11
sp|E1BK52|STK10_BOVIN Serine/threonine-protein kinase 10 OS=Bos taurus GN=STK10 PE=3 SV=3 830 1021 3.0E-11
sp|Q28GW8|MELK_XENTR Maternal embryonic leucine zipper kinase OS=Xenopus tropicalis GN=melk PE=2 SV=1 830 1021 3.0E-11
sp|P9WI81|PKNB_MYCTU Serine/threonine-protein kinase PknB OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pknB PE=1 SV=1 831 964 3.0E-11
sp|P9WI80|PKNB_MYCTO Serine/threonine-protein kinase PknB OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=pknB PE=3 SV=1 831 964 3.0E-11
sp|P0A5S5|PKNB_MYCBO Serine/threonine-protein kinase PknB OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=pknB PE=3 SV=1 831 964 3.0E-11
sp|Q5AP97|SWE1_CANAL Mitosis inhibitor protein kinase SWE1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SWE1 PE=1 SV=1 831 983 3.0E-11
sp|B7ZR30|STK10_XENLA Serine/threonine-protein kinase 10-A OS=Xenopus laevis GN=stk10-a PE=1 SV=1 830 1021 3.0E-11
sp|Q03957|CTK1_YEAST CTD kinase subunit alpha OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CTK1 PE=1 SV=1 820 987 3.0E-11
sp|P28829|BYR2_SCHPO Protein kinase byr2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=byr2 PE=1 SV=1 315 490 3.0E-11
sp|Q54LH8|Y6627_DICDI Probable serine/threonine-protein kinase DDB_G0286627 OS=Dictyostelium discoideum GN=DDB_G0286627 PE=3 SV=1 823 964 3.0E-11
sp|Q8CFH6|SIK2_MOUSE Serine/threonine-protein kinase SIK2 OS=Mus musculus GN=Sik2 PE=1 SV=1 827 967 3.0E-11
sp|P51958|CDK1_CARAU Cyclin-dependent kinase 1 OS=Carassius auratus GN=cdk1 PE=2 SV=1 814 984 3.0E-11
sp|Q6AX33|MAST3_XENLA Microtubule-associated serine/threonine-protein kinase 3 OS=Xenopus laevis GN=mast3 PE=2 SV=1 830 1014 3.0E-11
sp|Q55GC2|DST2_DICDI Serine/threonine-protein kinase dst2 OS=Dictyostelium discoideum GN=dst2 PE=3 SV=1 830 967 3.0E-11
sp|Q3UVC0|KSR2_MOUSE Kinase suppressor of Ras 2 OS=Mus musculus GN=Ksr2 PE=1 SV=2 773 1021 3.0E-11
sp|O14328|KSP1_SCHPO Serine/threonine-protein kinase ksp1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ksp1 PE=1 SV=1 812 967 3.0E-11
sp|Q9HC98|NEK6_HUMAN Serine/threonine-protein kinase Nek6 OS=Homo sapiens GN=NEK6 PE=1 SV=2 857 989 3.0E-11
sp|P27636|CDC15_YEAST Cell division control protein 15 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC15 PE=1 SV=3 799 1022 3.0E-11
sp|Q2RA93|WNK6_ORYSJ Probable serine/threonine-protein kinase WNK6 OS=Oryza sativa subsp. japonica GN=WNK6 PE=2 SV=1 812 995 3.0E-11
sp|O61661|CHK1_DROME Serine/threonine-protein kinase grp OS=Drosophila melanogaster GN=grp PE=1 SV=2 824 964 3.0E-11
sp|Q4WHP3|STE20_ASPFU Serine/threonine-protein kinase ste20 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=ste20 PE=3 SV=2 826 964 4.0E-11
sp|Q5BBL3|STE20_EMENI Serine/threonine-protein kinase ste20 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=ste20 PE=3 SV=1 826 964 4.0E-11
sp|P17157|PHO85_YEAST Cyclin-dependent protein kinase PHO85 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PHO85 PE=1 SV=2 818 964 4.0E-11
sp|Q751E8|PHO85_ASHGO Negative regulator of the PHO system OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=PHO85 PE=3 SV=2 818 964 4.0E-11
sp|Q9JM52|MINK1_MOUSE Misshapen-like kinase 1 OS=Mus musculus GN=Mink1 PE=1 SV=3 830 972 4.0E-11
sp|Q8N4C8|MINK1_HUMAN Misshapen-like kinase 1 OS=Homo sapiens GN=MINK1 PE=1 SV=2 830 967 4.0E-11
sp|F1LP90|MINK1_RAT Misshapen-like kinase 1 OS=Rattus norvegicus GN=Mink1 PE=1 SV=2 830 972 4.0E-11
sp|O60307|MAST3_HUMAN Microtubule-associated serine/threonine-protein kinase 3 OS=Homo sapiens GN=MAST3 PE=1 SV=2 830 991 4.0E-11
sp|Q2PQN9|CDK5_GLOMM Cyclin-dependent kinase 5 homolog OS=Glossina morsitans morsitans GN=Cdk5 PE=2 SV=1 821 967 4.0E-11
sp|Q55DK2|Y9628_DICDI Probable serine/threonine-protein kinase DDB_G0269628 OS=Dictyostelium discoideum GN=DDB_G0269628 PE=3 SV=1 867 1023 4.0E-11
sp|Q5R4R2|SYHC_PONAB Histidine--tRNA ligase, cytoplasmic OS=Pongo abelii GN=HARS PE=2 SV=1 1045 1456 4.0E-11
sp|Q9LET1|CAMK7_ARATH CDPK-related kinase 7 OS=Arabidopsis thaliana GN=CRK7 PE=1 SV=1 829 1021 4.0E-11
sp|Q6FN53|STE20_CANGA Serine/threonine-protein kinase STE20 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=STE20 PE=3 SV=1 827 967 4.0E-11
sp|P25859|CKB11_ARATH Cyclin-dependent kinase B1-1 OS=Arabidopsis thaliana GN=CDKB1-1 PE=1 SV=2 827 964 4.0E-11
sp|Q9LDI3|CIPKO_ARATH CBL-interacting serine/threonine-protein kinase 24 OS=Arabidopsis thaliana GN=CIPK24 PE=1 SV=1 818 962 4.0E-11
sp|Q7RAH3|CDPK1_PLAYO Calcium-dependent protein kinase 1 OS=Plasmodium yoelii yoelii GN=CPK1 PE=3 SV=3 827 971 4.0E-11
sp|Q9V3Q6|M3K7_DROME Mitogen-activated protein kinase kinase kinase 7 OS=Drosophila melanogaster GN=Tak1 PE=2 SV=1 812 982 4.0E-11
sp|Q9HGY5|PHO85_CANAX Negative regulator of the PHO system OS=Candida albicans GN=PHO85 PE=3 SV=1 830 965 4.0E-11
sp|Q9XA16|PKNX_STRCO Probable serine/threonine-protein kinase SCO3848 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=SCO3848 PE=3 SV=1 831 994 4.0E-11
sp|Q2ULU3|STE20_ASPOR Serine/threonine-protein kinase ste20 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=ste20 PE=3 SV=1 826 964 5.0E-11
sp|P62343|CDPK1_PLAFK Calcium-dependent protein kinase 1 OS=Plasmodium falciparum (isolate K1 / Thailand) GN=CPK1 PE=1 SV=2 827 971 5.0E-11
sp|P62344|CDPK1_PLAF7 Calcium-dependent protein kinase 1 OS=Plasmodium falciparum (isolate 3D7) GN=CPK1 PE=3 SV=2 827 971 5.0E-11
sp|P30290|MIK1_SCHPO Mitosis inhibitor protein kinase mik1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mik1 PE=3 SV=1 825 983 5.0E-11
sp|Q8IU85|KCC1D_HUMAN Calcium/calmodulin-dependent protein kinase type 1D OS=Homo sapiens GN=CAMK1D PE=1 SV=1 825 968 5.0E-11
sp|Q9FX43|M2K9_ARATH Mitogen-activated protein kinase kinase 9 OS=Arabidopsis thaliana GN=MKK9 PE=1 SV=1 832 970 5.0E-11
sp|Q63699|CDK2_RAT Cyclin-dependent kinase 2 OS=Rattus norvegicus GN=Cdk2 PE=1 SV=1 863 965 5.0E-11
sp|Q0IHQ8|STK10_XENTR Serine/threonine-protein kinase 10 OS=Xenopus tropicalis GN=stk10 PE=2 SV=1 830 1021 5.0E-11
sp|Q9R1L5|MAST1_MOUSE Microtubule-associated serine/threonine-protein kinase 1 OS=Mus musculus GN=Mast1 PE=1 SV=3 830 991 5.0E-11
sp|G5ECH7|CDK5_CAEEL Cyclin-dependent-like kinase 5 OS=Caenorhabditis elegans GN=cdk-5 PE=1 SV=1 818 967 5.0E-11
sp|P48963|CDK2_MESAU Cyclin-dependent kinase 2 OS=Mesocricetus auratus GN=CDK2 PE=2 SV=1 863 965 5.0E-11
sp|Q8L4P8|CKB11_ORYSJ Cyclin-dependent kinase B1-1 OS=Oryza sativa subsp. japonica GN=CDKB1-1 PE=2 SV=1 820 965 5.0E-11
sp|Q810W7|MAST1_RAT Microtubule-associated serine/threonine-protein kinase 1 OS=Rattus norvegicus GN=Mast1 PE=1 SV=1 830 991 5.0E-11
sp|O55076|CDK2_CRIGR Cyclin-dependent kinase 2 OS=Cricetulus griseus GN=CDK2 PE=2 SV=1 863 965 5.0E-11
sp|Q924X7|STK33_MOUSE Serine/threonine-protein kinase 33 OS=Mus musculus GN=Stk33 PE=1 SV=2 830 968 6.0E-11
sp|E9PTG8|STK10_RAT Serine/threonine-protein kinase 10 OS=Rattus norvegicus GN=Stk10 PE=1 SV=1 830 1022 6.0E-11
sp|Q5E9Y0|CDK2_BOVIN Cyclin-dependent kinase 2 OS=Bos taurus GN=CDK2 PE=2 SV=1 863 965 6.0E-11
sp|Q8BW96|KCC1D_MOUSE Calcium/calmodulin-dependent protein kinase type 1D OS=Mus musculus GN=Camk1d PE=1 SV=2 825 968 6.0E-11
sp|Q03497|STE20_YEAST Serine/threonine-protein kinase STE20 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=STE20 PE=1 SV=1 321 543 6.0E-11
sp|Q91821|MELK_XENLA Maternal embryonic leucine zipper kinase OS=Xenopus laevis GN=melk PE=1 SV=2 830 1021 6.0E-11
sp|O74456|PEF1_SCHPO Serine/threonine-protein kinase pef1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pef1 PE=3 SV=2 821 965 6.0E-11
sp|Q76MJ5|ERN2_HUMAN Serine/threonine-protein kinase/endoribonuclease IRE2 OS=Homo sapiens GN=ERN2 PE=1 SV=4 818 962 6.0E-11
sp|Q9KIG4|PK1_STRTO Serine/threonine-protein kinase PK-1 OS=Streptomyces toyocaensis GN=spk1 PE=1 SV=1 830 978 6.0E-11
sp|Q10GB1|NEK1_ORYSJ Serine/threonine-protein kinase Nek1 OS=Oryza sativa subsp. japonica GN=NEK1 PE=3 SV=1 830 1026 6.0E-11
sp|O14047|PPK11_SCHPO Serine/threonine-protein kinase ppk11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppk11 PE=3 SV=1 315 547 7.0E-11
sp|Q9Y2H9|MAST1_HUMAN Microtubule-associated serine/threonine-protein kinase 1 OS=Homo sapiens GN=MAST1 PE=1 SV=2 830 991 7.0E-11
sp|Q2V419|CKB12_ARATH Cyclin-dependent kinase B1-2 OS=Arabidopsis thaliana GN=CDKB1-2 PE=1 SV=2 822 964 7.0E-11
sp|P92958|KIN11_ARATH SNF1-related protein kinase catalytic subunit alpha KIN11 OS=Arabidopsis thaliana GN=KIN11 PE=1 SV=1 819 964 7.0E-11
sp|O22932|CIPKB_ARATH CBL-interacting serine/threonine-protein kinase 11 OS=Arabidopsis thaliana GN=CIPK11 PE=1 SV=1 819 962 7.0E-11
sp|P45894|AAPK1_CAEEL 5'-AMP-activated protein kinase catalytic subunit alpha-1 OS=Caenorhabditis elegans GN=aak-1 PE=2 SV=2 830 964 7.0E-11
sp|O55098|STK10_MOUSE Serine/threonine-protein kinase 10 OS=Mus musculus GN=Stk10 PE=1 SV=2 830 1022 7.0E-11
sp|Q5AG71|HSL1_CANAL Serine/threonine-protein kinase HSL1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=HSL1 PE=1 SV=1 821 969 7.0E-11
sp|Q2VWQ3|STE20_TALMA Serine/threonine-protein kinase pakA OS=Talaromyces marneffei GN=pakA PE=3 SV=1 826 964 8.0E-11
sp|Q00372|SNF1_CANGA Carbon catabolite-derepressing protein kinase OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=SNF1 PE=3 SV=2 821 995 8.0E-11
sp|Q3U214|MAST3_MOUSE Microtubule-associated serine/threonine-protein kinase 3 OS=Mus musculus GN=Mast3 PE=1 SV=3 830 991 8.0E-11
sp|Q8XJL8|PKN2_CLOPE Probable serine/threonine-protein kinase CPE1738 OS=Clostridium perfringens (strain 13 / Type A) GN=CPE1738 PE=3 SV=1 831 965 8.0E-11
sp|Q86HG9|Y9871_DICDI Probable serine/threonine-protein kinase DDB_G0271682 OS=Dictyostelium discoideum GN=DDB_G0271682 PE=3 SV=2 830 1026 8.0E-11
sp|Q9QYZ3|SMK2B_MOUSE Sperm motility kinase 2B OS=Mus musculus GN=Smok2b PE=2 SV=1 827 1033 8.0E-11
sp|P24941|CDK2_HUMAN Cyclin-dependent kinase 2 OS=Homo sapiens GN=CDK2 PE=1 SV=2 863 965 8.0E-11
sp|Q3ULB5|PAK6_MOUSE Serine/threonine-protein kinase PAK 6 OS=Mus musculus GN=Pak6 PE=2 SV=1 356 542 8.0E-11
sp|Q9WTK7|STK11_MOUSE Serine/threonine-protein kinase STK11 OS=Mus musculus GN=Stk11 PE=1 SV=1 818 964 9.0E-11
sp|Q61RA2|CHK1_CAEBR Serine/threonine-protein kinase chk-1 OS=Caenorhabditis briggsae GN=chk-1 PE=3 SV=1 812 964 9.0E-11
sp|P97377|CDK2_MOUSE Cyclin-dependent kinase 2 OS=Mus musculus GN=Cdk2 PE=1 SV=2 863 964 9.0E-11
sp|Q55EI8|Y9956_DICDI Probable serine/threonine-protein kinase DDB_G0268876 OS=Dictyostelium discoideum GN=DDB_G0268876 PE=3 SV=1 830 994 9.0E-11
sp|Q550L8|IFKB_DICDI Probable serine/threonine-protein kinase ifkB OS=Dictyostelium discoideum GN=ifkB PE=2 SV=1 589 651 1.0E-10
sp|Q99759|M3K3_HUMAN Mitogen-activated protein kinase kinase kinase 3 OS=Homo sapiens GN=MAP3K3 PE=1 SV=2 359 529 1.0E-10
sp|P38692|KIC1_YEAST Serine/threonine-protein kinase KIC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KIC1 PE=1 SV=1 828 1023 1.0E-10
sp|Q2QMH1|NEK2_ORYSJ Serine/threonine-protein kinase Nek2 OS=Oryza sativa subsp. japonica GN=NEK2 PE=2 SV=1 832 1026 1.0E-10
sp|A2ZMH2|NEK2_ORYSI Serine/threonine-protein kinase Nek2 OS=Oryza sativa subsp. indica GN=NEK2 PE=3 SV=1 832 1026 1.0E-10
sp|Q9LGV5|CIPK1_ORYSJ CBL-interacting protein kinase 1 OS=Oryza sativa subsp. japonica GN=CIPK1 PE=2 SV=1 814 1062 1.0E-10
sp|Q09499|IRE1_CAEEL Serine/threonine-protein kinase/endoribonuclease ire-1 OS=Caenorhabditis elegans GN=ire-1 PE=1 SV=2 831 962 1.0E-10
sp|Q64261|CDK6_MOUSE Cyclin-dependent kinase 6 OS=Mus musculus GN=Cdk6 PE=1 SV=2 863 964 1.0E-10
sp|Q00534|CDK6_HUMAN Cyclin-dependent kinase 6 OS=Homo sapiens GN=CDK6 PE=1 SV=1 863 964 1.0E-10
sp|Q5XHI9|HUNKA_XENLA Hormonally up-regulated neu tumor-associated kinase homolog A OS=Xenopus laevis GN=hunk-a PE=2 SV=1 827 1061 1.0E-10
sp|Q9Z2B5|E2AK3_MOUSE Eukaryotic translation initiation factor 2-alpha kinase 3 OS=Mus musculus GN=Eif2ak3 PE=1 SV=1 571 650 1.0E-10
sp|Q336M2|CDKE1_ORYSJ Cyclin-dependent kinase E-1 OS=Oryza sativa subsp. japonica GN=CDKE-1 PE=2 SV=2 819 965 1.0E-10
sp|O74536|SNF1_SCHPO SNF1-like protein kinase ssp2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ssp2 PE=1 SV=1 859 995 1.0E-10
sp|Q7Z8E9|STE20_MAGO7 Serine/threonine-protein kinase MST20 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=MST20 PE=3 SV=3 830 964 1.0E-10
sp|P54736|PKN2_MYXXA Serine/threonine-protein kinase pkn2 OS=Myxococcus xanthus GN=pkn2 PE=3 SV=1 814 964 1.0E-10
sp|O75385|ULK1_HUMAN Serine/threonine-protein kinase ULK1 OS=Homo sapiens GN=ULK1 PE=1 SV=2 818 963 1.0E-10
sp|Q39025|MPK5_ARATH Mitogen-activated protein kinase 5 OS=Arabidopsis thaliana GN=MPK5 PE=2 SV=2 820 964 1.0E-10
sp|Q9QY01|ULK2_MOUSE Serine/threonine-protein kinase ULK2 OS=Mus musculus GN=Ulk2 PE=1 SV=1 322 492 1.0E-10
sp|Q8SRF5|Y823_ENCCU Probable cell division protein kinase ECU08_0230 OS=Encephalitozoon cuniculi (strain GB-M1) GN=ECU08_0230 PE=3 SV=1 842 1039 1.0E-10
sp|Q00537|CDK17_HUMAN Cyclin-dependent kinase 17 OS=Homo sapiens GN=CDK17 PE=1 SV=2 829 965 1.0E-10
sp|P0CY24|STE20_CANAL Serine/threonine-protein kinase CST20 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CST20 PE=3 SV=1 827 964 1.0E-10
sp|O35831|CDK17_RAT Cyclin-dependent kinase 17 OS=Rattus norvegicus GN=Cdk17 PE=1 SV=1 821 964 1.0E-10
sp|P0CY23|STE20_CANAX Serine/threonine-protein kinase CST20 OS=Candida albicans GN=CST20 PE=3 SV=1 827 964 1.0E-10
sp|P22216|RAD53_YEAST Serine/threonine-protein kinase RAD53 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RAD53 PE=1 SV=1 829 979 1.0E-10
sp|Q9CEF5|PKNB_LACLA Probable serine/threonine-protein kinase PknB OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=pknB PE=3 SV=1 831 1013 1.0E-10
sp|Q6P431|MKNK2_XENLA MAP kinase-interacting serine/threonine-protein kinase 2 OS=Xenopus laevis GN=mknk2 PE=2 SV=1 860 971 1.0E-10
sp|C4YRB7|STE20_CANAW Serine/threonine-protein kinase CST20 OS=Candida albicans (strain WO-1) GN=CST20 PE=3 SV=2 827 964 1.0E-10
sp|Q3UGM2|NEK10_MOUSE Serine/threonine-protein kinase Nek10 OS=Mus musculus GN=Nek10 PE=2 SV=2 796 992 1.0E-10
sp|O94804|STK10_HUMAN Serine/threonine-protein kinase 10 OS=Homo sapiens GN=STK10 PE=1 SV=1 826 1021 1.0E-10
sp|Q66I46|MKNK2_XENTR MAP kinase-interacting serine/threonine-protein kinase 2 OS=Xenopus tropicalis GN=mknk2 PE=2 SV=1 860 971 1.0E-10
sp|P0C865|MK07_RAT Mitogen-activated protein kinase 7 OS=Rattus norvegicus GN=Mapk7 PE=1 SV=1 829 964 1.0E-10
sp|P06782|SNF1_YEAST Carbon catabolite-derepressing protein kinase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SNF1 PE=1 SV=1 821 995 1.0E-10
sp|O55173|PDPK1_RAT 3-phosphoinositide-dependent protein kinase 1 OS=Rattus norvegicus GN=Pdpk1 PE=1 SV=2 830 1006 1.0E-10
sp|Q9WVS8|MK07_MOUSE Mitogen-activated protein kinase 7 OS=Mus musculus GN=Mapk7 PE=1 SV=1 829 964 1.0E-10
sp|Q54WD7|Y9719_DICDI Probable serine/threonine-protein kinase DDB_G0279719 OS=Dictyostelium discoideum GN=DDB_G0279719 PE=2 SV=1 850 1026 1.0E-10
sp|Q8K0D0|CDK17_MOUSE Cyclin-dependent kinase 17 OS=Mus musculus GN=Cdk17 PE=1 SV=2 829 965 1.0E-10
sp|A5PKJ4|MK07_BOVIN Mitogen-activated protein kinase 7 OS=Bos taurus GN=MAPK7 PE=2 SV=1 829 964 1.0E-10
sp|G5EFD2|KSRA_CAEEL Kinase suppressor of Ras A OS=Caenorhabditis elegans GN=ksr-1 PE=1 SV=1 853 1027 1.0E-10
sp|Q28DZ1|IKKA_XENTR Inhibitor of nuclear factor kappa-B kinase subunit alpha OS=Xenopus tropicalis GN=chuk PE=2 SV=1 831 963 1.0E-10
sp|Q23023|UNC51_CAEEL Serine/threonine-protein kinase unc-51 OS=Caenorhabditis elegans GN=unc-51 PE=1 SV=1 303 492 2.0E-10
sp|Q7RZD3|STE20_NEUCR Serine/threonine-protein kinase ste20 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=stk-4 PE=3 SV=1 337 492 2.0E-10
sp|P08458|SPS1_YEAST Sporulation-specific protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SPS1 PE=1 SV=2 807 1021 2.0E-10
sp|Q5ZJB4|IKKA_CHICK Inhibitor of nuclear factor kappa-B kinase subunit alpha OS=Gallus gallus GN=CHUK PE=2 SV=1 832 963 2.0E-10
sp|O70405|ULK1_MOUSE Serine/threonine-protein kinase ULK1 OS=Mus musculus GN=Ulk1 PE=1 SV=1 322 492 2.0E-10
sp|O70405|ULK1_MOUSE Serine/threonine-protein kinase ULK1 OS=Mus musculus GN=Ulk1 PE=1 SV=1 818 963 2.0E-10
sp|Q9Z2A0|PDPK1_MOUSE 3-phosphoinositide-dependent protein kinase 1 OS=Mus musculus GN=Pdpk1 PE=1 SV=2 830 1067 2.0E-10
sp|Q91727|CDK4_XENLA Cyclin-dependent kinase 4 OS=Xenopus laevis GN=cdk4 PE=1 SV=1 860 964 2.0E-10
sp|Q6CVA2|STE20_KLULA Serine/threonine-protein kinase STE20 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=STE20 PE=3 SV=1 830 967 2.0E-10
sp|Q13164|MK07_HUMAN Mitogen-activated protein kinase 7 OS=Homo sapiens GN=MAPK7 PE=1 SV=2 829 964 2.0E-10
sp|Q6BRY2|PHO85_DEBHA Negative regulator of the PHO system OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=PHO85 PE=3 SV=2 848 965 2.0E-10
sp|Q9HFW2|CLA4_ASHGO Serine/threonine-protein kinase CLA4 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=CLA4 PE=3 SV=1 830 964 2.0E-10
sp|Q8LIG4|CIPK3_ORYSJ CBL-interacting protein kinase 3 OS=Oryza sativa subsp. japonica GN=CIPK3 PE=2 SV=1 818 962 2.0E-10
sp|A2AQW0|M3K15_MOUSE Mitogen-activated protein kinase kinase kinase 15 OS=Mus musculus GN=Map3k15 PE=1 SV=1 862 1026 2.0E-10
sp|Q7TYY6|PKNL_MYCBO Serine/threonine-protein kinase PknL OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=pknL PE=3 SV=1 831 971 2.0E-10
sp|Q55A09|Y9963_DICDI Probable serine/threonine-protein kinase DDB_G0272254 OS=Dictyostelium discoideum GN=DDB_G0272254 PE=3 SV=1 776 1016 2.0E-10
sp|Q91XS8|ST17B_RAT Serine/threonine-protein kinase 17B OS=Rattus norvegicus GN=Stk17b PE=1 SV=1 828 1021 2.0E-10
sp|Q9ZSA4|CDPKR_ARATH Calcium-dependent protein kinase 27 OS=Arabidopsis thaliana GN=CPK27 PE=1 SV=3 827 1021 2.0E-10
sp|Q8I7M8|CDK17_CAEEL Cyclin-dependent kinase 17 OS=Caenorhabditis elegans GN=pct-1 PE=1 SV=1 830 964 2.0E-10
sp|Q04735|CDK16_MOUSE Cyclin-dependent kinase 16 OS=Mus musculus GN=Cdk16 PE=1 SV=1 821 965 2.0E-10
sp|Q02595|KPK2_PLAFK Probable serine/threonine-protein kinase 2 OS=Plasmodium falciparum (isolate K1 / Thailand) GN=PK2 PE=2 SV=1 830 979 2.0E-10
sp|B1WAS2|HUNK_XENTR Hormonally up-regulated neu tumor-associated kinase homolog OS=Xenopus tropicalis GN=hunk PE=2 SV=1 827 1061 2.0E-10
sp|Q802A6|STK4_SQUAC Serine/threonine-protein kinase 3/4 OS=Squalus acanthias GN=STK4 PE=2 SV=1 828 967 2.0E-10
sp|P9WI63|PKNL_MYCTU Serine/threonine-protein kinase PknL OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pknL PE=1 SV=1 831 971 2.0E-10
sp|P9WI62|PKNL_MYCTO Serine/threonine-protein kinase PknL OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=pknL PE=3 SV=1 831 971 2.0E-10
sp|Q40541|NPK1_TOBAC Mitogen-activated protein kinase kinase kinase NPK1 OS=Nicotiana tabacum GN=NPK1 PE=1 SV=1 291 492 2.0E-10
sp|Q8WTQ7|GRK7_HUMAN G protein-coupled receptor kinase 7 OS=Homo sapiens GN=GRK7 PE=1 SV=1 827 964 2.0E-10
sp|Q811L6|MAST4_MOUSE Microtubule-associated serine/threonine-protein kinase 4 OS=Mus musculus GN=Mast4 PE=1 SV=3 830 1014 2.0E-10
sp|Q8G4G1|PKNA2_BIFLO Probable serine/threonine-protein kinase pknA2 OS=Bifidobacterium longum (strain NCC 2705) GN=pknA2 PE=3 SV=1 831 964 2.0E-10
sp|Q92918|M4K1_HUMAN Mitogen-activated protein kinase kinase kinase kinase 1 OS=Homo sapiens GN=MAP4K1 PE=1 SV=1 814 1021 2.0E-10
sp|Q6C3J2|IPL1_YARLI Spindle assembly checkpoint kinase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=IPL1 PE=3 SV=1 818 968 2.0E-10
sp|Q9FIM9|CAMK4_ARATH CDPK-related kinase 4 OS=Arabidopsis thaliana GN=CRK4 PE=2 SV=1 792 986 2.0E-10
sp|Q6ZEZ5|NEK3_ORYSJ Serine/threonine-protein kinase Nek3 OS=Oryza sativa subsp. japonica GN=NEK3 PE=2 SV=1 818 1031 2.0E-10
sp|P06245|KAPB_YEAST cAMP-dependent protein kinase type 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPK2 PE=1 SV=2 830 1068 2.0E-10
sp|Q9URY1|PPK16_SCHPO Serine/threonine-protein kinase ppk16 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppk16 PE=1 SV=1 830 964 2.0E-10
sp|Q97PA9|STKP2_STRPN Serine/threonine-protein kinase StkP OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=stkP PE=1 SV=1 831 971 2.0E-10
sp|Q9U1Y5|CHK2_CAEEL Serine/threonine-protein kinase chk-2 OS=Caenorhabditis elegans GN=chk-2 PE=2 SV=2 863 962 2.0E-10
sp|Q00536|CDK16_HUMAN Cyclin-dependent kinase 16 OS=Homo sapiens GN=CDK16 PE=1 SV=1 821 965 2.0E-10
sp|Q60806|PLK3_MOUSE Serine/threonine-protein kinase PLK3 OS=Mus musculus GN=Plk3 PE=1 SV=2 818 1022 2.0E-10
sp|A1A5Q6|SMK_RAT Sperm motility kinase OS=Rattus norvegicus GN=Smok PE=2 SV=1 856 1022 2.0E-10
sp|Q09437|YP62_CAEEL Putative serine/threonine-protein kinase B0495.2 OS=Caenorhabditis elegans GN=B0495.2 PE=3 SV=1 830 965 2.0E-10
sp|P62205|PLK1_XENTR Serine/threonine-protein kinase PLK1 OS=Xenopus tropicalis GN=plk1 PE=2 SV=1 830 964 2.0E-10
sp|Q09170|CDS1_SCHPO Serine/threonine-protein kinase cds1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cds1 PE=1 SV=2 814 988 2.0E-10
sp|Q09831|PPK14_SCHPO Serine/threonine-protein kinase ppk14 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppk14 PE=1 SV=1 830 990 2.0E-10
sp|P83104|M3K7L_DROME Putative mitogen-activated protein kinase kinase kinase 7-like OS=Drosophila melanogaster GN=Takl1 PE=2 SV=1 813 1091 2.0E-10
sp|O01700|DLK1_CAEEL Mitogen-activated protein kinase kinase kinase dlk-1 OS=Caenorhabditis elegans GN=dlk-1 PE=1 SV=4 827 1016 2.0E-10
sp|Q84TI6|CDKE1_ARATH Cyclin-dependent kinase E-1 OS=Arabidopsis thaliana GN=CDKE-1 PE=1 SV=2 829 965 2.0E-10
sp|Q61083|M3K2_MOUSE Mitogen-activated protein kinase kinase kinase 2 OS=Mus musculus GN=Map3k2 PE=1 SV=2 818 1022 2.0E-10
sp|Q9R011|PLK3_RAT Serine/threonine-protein kinase PLK3 OS=Rattus norvegicus GN=Plk3 PE=1 SV=2 818 1022 2.0E-10
sp|Q96PF2|TSSK2_HUMAN Testis-specific serine/threonine-protein kinase 2 OS=Homo sapiens GN=TSSK2 PE=1 SV=2 830 969 2.0E-10
sp|Q8DNS0|STKP_STRR6 Serine/threonine-protein kinase StkP OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=stkP PE=1 SV=1 831 971 2.0E-10
sp|Q04J43|STKP_STRP2 Serine/threonine-protein kinase StkP OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=stkP PE=1 SV=1 831 971 2.0E-10
sp|Q8BG48|ST17B_MOUSE Serine/threonine-protein kinase 17B OS=Mus musculus GN=Stk17b PE=1 SV=1 826 1021 2.0E-10
sp|Q43531|CCAMK_LILLO Calcium and calcium/calmodulin-dependent serine/threonine-protein kinase OS=Lilium longiflorum GN=CCAMK PE=1 SV=1 830 1022 2.0E-10
sp|Q9H093|NUAK2_HUMAN NUAK family SNF1-like kinase 2 OS=Homo sapiens GN=NUAK2 PE=1 SV=1 828 979 2.0E-10
sp|P13863|CDK1_CHICK Cyclin-dependent kinase 1 OS=Gallus gallus GN=CDK1 PE=1 SV=1 830 984 2.0E-10
sp|Q66HE5|NUAK2_RAT NUAK family SNF1-like kinase 2 OS=Rattus norvegicus GN=Nuak2 PE=1 SV=1 828 969 2.0E-10
sp|Q5R7G9|NUAK2_PONAB NUAK family SNF1-like kinase 2 OS=Pongo abelii GN=NUAK2 PE=2 SV=1 828 979 2.0E-10
sp|Q4P5N0|STE20_USTMA Serine/threonine-protein kinase SMU1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SMU1 PE=3 SV=1 321 492 3.0E-10
sp|O75385|ULK1_HUMAN Serine/threonine-protein kinase ULK1 OS=Homo sapiens GN=ULK1 PE=1 SV=2 322 492 3.0E-10
sp|Q6CVA2|STE20_KLULA Serine/threonine-protein kinase STE20 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=STE20 PE=3 SV=1 321 492 3.0E-10
sp|Q61083|M3K2_MOUSE Mitogen-activated protein kinase kinase kinase 2 OS=Mus musculus GN=Map3k2 PE=1 SV=2 359 490 3.0E-10
sp|Q6Z829|WEE1_ORYSJ Wee1-like protein kinase OS=Oryza sativa subsp. japonica GN=WEE1 PE=3 SV=1 830 1022 3.0E-10
sp|Q54YF2|AMPKA_DICDI 5'-AMP-activated serine/threonine-protein kinase catalytic subunit alpha OS=Dictyostelium discoideum GN=snfA PE=2 SV=1 812 994 3.0E-10
sp|Q9NB31|CST1_CAEEL Serine/threonine-protein kinase cst-1 OS=Caenorhabditis elegans GN=cst-1 PE=1 SV=1 830 967 3.0E-10
sp|O81472|MP3K2_ARATH Mitogen-activated protein kinase kinase kinase 9 OS=Arabidopsis thaliana GN=MEKK2 PE=1 SV=1 814 1021 3.0E-10
sp|O15021|MAST4_HUMAN Microtubule-associated serine/threonine-protein kinase 4 OS=Homo sapiens GN=MAST4 PE=1 SV=3 830 964 3.0E-10
sp|Q869W6|MYLKG_DICDI Probable myosin light chain kinase DDB_G0275057 OS=Dictyostelium discoideum GN=DDB_G0275057 PE=3 SV=1 860 990 3.0E-10
sp|Q40531|NTF6_TOBAC Mitogen-activated protein kinase homolog NTF6 OS=Nicotiana tabacum GN=NTF6 PE=2 SV=1 860 964 3.0E-10
sp|Q9XBQ0|PKN3_MYXXA Serine/threonine-protein kinase pkn3 OS=Myxococcus xanthus GN=pkn3 PE=3 SV=1 829 965 3.0E-10
sp|Q9N3Z3|CHK1_CAEEL Serine/threonine-protein kinase chk-1 OS=Caenorhabditis elegans GN=chk-1 PE=2 SV=2 812 964 3.0E-10
sp|B6CZ18|GRK7B_XENLA G protein-coupled receptor kinase 7B OS=Xenopus laevis GN=grk7-b PE=1 SV=1 849 967 3.0E-10
sp|Q75DK7|STE20_ASHGO Serine/threonine-protein kinase STE20 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=STE20 PE=3 SV=2 827 964 3.0E-10
sp|F1QGZ6|MELK_DANRE Maternal embryonic leucine zipper kinase OS=Danio rerio GN=melk PE=2 SV=1 828 964 3.0E-10
sp|Q54WJ0|STK11_DICDI Serine/threonine-protein kinase stk11 homolog OS=Dictyostelium discoideum GN=lkb1 PE=3 SV=1 827 989 3.0E-10
sp|P34244|HSL1_YEAST Probable serine/threonine-protein kinase HSL1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HSL1 PE=1 SV=2 826 969 3.0E-10
sp|Q8RXT4|NEK4_ARATH Serine/threonine-protein kinase Nek4 OS=Arabidopsis thaliana GN=NEK4 PE=2 SV=1 830 1021 3.0E-10
sp|Q9Z2G7|GRK7_ICTTR G protein-coupled receptor kinase 7 OS=Ictidomys tridecemlineatus GN=GRK7 PE=1 SV=1 827 964 3.0E-10
sp|D4AE59|STK11_RAT Serine/threonine-protein kinase STK11 OS=Rattus norvegicus GN=Stk11 PE=1 SV=1 818 964 3.0E-10
sp|Q0J4I1|CKB21_ORYSJ Cyclin-dependent kinase B2-1 OS=Oryza sativa subsp. japonica GN=CDKB2-1 PE=1 SV=1 827 965 3.0E-10
sp|Q4PKS0|HOG1_GIBIN Mitogen-activated protein kinase HOG1 (Fragment) OS=Gibberella intermedia GN=HOG1 PE=3 SV=1 860 964 3.0E-10
sp|Q9QYZ5|SMK3_MOUSE Sperm motility kinase 3 OS=Mus musculus GN=Smok3a PE=2 SV=1 827 1034 3.0E-10
sp|Q9XZD6|CDC2H_PLAVI Cell division control protein 2 homolog OS=Plasmodium vivax GN=CRK2 PE=3 SV=1 863 967 3.0E-10
sp|O15530|PDPK1_HUMAN 3-phosphoinositide-dependent protein kinase 1 OS=Homo sapiens GN=PDPK1 PE=1 SV=1 830 994 3.0E-10
sp|Q6IP06|STK3_XENLA Serine/threonine-protein kinase 3 OS=Xenopus laevis GN=stk3 PE=2 SV=1 828 965 3.0E-10
sp|O04533|LRK52_ARATH Putative L-type lectin-domain containing receptor kinase V.2 OS=Arabidopsis thaliana GN=LECRK52 PE=3 SV=1 818 964 3.0E-10
sp|P27638|SPK1_SCHPO Mitogen-activated protein kinase spk1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=spk1 PE=2 SV=1 787 967 3.0E-10
sp|Q66JF3|MKNK1_XENTR MAP kinase-interacting serine/threonine-protein kinase 1 OS=Xenopus tropicalis GN=mknk1 PE=2 SV=1 856 971 3.0E-10
sp|Q9UQ88|CD11A_HUMAN Cyclin-dependent kinase 11A OS=Homo sapiens GN=CDK11A PE=1 SV=4 820 964 3.0E-10
sp|Q6GM53|IKKA_XENLA Inhibitor of nuclear factor kappa-B kinase subunit alpha OS=Xenopus laevis GN=chuk PE=2 SV=1 831 963 3.0E-10
sp|A8XJW8|CST1_CAEBR Serine/threonine-protein kinase cst-1 OS=Caenorhabditis briggsae GN=cst-1 PE=3 SV=2 830 967 3.0E-10
sp|Q6C3D7|STE20_YARLI Serine/threonine-protein kinase STE20 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=STE20 PE=3 SV=1 321 551 4.0E-10
sp|Q5JLS2|CIPKC_ORYSJ CBL-interacting protein kinase 12 OS=Oryza sativa subsp. japonica GN=CIPK12 PE=1 SV=1 827 1028 4.0E-10
sp|Q9SCS2|CAMK5_ARATH CDPK-related kinase 5 OS=Arabidopsis thaliana GN=CRK5 PE=2 SV=1 821 986 4.0E-10
sp|Q92207|HOG1_CANAL Mitogen-activated protein kinase HOG1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=HOG1 PE=1 SV=2 863 964 4.0E-10
sp|Q6EU49|WNK4_ORYSJ Probable serine/threonine-protein kinase WNK4 OS=Oryza sativa subsp. japonica GN=WNK4 PE=2 SV=1 814 964 4.0E-10
sp|Q9LP51|CIPKI_ARATH CBL-interacting serine/threonine-protein kinase 18 OS=Arabidopsis thaliana GN=CIPK18 PE=1 SV=1 827 992 4.0E-10
sp|Q07785|CDC2H_PLAFK Cell division control protein 2 homolog OS=Plasmodium falciparum (isolate K1 / Thailand) GN=CRK2 PE=1 SV=1 863 967 4.0E-10
sp|P61075|CDC2H_PLAF7 Cell division control protein 2 homolog OS=Plasmodium falciparum (isolate 3D7) GN=CRK2 PE=3 SV=1 863 967 4.0E-10
sp|Q4PNJ1|HOG1_FUSCU Mitogen-activated protein kinase HOG1 (Fragment) OS=Fusarium culmorum GN=HOG1 PE=3 SV=1 863 964 4.0E-10
sp|Q5REX1|SIK2_PONAB Serine/threonine-protein kinase SIK2 OS=Pongo abelii GN=SIK2 PE=2 SV=1 827 967 4.0E-10
sp|Q9LQQ9|MPK13_ARATH Mitogen-activated protein kinase 13 OS=Arabidopsis thaliana GN=MPK13 PE=1 SV=1 860 964 4.0E-10
sp|Q92241|PHO85_KLULA Negative regulator of the PHO system OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=PHO85 PE=3 SV=2 863 964 4.0E-10
sp|Q20085|PMY11_CAEEL Membrane-associated tyrosine- and threonine-specific cdc2-inhibitory kinase wee-1.1 OS=Caenorhabditis elegans GN=wee-1.1 PE=2 SV=2 819 1023 4.0E-10
sp|P21127|CD11B_HUMAN Cyclin-dependent kinase 11B OS=Homo sapiens GN=CDK11B PE=1 SV=3 820 981 4.0E-10
sp|P48609|CDK5_DROME Cyclin-dependent kinase 5 homolog OS=Drosophila melanogaster GN=Cdk5 PE=1 SV=2 821 967 4.0E-10
sp|Q0D4B2|CIPKL_ORYSJ CBL-interacting protein kinase 21 OS=Oryza sativa subsp. japonica GN=CIPK21 PE=2 SV=2 814 1014 4.0E-10
sp|Q9DGD9|MK08_DANRE Mitogen-activated protein kinase 8 OS=Danio rerio GN=mapk8 PE=2 SV=1 825 970 4.0E-10
sp|O60285|NUAK1_HUMAN NUAK family SNF1-like kinase 1 OS=Homo sapiens GN=NUAK1 PE=1 SV=1 826 969 4.0E-10
sp|Q1RLU9|CDK15_DANRE Cyclin-dependent kinase 15 OS=Danio rerio GN=cdk15 PE=2 SV=1 814 1030 4.0E-10
sp|Q9HGN1|GCN2_SCHPO Serine/threonine-protein kinase gcn2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gcn2 PE=2 SV=2 818 1023 5.0E-10
sp|Q61084|M3K3_MOUSE Mitogen-activated protein kinase kinase kinase 3 OS=Mus musculus GN=Map3k3 PE=1 SV=1 370 529 5.0E-10
sp|Q10056|SHK2_SCHPO Serine/threonine-protein kinase shk2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=shk2 PE=3 SV=1 292 547 5.0E-10
sp|A4K2W5|STK4_AOTNA Serine/threonine-protein kinase 4 OS=Aotus nancymaae GN=STK4 PE=3 SV=1 828 967 5.0E-10
sp|A4K2T0|STK4_MACMU Serine/threonine-protein kinase 4 OS=Macaca mulatta GN=STK4 PE=3 SV=1 828 967 5.0E-10
sp|Q13043|STK4_HUMAN Serine/threonine-protein kinase 4 OS=Homo sapiens GN=STK4 PE=1 SV=2 828 967 5.0E-10
sp|Q90327|MK08A_CYPCA Mitogen-activated protein kinase 8A OS=Cyprinus carpio GN=mapk8a PE=2 SV=1 825 964 5.0E-10
sp|P54737|PKN5_MYXXA Serine/threonine-protein kinase pkn5 OS=Myxococcus xanthus GN=pkn5 PE=2 SV=1 863 965 5.0E-10
sp|A4K2S1|STK4_LEMCA Serine/threonine-protein kinase 4 OS=Lemur catta GN=STK4 PE=3 SV=1 828 967 5.0E-10
sp|Q19469|SAD1_CAEEL Serine/threonine kinase SAD-1 OS=Caenorhabditis elegans GN=sad-1 PE=1 SV=2 821 964 5.0E-10
sp|A4K2Y1|STK4_CHLAE Serine/threonine-protein kinase 4 OS=Chlorocebus aethiops GN=STK4 PE=3 SV=1 828 967 5.0E-10
sp|Q20845|PLK3_CAEEL Serine/threonine-protein kinase plk-3 OS=Caenorhabditis elegans GN=plk-3 PE=2 SV=1 819 1021 5.0E-10
sp|Q8S8Y8|WNK6_ARATH Probable serine/threonine-protein kinase WNK6 OS=Arabidopsis thaliana GN=WNK6 PE=2 SV=1 814 964 5.0E-10
sp|Q15831|STK11_HUMAN Serine/threonine-protein kinase STK11 OS=Homo sapiens GN=STK11 PE=1 SV=1 821 964 5.0E-10
sp|Q95KV1|IKKA_BOVIN Inhibitor of nuclear factor kappa-B kinase subunit alpha OS=Bos taurus GN=CHUK PE=1 SV=1 832 963 5.0E-10
sp|Q626B1|PMY13_CAEBR Membrane-associated tyrosine- and threonine-specific cdc2-inhibitory kinase wee-1.3 OS=Caenorhabditis briggsae GN=wee-1.3 PE=3 SV=1 830 1022 5.0E-10
sp|Q641K5|NUAK1_MOUSE NUAK family SNF1-like kinase 1 OS=Mus musculus GN=Nuak1 PE=1 SV=1 826 969 5.0E-10
sp|Q6XKY3|HOG1_HYPAT Mitogen-activated protein kinase hog1 OS=Hypocrea atroviridis GN=hog1 PE=3 SV=1 863 964 5.0E-10
sp|Q5E9L6|STK4_BOVIN Serine/threonine-protein kinase 4 OS=Bos taurus GN=STK4 PE=2 SV=1 828 967 5.0E-10
sp|Q9LMM5|MPK11_ARATH Mitogen-activated protein kinase 11 OS=Arabidopsis thaliana GN=MPK11 PE=1 SV=1 863 964 5.0E-10
sp|Q6VZ17|HUNKB_XENLA Hormonally up-regulated neu tumor-associated kinase homolog B (Fragment) OS=Xenopus laevis GN=hunk-b PE=2 SV=1 827 964 5.0E-10
sp|Q6ZN16|M3K15_HUMAN Mitogen-activated protein kinase kinase kinase 15 OS=Homo sapiens GN=MAP3K15 PE=1 SV=2 862 1026 5.0E-10
sp|Q75L42|CIPKH_ORYSJ CBL-interacting protein kinase 17 OS=Oryza sativa subsp. japonica GN=CIPK17 PE=2 SV=1 814 964 5.0E-10
sp|A4K2Q5|STK4_OTOGA Serine/threonine-protein kinase 4 OS=Otolemur garnettii GN=STK4 PE=3 SV=1 828 967 5.0E-10
sp|P84390|US03_EHV1V Serine/threonine-protein kinase US3 homolog OS=Equine herpesvirus 1 (strain V592) GN=69 PE=3 SV=1 862 1015 5.0E-10
sp|P28926|US03_EHV1B Serine/threonine-protein kinase US3 homolog OS=Equine herpesvirus 1 (strain Ab4p) GN=69 PE=3 SV=1 862 1015 5.0E-10
sp|A4K2M3|STK4_PAPAN Serine/threonine-protein kinase 4 OS=Papio anubis GN=STK4 PE=3 SV=1 828 967 5.0E-10
sp|Q7Z8E9|STE20_MAGO7 Serine/threonine-protein kinase MST20 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=MST20 PE=3 SV=3 321 492 7.0E-10
sp|Q9QY01|ULK2_MOUSE Serine/threonine-protein kinase ULK2 OS=Mus musculus GN=Ulk2 PE=1 SV=1 818 963 7.0E-10
sp|Q03497|STE20_YEAST Serine/threonine-protein kinase STE20 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=STE20 PE=1 SV=1 827 964 8.0E-10
sp|Q54RP7|Y0652_DICDI Probable serine/threonine-protein kinase DDB_G0283065 OS=Dictyostelium discoideum GN=DDB_G0283065 PE=3 SV=1 579 659 1.0E-09
sp|Q9XF67|PDPK1_ARATH 3-phosphoinositide-dependent protein kinase 1 OS=Arabidopsis thaliana GN=PDPK1 PE=1 SV=1 367 543 1.0E-09
sp|P50527|STE20_SCHPO Serine/threonine-protein kinase shk1/pak1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=shk1 PE=1 SV=2 332 548 1.0E-09
sp|Q75DK7|STE20_ASHGO Serine/threonine-protein kinase STE20 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=STE20 PE=3 SV=2 321 542 1.0E-09
sp|Q6BNF3|STE20_DEBHA Serine/threonine-protein kinase STE20 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=STE20 PE=3 SV=2 830 967 2.0E-09
sp|Q3ULB5|PAK6_MOUSE Serine/threonine-protein kinase PAK 6 OS=Mus musculus GN=Pak6 PE=2 SV=1 818 964 2.0E-09
sp|Q54RJ4|IKSA_DICDI Probable serine/threonine-protein kinase iksA OS=Dictyostelium discoideum GN=iksA PE=3 SV=1 303 492 3.0E-09
sp|Q9Y2U5|M3K2_HUMAN Mitogen-activated protein kinase kinase kinase 2 OS=Homo sapiens GN=MAP3K2 PE=1 SV=2 359 490 3.0E-09
sp|Q6FN53|STE20_CANGA Serine/threonine-protein kinase STE20 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=STE20 PE=3 SV=1 321 543 3.0E-09
sp|Q7TSC3|NEK5_MOUSE Serine/threonine-protein kinase Nek5 OS=Mus musculus GN=Nek5 PE=2 SV=1 385 544 4.0E-09
sp|Q01389|BCK1_YEAST Serine/threonine-protein kinase BCK1/SLK1/SSP31 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BCK1 PE=1 SV=1 826 1021 4.0E-09
sp|Q6P3R8|NEK5_HUMAN Serine/threonine-protein kinase Nek5 OS=Homo sapiens GN=NEK5 PE=2 SV=1 287 680 5.0E-09
sp|Q8IYT8|ULK2_HUMAN Serine/threonine-protein kinase ULK2 OS=Homo sapiens GN=ULK2 PE=1 SV=3 818 964 5.0E-09
sp|Q4V3C8|PDPK2_ARATH 3-phosphoinositide-dependent protein kinase 2 OS=Arabidopsis thaliana GN=PDPK2 PE=1 SV=1 367 533 6.0E-09
sp|O08648|M3K4_MOUSE Mitogen-activated protein kinase kinase kinase 4 OS=Mus musculus GN=Map3k4 PE=1 SV=2 323 492 9.0E-09
sp|E9Q3S4|M3K19_MOUSE Mitogen-activated protein kinase kinase kinase 19 OS=Mus musculus GN=Map3k19 PE=3 SV=1 328 492 2.0E-08
sp|A2BD05|NEK6_PIG Serine/threonine-protein kinase Nek6 OS=Sus scrofa GN=NEK6 PE=3 SV=1 271 489 2.0E-08
sp|Q924X7|STK33_MOUSE Serine/threonine-protein kinase 33 OS=Mus musculus GN=Stk33 PE=1 SV=2 314 492 2.0E-08
sp|P38692|KIC1_YEAST Serine/threonine-protein kinase KIC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KIC1 PE=1 SV=1 271 542 2.0E-08
sp|Q7TYY6|PKNL_MYCBO Serine/threonine-protein kinase PknL OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=pknL PE=3 SV=1 293 492 2.0E-08
sp|P9WI63|PKNL_MYCTU Serine/threonine-protein kinase PknL OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pknL PE=1 SV=1 293 492 2.0E-08
sp|P9WI62|PKNL_MYCTO Serine/threonine-protein kinase PknL OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=pknL PE=3 SV=1 293 492 2.0E-08
sp|Q0VD22|STK33_BOVIN Serine/threonine-protein kinase 33 OS=Bos taurus GN=STK33 PE=2 SV=1 314 492 3.0E-08
sp|Q9ES70|NEK6_MOUSE Serine/threonine-protein kinase Nek6 OS=Mus musculus GN=Nek6 PE=1 SV=1 271 489 3.0E-08
sp|P59895|NEK6_RAT Serine/threonine-protein kinase Nek6 OS=Rattus norvegicus GN=Nek6 PE=1 SV=1 271 489 3.0E-08
sp|Q9HC98|NEK6_HUMAN Serine/threonine-protein kinase Nek6 OS=Homo sapiens GN=NEK6 PE=1 SV=2 271 489 3.0E-08
sp|Q9Y6R4|M3K4_HUMAN Mitogen-activated protein kinase kinase kinase 4 OS=Homo sapiens GN=MAP3K4 PE=1 SV=2 272 492 4.0E-08
sp|D0Z5N4|E2AKB_CAEEL Eukaryotic translation initiation factor 2-alpha kinase gcn-2 OS=Caenorhabditis elegans GN=gcn-2 PE=1 SV=2 574 650 5.0E-08
sp|O22040|ANP1_ARATH Mitogen-activated protein kinase kinase kinase ANP1 OS=Arabidopsis thaliana GN=ANP1 PE=1 SV=2 819 1022 6.0E-08
sp|P0CY24|STE20_CANAL Serine/threonine-protein kinase CST20 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CST20 PE=3 SV=1 321 492 6.0E-08
sp|P0CY23|STE20_CANAX Serine/threonine-protein kinase CST20 OS=Candida albicans GN=CST20 PE=3 SV=1 321 492 6.0E-08
sp|C4YRB7|STE20_CANAW Serine/threonine-protein kinase CST20 OS=Candida albicans (strain WO-1) GN=CST20 PE=3 SV=2 321 492 6.0E-08
sp|Q63184|E2AK2_RAT Interferon-induced, double-stranded RNA-activated protein kinase OS=Rattus norvegicus GN=Eif2ak2 PE=1 SV=1 579 662 1.0E-07
sp|Q9FZ36|M3K2_ARATH Mitogen-activated protein kinase kinase kinase 2 OS=Arabidopsis thaliana GN=ANP2 PE=2 SV=1 819 1071 1.0E-07
sp|Q97IC2|PKN2_CLOAB Probable serine/threonine-protein kinase CA_C1728 OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=CA_C1728 PE=3 SV=1 371 492 1.0E-07
sp|P70218|M4K1_MOUSE Mitogen-activated protein kinase kinase kinase kinase 1 OS=Mus musculus GN=Map4k1 PE=1 SV=1 337 489 1.0E-07
sp|Q6P431|MKNK2_XENLA MAP kinase-interacting serine/threonine-protein kinase 2 OS=Xenopus laevis GN=mknk2 PE=2 SV=1 391 492 1.0E-07
sp|Q66I46|MKNK2_XENTR MAP kinase-interacting serine/threonine-protein kinase 2 OS=Xenopus tropicalis GN=mknk2 PE=2 SV=1 391 492 1.0E-07
sp|Q54LH8|Y6627_DICDI Probable serine/threonine-protein kinase DDB_G0286627 OS=Dictyostelium discoideum GN=DDB_G0286627 PE=3 SV=1 314 542 2.0E-07
sp|Q92918|M4K1_HUMAN Mitogen-activated protein kinase kinase kinase kinase 1 OS=Homo sapiens GN=MAP4K1 PE=1 SV=1 337 489 2.0E-07
sp|Q96PY6|NEK1_HUMAN Serine/threonine-protein kinase Nek1 OS=Homo sapiens GN=NEK1 PE=1 SV=2 385 543 3.0E-07
sp|P19525|E2AK2_HUMAN Interferon-induced, double-stranded RNA-activated protein kinase OS=Homo sapiens GN=EIF2AK2 PE=1 SV=2 579 648 4.0E-07
sp|Q55F45|Y8642_DICDI Probable serine/threonine-protein kinase DDB_G0268642 OS=Dictyostelium discoideum GN=DDB_G0268642 PE=3 SV=1 577 650 4.0E-07
sp|Q9BYT3|STK33_HUMAN Serine/threonine-protein kinase 33 OS=Homo sapiens GN=STK33 PE=1 SV=1 314 492 4.0E-07
sp|Q6C3J2|IPL1_YARLI Spindle assembly checkpoint kinase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=IPL1 PE=3 SV=1 360 509 4.0E-07
sp|P28829|BYR2_SCHPO Protein kinase byr2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=byr2 PE=1 SV=1 830 990 5.0E-07
sp|A2AQW0|M3K15_MOUSE Mitogen-activated protein kinase kinase kinase 15 OS=Mus musculus GN=Map3k15 PE=1 SV=1 305 542 6.0E-07
sp|Q8TDX7|NEK7_HUMAN Serine/threonine-protein kinase Nek7 OS=Homo sapiens GN=NEK7 PE=1 SV=1 246 530 9.0E-07
sp|Q19192|E2AKA_CAEEL Eukaryotic translation initiation factor 2-alpha kinase pek-1 OS=Caenorhabditis elegans GN=pek-1 PE=1 SV=2 578 651 1.0E-06
sp|Q39008|M3K1_ARATH Mitogen-activated protein kinase kinase kinase 1 OS=Arabidopsis thaliana GN=MEKK1 PE=1 SV=2 271 547 1.0E-06
sp|Q56UN5|M3K19_HUMAN Mitogen-activated protein kinase kinase kinase 19 OS=Homo sapiens GN=MAP3K19 PE=2 SV=1 328 492 1.0E-06
sp|O01775|NEKL2_CAEEL Serine/threonine-protein kinase nekl-2 OS=Caenorhabditis elegans GN=nekl-2 PE=2 SV=1 328 490 1.0E-06
sp|A0AUV4|SMKY_MOUSE Sperm motility kinase Y OS=Mus musculus GN=Gm7168 PE=2 SV=1 272 503 1.0E-06
sp|P08458|SPS1_YEAST Sporulation-specific protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SPS1 PE=1 SV=2 370 542 1.0E-06
sp|D4AE59|STK11_RAT Serine/threonine-protein kinase STK11 OS=Rattus norvegicus GN=Stk11 PE=1 SV=1 322 493 1.0E-06
sp|Q6ZN16|M3K15_HUMAN Mitogen-activated protein kinase kinase kinase 15 OS=Homo sapiens GN=MAP3K15 PE=1 SV=2 305 565 1.0E-06
sp|F4I1N8|ATG1T_ARATH Serine/threonine-protein kinase ATG1t OS=Arabidopsis thaliana GN=At1g49180 PE=2 SV=1 367 492 2.0E-06
sp|G5EFM9|NEKL3_CAEEL Serine/threonine-protein kinase nekl-3 OS=Caenorhabditis elegans GN=nekl-3 PE=1 SV=1 252 530 2.0E-06
sp|Q9ES74|NEK7_MOUSE Serine/threonine-protein kinase Nek7 OS=Mus musculus GN=Nek7 PE=1 SV=1 246 530 2.0E-06
sp|D3ZBE5|NEK7_RAT Serine/threonine-protein kinase Nek7 OS=Rattus norvegicus GN=Nek7 PE=2 SV=1 246 530 2.0E-06
sp|B7ZR30|STK10_XENLA Serine/threonine-protein kinase 10-A OS=Xenopus laevis GN=stk10-a PE=1 SV=1 375 489 2.0E-06
sp|Q03963|E2AK2_MOUSE Interferon-induced, double-stranded RNA-activated protein kinase OS=Mus musculus GN=Eif2ak2 PE=1 SV=2 578 648 3.0E-06
sp|P27636|CDC15_YEAST Cell division control protein 15 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC15 PE=1 SV=3 271 536 3.0E-06
sp|Q9FX43|M2K9_ARATH Mitogen-activated protein kinase kinase 9 OS=Arabidopsis thaliana GN=MKK9 PE=1 SV=1 357 545 3.0E-06
sp|Q96PF2|TSSK2_HUMAN Testis-specific serine/threonine-protein kinase 2 OS=Homo sapiens GN=TSSK2 PE=1 SV=2 349 556 4.0E-06
sp|Q9WTK7|STK11_MOUSE Serine/threonine-protein kinase STK11 OS=Mus musculus GN=Stk11 PE=1 SV=1 322 493 5.0E-06
sp|P32562|CDC5_YEAST Cell cycle serine/threonine-protein kinase CDC5/MSD2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC5 PE=1 SV=1 307 492 7.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:0004672 protein kinase activity Yes
GO:0005515 protein binding Yes
GO:0006468 protein phosphorylation Yes
GO:0000166 nucleotide binding No
GO:0097367 carbohydrate derivative binding No
GO:0006807 nitrogen compound metabolic process No
GO:0036211 protein modification process No
GO:0006796 phosphate-containing compound metabolic process No
GO:0032553 ribonucleotide binding No
GO:0016301 kinase activity No
GO:0140096 catalytic activity, acting on a protein No
GO:0043167 ion binding No
GO:0016310 phosphorylation No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0006793 phosphorus metabolic process No
GO:0003674 molecular_function No
GO:0005488 binding No
GO:0008150 biological_process No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0043170 macromolecule metabolic process No
GO:0016773 phosphotransferase activity, alcohol group as acceptor No
GO:0008152 metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0016740 transferase activity No
GO:0030554 adenyl nucleotide binding No
GO:0019538 protein metabolic process No
GO:0044238 primary metabolic process No
GO:0009987 cellular process No
GO:0043412 macromolecule modification No
GO:0036094 small molecule binding No
GO:0032559 adenyl ribonucleotide binding No
GO:0003824 catalytic activity No
GO:0044237 cellular metabolic process No
GO:0071704 organic substance metabolic process No
GO:1901363 heterocyclic compound binding No
GO:0032555 purine ribonucleotide binding No
GO:1901265 nucleoside phosphate binding No
GO:0097159 organic cyclic compound binding No
GO:0043168 anion binding No
GO:0017076 purine nucleotide binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|6009
MAWQANTPNPNHDSSFPGLKPTTAAATTTKTEYHEIQENELLALQAIYGNDFVKHNNAPSAWKKADPSFDIHITA
SSDCEFAVTLSFVMTATYPKTPPLITIKATHGLREALQLRVTHFIQTQPKLYARDEQEMIDKIVEGVRELIEDAA
QSKLSGNQALSLEEERERHEADLARLAMEQKQQEELKRQQEAKEQDRVTSEMLKQQIDHQRQRVKESRLNRQPHS
MALVKPTDNAESDFEKIQFDQLCITKDKDENTFAFHSVSGKSDPRRGQVSIVYTVRPMLFSGQGSQTLALKEATL
RCKGIEIKEFKTRIQLLESRLQDLKTTKKIKHRHLVEILDFKLESNQPTTSSFATEVWTLRVLTPLADKGSLEEL
LELAGHIEIDKVRSWTRDLLEALSSLHNRGITHRDIHPRNILLFRESTGEIIPKMSDAYYQREIHNAMNRSQDLS
GVTLAKSAYWLPPEVAGTANPQYSHKSDIWDFGVVFVQMIFGLDVVEKYSSPKALVRSLTLSKPLRELVDRFFRE
EKQKRHRAFELGSSEFLATDAPVFAPSATLQASQLAVPARLRRESITHGAAISRYTEDFVEEGLLGKGGFGQVVK
ARKKLDGQIYAIKKITQRSQASLSAILKEVRLLSRISHPAVVRYYNTWVERESLDRPGEKTSLSNAPNEELDMDF
HIQFTPLDAEHNNDLDFIKNRSSIAYAESDTAIEYDDEDDDEDDDEDDDDDDDVEDEDEECSGDEDEDEEVDGEY
SGIGESEKSEQDSHKAPQEDEDDMQGAGNRQRRRHGHWRAESTGSAQDEADETSSDKGPSGQQLTARQHEDVMRN
HKTTLYISMEYCEKRTLRDLINNNVARDMSEVWRLFRQIVEGLAHIHGLSIVHRDLKPENIFMSSSTDNVNNAKI
GDFGLATGGLFSIDKVAANGLEVDSMTSSVGTASYQAPEVSSSVTETYSTKVDMYSLGLVFFEMCHAPMMGMEKA
IVFKGLRSLEPVLPEGFKPGREVQSEIMLSLINHNAKERPSSTDLLKSGKLPVPLESETIRRTLAGLADPDSPYH
SKMLNTLFARLPAATTDYVWDAGPVMPSVAELLQESTVKEVLSSIFRRHGALEASRSFIYPISDMYGPQVFKVLD
ANGTVLQLPFDLTLGNARMLAKKKPSVSRTFTFGSVFRDGPDGGQPDVISEVDFDIISDDALDLALREAEVLKVL
DEIVVAFPSLHGQMCFQIGHSDLLQLILEYCGVQPENRRSVASALTHLNDHNRPWQKVKAELRSPSTGVSATSIN
ELQRFDFRDVPNKAFARLKTLFEGSDMYQRASPVLAHLKEVMEYLKRFKLSSKVYINPLNSVKEHVFVGGILFCC
MHDKKAMDVFAAGGRYDQLIRDQRPRIAGLPKEQHAVGFQLAWERLTKQPKPSGKHAAKKADEEKGSIFAARRCD
ALVASFDAKLLRSTGVEILELLWTHDMSAELAKDAKSPEELLARHRNDTYSWIIIIKQESMLKIKTMGRSDVTDV
DIPTGQLLTWLRPQVRERESRRTRGGSSQAETASSGMGDKDHEQEVKVLVAQTKSKKFNRQTVVEQAQMAAASVA
RTFLEGPILAVETTDNVMELMRGARISEPESWRRVEHQVTTLERNYVRDVHRQLEQWRWAHVKDGGPRHSFIYNF
RTGMCLYYDVGL*
Coding >OphauB2|6009
ATGGCTTGGCAAGCAAACACGCCCAATCCTAATCATGACTCAAGCTTTCCTGGCCTCAAGCCCACCACGGCAGCC
GCCACAACAACCAAGACTGAGTATCATGAAATCCAGGAAAACGAGTTACTAGCTCTCCAAGCCATCTATGGCAAT
GACTTTGTAAAACACAACAATGCTCCCAGCGCTTGGAAGAAGGCTGATCCGTCATTCGACATTCACATCACTGCC
TCGTCAGACTGTGAATTTGCTGTTACTCTTTCATTTGTCATGACCGCAACATATCCCAAAACACCGCCTCTCATC
ACAATCAAAGCCACGCATGGTTTGCGAGAAGCTCTACAGCTCAGAGTGACTCACTTTATTCAGACTCAACCAAAG
CTCTACGCAAGAGACGAGCAAGAAATGATAGACAAGATTGTTGAGGGCGTAAGAGAACTCATTGAAGACGCAGCC
CAGTCAAAATTGTCTGGCAACCAGGCCCTTTCCCTCGAAGAGGAGCGAGAACGCCATGAGGCCGATCTTGCCAGA
TTAGCTATGGAACAAAAGCAACAGGAAGAACTCAAAAGGCAACAGGAAGCCAAAGAGCAAGATAGGGTCACGTCA
GAGATGCTCAAGCAACAGATTGATCATCAGCGGCAAAGGGTCAAGGAATCCCGCCTCAACCGACAGCCTCATTCC
ATGGCCCTCGTCAAGCCCACTGATAATGCCGAATCTGATTTCGAAAAAATCCAGTTCGATCAGTTGTGCATCACA
AAAGACAAGGATGAAAATACCTTTGCCTTTCATTCAGTTTCTGGCAAAAGCGACCCTCGCAGAGGCCAGGTTTCC
ATCGTCTACACTGTTCGGCCCATGCTGTTCAGTGGCCAGGGAAGCCAGACCTTGGCTCTCAAGGAAGCAACGCTG
CGTTGCAAAGGTATTGAAATCAAAGAATTCAAAACGCGGATCCAGTTGCTGGAATCCCGACTCCAAGATCTGAAA
ACAACCAAAAAGATCAAACATCGCCATCTCGTTGAGATACTCGATTTCAAACTCGAAAGCAATCAGCCTACAACG
TCGTCGTTTGCAACCGAGGTGTGGACTCTTAGGGTTTTGACCCCGTTGGCTGACAAGGGCTCTCTGGAGGAGTTG
CTAGAACTGGCAGGCCATATCGAGATTGACAAGGTGAGGTCCTGGACAAGAGACCTCCTTGAAGCCCTCAGCTCT
CTCCACAATCGCGGCATCACTCACCGTGATATTCACCCCCGGAATATTCTTTTGTTTCGCGAATCTACTGGGGAA
ATAATACCCAAAATGTCAGACGCTTACTACCAGAGAGAGATTCATAATGCCATGAATCGCAGCCAAGATCTGTCG
GGTGTTACTTTGGCCAAGTCTGCATACTGGCTACCACCCGAGGTGGCTGGAACGGCAAACCCGCAGTATTCACAC
AAATCTGACATTTGGGATTTCGGCGTCGTCTTTGTACAAATGATATTTGGCCTGGATGTAGTGGAAAAGTACTCG
TCTCCCAAGGCTCTTGTACGCTCCCTCACCCTATCAAAGCCTCTCAGAGAACTCGTGGACCGCTTCTTCCGCGAA
GAAAAGCAGAAAAGACACCGTGCTTTTGAACTAGGTTCGAGCGAGTTTCTCGCTACAGACGCTCCGGTTTTTGCT
CCATCAGCCACTCTTCAAGCGTCTCAGTTGGCTGTTCCAGCCAGGTTAAGACGCGAGTCTATCACACACGGGGCC
GCCATTTCGCGTTATACCGAAGATTTCGTCGAAGAGGGCCTGCTAGGCAAAGGAGGATTTGGTCAAGTCGTCAAG
GCACGAAAGAAGCTAGACGGGCAGATTTATGCCATCAAAAAGATTACGCAGCGCTCACAGGCCAGTCTTAGTGCT
ATTTTGAAAGAGGTGCGGCTTTTGTCTAGAATCAGTCATCCTGCCGTCGTACGCTATTACAACACTTGGGTGGAG
AGGGAATCCCTGGACCGGCCAGGCGAGAAAACGAGCCTGAGCAATGCTCCTAACGAGGAGTTGGATATGGATTTT
CATATCCAGTTTACGCCGCTGGATGCTGAACATAACAACGATCTTGATTTTATAAAGAATCGCAGCAGTATCGCA
TATGCCGAAAGCGATACTGCAATTGAATACGACGATGAAGACGACGATGAAGACGACGATGAAGACGACGATGAC
GACGACGACGTAGAAGATGAAGATGAAGAATGTAGTGGAGACGAGGACGAAGACGAAGAAGTTGACGGCGAGTAT
TCCGGCATTGGAGAAAGCGAGAAGAGTGAGCAAGACTCTCACAAGGCGCCACAAGAGGACGAGGATGACATGCAA
GGCGCTGGTAACCGGCAAAGAAGGCGCCATGGTCACTGGCGTGCCGAGAGCACTGGCAGCGCCCAAGACGAGGCT
GACGAGACTAGTAGCGACAAGGGACCATCAGGGCAACAGCTGACGGCCCGTCAGCATGAGGATGTGATGCGAAAT
CACAAGACGACGCTTTACATCTCAATGGAGTATTGCGAGAAGCGGACGCTGCGCGACCTCATTAACAACAATGTG
GCTCGCGACATGTCCGAAGTGTGGCGCCTGTTTCGTCAGATTGTGGAGGGACTGGCGCACATTCATGGACTTAGC
ATTGTCCATCGTGATCTGAAGCCGGAAAACATCTTCATGAGTAGCAGTACCGATAATGTCAACAATGCCAAAATT
GGAGACTTTGGCTTGGCGACCGGTGGCCTGTTCTCAATCGATAAAGTCGCGGCTAATGGCCTTGAGGTGGACTCC
ATGACGTCGAGCGTAGGAACTGCTAGCTATCAGGCTCCAGAAGTGAGCTCGTCTGTGACGGAGACGTACAGCACC
AAAGTTGATATGTACTCTTTGGGGCTCGTCTTCTTTGAAATGTGTCACGCACCCATGATGGGCATGGAGAAGGCG
ATTGTTTTCAAGGGACTTCGGAGTCTTGAGCCGGTGCTCCCAGAAGGCTTCAAGCCAGGACGCGAGGTGCAGTCG
GAAATCATGCTCTCCTTGATCAACCACAATGCCAAGGAGAGGCCTTCGAGCACTGATTTGCTCAAGAGCGGCAAG
TTACCGGTGCCATTGGAGAGCGAGACTATACGGCGGACGCTGGCAGGCCTCGCAGATCCGGACTCGCCCTATCAC
TCCAAGATGCTCAACACTTTGTTTGCTCGTCTACCTGCCGCGACAACGGACTATGTTTGGGATGCTGGGCCAGTT
ATGCCTAGTGTCGCAGAGCTGCTTCAGGAGAGCACTGTCAAGGAAGTGCTTAGTTCGATATTCCGTCGCCACGGG
GCCTTGGAGGCCTCTCGCAGCTTCATCTATCCCATCTCGGATATGTACGGGCCCCAGGTCTTCAAGGTCCTTGAT
GCCAATGGCACAGTGCTTCAGCTACCCTTTGACCTCACGCTAGGCAACGCGCGCATGCTGGCTAAGAAGAAGCCG
TCAGTCTCACGCACATTTACCTTTGGCAGTGTCTTCAGAGACGGACCAGATGGTGGACAGCCCGACGTCATTAGT
GAGGTCGACTTTGACATCATCTCTGATGACGCTCTGGACCTGGCTCTTAGGGAAGCCGAAGTGCTCAAGGTGCTA
GACGAGATTGTTGTCGCATTTCCCTCGCTACACGGCCAAATGTGCTTTCAGATTGGTCATTCCGACTTGTTGCAG
CTTATACTCGAGTATTGTGGGGTTCAACCAGAGAATCGCAGAAGTGTCGCGAGTGCCTTGACGCACCTCAATGAC
CACAATCGGCCTTGGCAAAAGGTCAAGGCCGAGCTGCGGTCACCATCTACCGGCGTGTCCGCCACCAGCATCAAC
GAGCTGCAGCGCTTTGATTTTCGCGACGTGCCCAACAAAGCGTTTGCCAGACTCAAGACGCTATTTGAGGGGAGC
GATATGTATCAGAGAGCGTCGCCGGTTCTTGCCCATCTGAAAGAAGTCATGGAGTACCTGAAGCGCTTCAAGCTG
TCATCAAAGGTGTATATCAATCCGCTCAACAGTGTCAAGGAACATGTTTTTGTCGGAGGTATTCTATTTTGCTGT
ATGCACGACAAAAAGGCCATGGATGTGTTTGCCGCAGGGGGTCGATACGATCAGCTCATTAGAGACCAGCGGCCT
AGAATCGCTGGGCTTCCCAAAGAGCAGCATGCCGTGGGCTTTCAGCTGGCCTGGGAACGACTGACCAAGCAGCCA
AAGCCGAGTGGTAAGCATGCAGCCAAAAAGGCTGACGAGGAAAAAGGAAGCATCTTTGCAGCTCGAAGATGCGAT
GCGCTTGTTGCTAGCTTTGATGCCAAACTTCTCAGATCTACCGGGGTTGAAATCCTCGAGTTGCTGTGGACGCAC
GACATGAGTGCCGAGCTGGCCAAAGACGCCAAGTCGCCTGAAGAGTTGCTGGCCCGCCATCGCAACGACACGTAC
TCGTGGATCATCATCATCAAGCAGGAGTCGATGCTCAAGATCAAGACGATGGGCAGAAGCGACGTGACCGACGTG
GATATCCCCACAGGACAGTTGCTGACATGGCTGAGGCCTCAGGTGCGCGAGCGCGAGTCTCGCAGGACACGGGGC
GGCTCGTCGCAGGCGGAGACGGCGAGCAGCGGCATGGGCGACAAGGACCACGAGCAAGAGGTCAAGGTCTTGGTG
GCGCAGACAAAGAGCAAAAAGTTCAACCGGCAGACGGTGGTGGAGCAGGCGCAGATGGCAGCCGCCAGCGTGGCG
CGCACTTTCCTCGAGGGGCCGATTCTGGCGGTGGAAACGACGGACAATGTCATGGAGCTGATGCGAGGCGCGCGC
ATCTCGGAGCCGGAGAGCTGGCGAAGGGTCGAGCACCAGGTGACGACGCTGGAGCGCAACTATGTGCGCGACGTG
CACCGCCAGCTGGAGCAATGGCGATGGGCACACGTCAAGGACGGCGGGCCTCGCCACTCCTTCATCTACAACTTC
CGCACGGGCATGTGCCTGTATTACGATGTAGGGCTGTGA
Transcript >OphauB2|6009
ATGGCTTGGCAAGCAAACACGCCCAATCCTAATCATGACTCAAGCTTTCCTGGCCTCAAGCCCACCACGGCAGCC
GCCACAACAACCAAGACTGAGTATCATGAAATCCAGGAAAACGAGTTACTAGCTCTCCAAGCCATCTATGGCAAT
GACTTTGTAAAACACAACAATGCTCCCAGCGCTTGGAAGAAGGCTGATCCGTCATTCGACATTCACATCACTGCC
TCGTCAGACTGTGAATTTGCTGTTACTCTTTCATTTGTCATGACCGCAACATATCCCAAAACACCGCCTCTCATC
ACAATCAAAGCCACGCATGGTTTGCGAGAAGCTCTACAGCTCAGAGTGACTCACTTTATTCAGACTCAACCAAAG
CTCTACGCAAGAGACGAGCAAGAAATGATAGACAAGATTGTTGAGGGCGTAAGAGAACTCATTGAAGACGCAGCC
CAGTCAAAATTGTCTGGCAACCAGGCCCTTTCCCTCGAAGAGGAGCGAGAACGCCATGAGGCCGATCTTGCCAGA
TTAGCTATGGAACAAAAGCAACAGGAAGAACTCAAAAGGCAACAGGAAGCCAAAGAGCAAGATAGGGTCACGTCA
GAGATGCTCAAGCAACAGATTGATCATCAGCGGCAAAGGGTCAAGGAATCCCGCCTCAACCGACAGCCTCATTCC
ATGGCCCTCGTCAAGCCCACTGATAATGCCGAATCTGATTTCGAAAAAATCCAGTTCGATCAGTTGTGCATCACA
AAAGACAAGGATGAAAATACCTTTGCCTTTCATTCAGTTTCTGGCAAAAGCGACCCTCGCAGAGGCCAGGTTTCC
ATCGTCTACACTGTTCGGCCCATGCTGTTCAGTGGCCAGGGAAGCCAGACCTTGGCTCTCAAGGAAGCAACGCTG
CGTTGCAAAGGTATTGAAATCAAAGAATTCAAAACGCGGATCCAGTTGCTGGAATCCCGACTCCAAGATCTGAAA
ACAACCAAAAAGATCAAACATCGCCATCTCGTTGAGATACTCGATTTCAAACTCGAAAGCAATCAGCCTACAACG
TCGTCGTTTGCAACCGAGGTGTGGACTCTTAGGGTTTTGACCCCGTTGGCTGACAAGGGCTCTCTGGAGGAGTTG
CTAGAACTGGCAGGCCATATCGAGATTGACAAGGTGAGGTCCTGGACAAGAGACCTCCTTGAAGCCCTCAGCTCT
CTCCACAATCGCGGCATCACTCACCGTGATATTCACCCCCGGAATATTCTTTTGTTTCGCGAATCTACTGGGGAA
ATAATACCCAAAATGTCAGACGCTTACTACCAGAGAGAGATTCATAATGCCATGAATCGCAGCCAAGATCTGTCG
GGTGTTACTTTGGCCAAGTCTGCATACTGGCTACCACCCGAGGTGGCTGGAACGGCAAACCCGCAGTATTCACAC
AAATCTGACATTTGGGATTTCGGCGTCGTCTTTGTACAAATGATATTTGGCCTGGATGTAGTGGAAAAGTACTCG
TCTCCCAAGGCTCTTGTACGCTCCCTCACCCTATCAAAGCCTCTCAGAGAACTCGTGGACCGCTTCTTCCGCGAA
GAAAAGCAGAAAAGACACCGTGCTTTTGAACTAGGTTCGAGCGAGTTTCTCGCTACAGACGCTCCGGTTTTTGCT
CCATCAGCCACTCTTCAAGCGTCTCAGTTGGCTGTTCCAGCCAGGTTAAGACGCGAGTCTATCACACACGGGGCC
GCCATTTCGCGTTATACCGAAGATTTCGTCGAAGAGGGCCTGCTAGGCAAAGGAGGATTTGGTCAAGTCGTCAAG
GCACGAAAGAAGCTAGACGGGCAGATTTATGCCATCAAAAAGATTACGCAGCGCTCACAGGCCAGTCTTAGTGCT
ATTTTGAAAGAGGTGCGGCTTTTGTCTAGAATCAGTCATCCTGCCGTCGTACGCTATTACAACACTTGGGTGGAG
AGGGAATCCCTGGACCGGCCAGGCGAGAAAACGAGCCTGAGCAATGCTCCTAACGAGGAGTTGGATATGGATTTT
CATATCCAGTTTACGCCGCTGGATGCTGAACATAACAACGATCTTGATTTTATAAAGAATCGCAGCAGTATCGCA
TATGCCGAAAGCGATACTGCAATTGAATACGACGATGAAGACGACGATGAAGACGACGATGAAGACGACGATGAC
GACGACGACGTAGAAGATGAAGATGAAGAATGTAGTGGAGACGAGGACGAAGACGAAGAAGTTGACGGCGAGTAT
TCCGGCATTGGAGAAAGCGAGAAGAGTGAGCAAGACTCTCACAAGGCGCCACAAGAGGACGAGGATGACATGCAA
GGCGCTGGTAACCGGCAAAGAAGGCGCCATGGTCACTGGCGTGCCGAGAGCACTGGCAGCGCCCAAGACGAGGCT
GACGAGACTAGTAGCGACAAGGGACCATCAGGGCAACAGCTGACGGCCCGTCAGCATGAGGATGTGATGCGAAAT
CACAAGACGACGCTTTACATCTCAATGGAGTATTGCGAGAAGCGGACGCTGCGCGACCTCATTAACAACAATGTG
GCTCGCGACATGTCCGAAGTGTGGCGCCTGTTTCGTCAGATTGTGGAGGGACTGGCGCACATTCATGGACTTAGC
ATTGTCCATCGTGATCTGAAGCCGGAAAACATCTTCATGAGTAGCAGTACCGATAATGTCAACAATGCCAAAATT
GGAGACTTTGGCTTGGCGACCGGTGGCCTGTTCTCAATCGATAAAGTCGCGGCTAATGGCCTTGAGGTGGACTCC
ATGACGTCGAGCGTAGGAACTGCTAGCTATCAGGCTCCAGAAGTGAGCTCGTCTGTGACGGAGACGTACAGCACC
AAAGTTGATATGTACTCTTTGGGGCTCGTCTTCTTTGAAATGTGTCACGCACCCATGATGGGCATGGAGAAGGCG
ATTGTTTTCAAGGGACTTCGGAGTCTTGAGCCGGTGCTCCCAGAAGGCTTCAAGCCAGGACGCGAGGTGCAGTCG
GAAATCATGCTCTCCTTGATCAACCACAATGCCAAGGAGAGGCCTTCGAGCACTGATTTGCTCAAGAGCGGCAAG
TTACCGGTGCCATTGGAGAGCGAGACTATACGGCGGACGCTGGCAGGCCTCGCAGATCCGGACTCGCCCTATCAC
TCCAAGATGCTCAACACTTTGTTTGCTCGTCTACCTGCCGCGACAACGGACTATGTTTGGGATGCTGGGCCAGTT
ATGCCTAGTGTCGCAGAGCTGCTTCAGGAGAGCACTGTCAAGGAAGTGCTTAGTTCGATATTCCGTCGCCACGGG
GCCTTGGAGGCCTCTCGCAGCTTCATCTATCCCATCTCGGATATGTACGGGCCCCAGGTCTTCAAGGTCCTTGAT
GCCAATGGCACAGTGCTTCAGCTACCCTTTGACCTCACGCTAGGCAACGCGCGCATGCTGGCTAAGAAGAAGCCG
TCAGTCTCACGCACATTTACCTTTGGCAGTGTCTTCAGAGACGGACCAGATGGTGGACAGCCCGACGTCATTAGT
GAGGTCGACTTTGACATCATCTCTGATGACGCTCTGGACCTGGCTCTTAGGGAAGCCGAAGTGCTCAAGGTGCTA
GACGAGATTGTTGTCGCATTTCCCTCGCTACACGGCCAAATGTGCTTTCAGATTGGTCATTCCGACTTGTTGCAG
CTTATACTCGAGTATTGTGGGGTTCAACCAGAGAATCGCAGAAGTGTCGCGAGTGCCTTGACGCACCTCAATGAC
CACAATCGGCCTTGGCAAAAGGTCAAGGCCGAGCTGCGGTCACCATCTACCGGCGTGTCCGCCACCAGCATCAAC
GAGCTGCAGCGCTTTGATTTTCGCGACGTGCCCAACAAAGCGTTTGCCAGACTCAAGACGCTATTTGAGGGGAGC
GATATGTATCAGAGAGCGTCGCCGGTTCTTGCCCATCTGAAAGAAGTCATGGAGTACCTGAAGCGCTTCAAGCTG
TCATCAAAGGTGTATATCAATCCGCTCAACAGTGTCAAGGAACATGTTTTTGTCGGAGGTATTCTATTTTGCTGT
ATGCACGACAAAAAGGCCATGGATGTGTTTGCCGCAGGGGGTCGATACGATCAGCTCATTAGAGACCAGCGGCCT
AGAATCGCTGGGCTTCCCAAAGAGCAGCATGCCGTGGGCTTTCAGCTGGCCTGGGAACGACTGACCAAGCAGCCA
AAGCCGAGTGGTAAGCATGCAGCCAAAAAGGCTGACGAGGAAAAAGGAAGCATCTTTGCAGCTCGAAGATGCGAT
GCGCTTGTTGCTAGCTTTGATGCCAAACTTCTCAGATCTACCGGGGTTGAAATCCTCGAGTTGCTGTGGACGCAC
GACATGAGTGCCGAGCTGGCCAAAGACGCCAAGTCGCCTGAAGAGTTGCTGGCCCGCCATCGCAACGACACGTAC
TCGTGGATCATCATCATCAAGCAGGAGTCGATGCTCAAGATCAAGACGATGGGCAGAAGCGACGTGACCGACGTG
GATATCCCCACAGGACAGTTGCTGACATGGCTGAGGCCTCAGGTGCGCGAGCGCGAGTCTCGCAGGACACGGGGC
GGCTCGTCGCAGGCGGAGACGGCGAGCAGCGGCATGGGCGACAAGGACCACGAGCAAGAGGTCAAGGTCTTGGTG
GCGCAGACAAAGAGCAAAAAGTTCAACCGGCAGACGGTGGTGGAGCAGGCGCAGATGGCAGCCGCCAGCGTGGCG
CGCACTTTCCTCGAGGGGCCGATTCTGGCGGTGGAAACGACGGACAATGTCATGGAGCTGATGCGAGGCGCGCGC
ATCTCGGAGCCGGAGAGCTGGCGAAGGGTCGAGCACCAGGTGACGACGCTGGAGCGCAACTATGTGCGCGACGTG
CACCGCCAGCTGGAGCAATGGCGATGGGCACACGTCAAGGACGGCGGGCCTCGCCACTCCTTCATCTACAACTTC
CGCACGGGCATGTGCCTGTATTACGATGTAGGGCTGTGA
Gene >OphauB2|6009
ATGGCTTGGCAAGCAAACACGCCCAATCCTAATCATGACTCAAGCTTTCCTGGCCTCAAGCCCACCACGGCAGCC
GCCACAACAACCAAGACTGAGTATCATGAAATCCAGGAAAACGAGTTACTAGCTCTCCAAGCCATCTATGGCAAT
GACTTTGTAAAACACAACAATGCTCCCAGCGCTTGGAAGGTATCATGTCCATCTTCGCCCCACCACAGCAGCCCG
GCTCTAACTCATCTTCCCTGCATTATAGAAGGCTGATCCGTCATTCGACATTCACATCACTGCCTCGTCAGACTG
TGAATTTGCTGTTACTCTTTCATTTGTCATGACCGCAACATATCCCAAAACACCGCCTCTCATCACAATCAAAGC
CACGCATGGTTTGCGAGAAGCTCTACAGCTCAGAGTGACTCACTTTATTCAGACTCAACCAAAGCTCTACGCAAG
AGACGAGCAAGAAATGATAGACAAGATTGTTGAGGGCGTAAGAGAACTCATTGAAGACGCAGCCCAGTCAAAATT
GTCTGGCAACCAGGCCCTTTCCCTCGAAGAGGAGCGAGAACGCCATGAGGCCGATCTTGCCAGATTAGCTATGGA
ACAAAAGCAACAGGAAGAACTCAAAAGGCAACAGGAAGCCAAAGAGCAAGATAGGGTCACGTCAGAGATGCTCAA
GCAACAGATTGATCATCAGCGGCAAAGGGTCAAGGAATCCCGCCTCAACCGACAGCCTCATTCCATGGCCCTCGT
CAAGCCCACTGATAATGCCGAATCTGATTTCGAAAAAATCCAGTTCGATCAGTTGTGCATCACAAAAGACAAGGA
TGAAAATACCTTTGCCTTTCATTCAGTTTCTGGCAAAAGCGACCCTCGCAGAGGCCAGGTTTCCATCGTCTACAC
TGTTCGGCCCATGCTGTTCAGTGGCCAGGGAAGCCAGACCTTGGCTCTCAAGGAAGCAACGCTGCGTTGCAAAGG
TATTGAAATCAAAGAATTCAAAACGCGGATCCAGTTGCTGGAATCCCGACTCCAAGATCTGAAAACAACCAAAAA
GATCAAACATCGCCATCTCGTTGAGATACTCGATTTCAAACTCGAAAGCAATCAGCCTACAACGTCGTCGTTTGC
AACCGAGGTGTGGACTCTTAGGGTTTTGACCCCGTTGGCTGACAAGGGCTCTCTGGAGGAGTTGCTAGAACTGGC
AGGCCATATCGAGATTGACAAGGTGAGGTCCTGGACAAGAGACCTCCTTGAAGCCCTCAGCTCTCTCCACAATCG
CGGCATCACTCACCGTGATATTCACCCCCGGAATATTCTTTTGTTTCGCGAATCTACTGGGGAAATAATACCCAA
AATGTCAGACGCTTACTACCAGAGAGAGATTCATAATGCCATGAATCGCAGCCAAGATCTGTCGGGTGTTACTTT
GGCCAAGTCTGCATACTGGCTACCACCCGAGGTGGCTGGAACGGCAAACCCGCAGTATTCACACAAATCTGACAT
TTGGGATTTCGGCGTCGTCTTTGTACAAATGATATTTGGCCTGGATGTAGTGGAAAAGTACTCGTCTCCCAAGGC
TCTTGTACGCTCCCTCACCCTATCAAAGCCTCTCAGAGAACTCGTGGACCGCTTCTTCCGCGAAGAAAAGCAGAA
AAGACACCGTGCTTTTGAACTAGGTTCGAGCGAGTTTCTCGCTACAGACGCTCCGGTTTTTGCTCCATCAGCCAC
TCTTCAAGCGTCTCAGTTGGCTGTTCCAGCCAGGTTAAGACGCGAGTCTATCACACACGGGGCCGCCATTTCGCG
TTATACCGAAGATTTCGTCGAAGAGGGCCTGCTAGGCAAAGGAGGATTTGGTCAAGTCGTCAAGGCACGAAAGAA
GCTAGACGGGCAGATTTATGCCATCAAAAAGATTACGCAGCGCTCACAGGCCAGTCTTAGTGCTATTTTGAAAGA
GGTGCGGCTTTTGTCTAGAATCAGTCATCCTGCCGTCGTACGCTATTACAACACTTGGGTGGAGAGGGAATCCCT
GGACCGGCCAGGCGAGAAAACGAGCCTGAGCAATGCTCCTAACGAGGAGTTGGATATGGATTTTCATATCCAGTT
TACGCCGCTGGATGCTGAACATAACAACGATCTTGATTTTATAAAGAATCGCAGCAGTATCGCATATGCCGAAAG
CGATACTGCAATTGAATACGACGATGAAGACGACGATGAAGACGACGATGAAGACGACGATGACGACGACGACGT
AGAAGATGAAGATGAAGAATGTAGTGGAGACGAGGACGAAGACGAAGAAGTTGACGGCGAGTATTCCGGCATTGG
AGAAAGCGAGAAGAGTGAGCAAGACTCTCACAAGGCGCCACAAGAGGACGAGGATGACATGCAAGGCGCTGGTAA
CCGGCAAAGAAGGCGCCATGGTCACTGGCGTGCCGAGAGCACTGGCAGCGCCCAAGACGAGGCTGACGAGACTAG
TAGCGACAAGGGACCATCAGGGCAACAGCTGACGGCCCGTCAGCATGAGGATGTGATGCGAAATCACAAGACGAC
GCTTTACATCTCAATGGAGTATTGCGAGAAGCGGGTAAGTGTCTTGATTGTCTTGACGACCTGTCGCTGCTCAAC
AAGAAAGCTCATATCATGGTAGACGCTGCGCGACCTCATTAACAACAATGTGGCTCGCGACATGTCCGAAGTGTG
GCGCCTGTTTCGTCAGATTGTGGAGGGACTGGCGCACATTCATGGACTTAGCATTGTCCATCGTGATCTGAAGCC
GGAAAACATCTTCATGAGTAGCAGTACCGATAATGTCAACAATGCCAAAATTGGAGACTTTGGCTTGGCGACCGG
TGGCCTGTTCTCAATCGATAAAGTCGCGGCTAATGGCCTTGAGGTGGACTCCATGACGTCGAGCGTAGGAACTGC
TAGCTATCAGGCTCCAGAAGTGAGCTCGTCTGTGACGGAGACGTACAGCACCAAAGTTGATGTGAGAGCCACGGT
GCTTATACTACTAATAACTAAGAGGCTGATTACAGGGCCTAGATGTACTCTTTGGGGCTCGTCTTCTTTGAAATG
TGTCACGCACCCATGATGGGCATGGAGAAGGCGATTGTTTTCAAGGGACTTCGGAGTCTTGAGCCGGTGCTCCCA
GAAGGCTTCAAGCCAGGACGCGAGGTGCAGTCGGAAATCATGCTCTCCTTGATCAACCACAATGCCAAGGAGAGG
CCTTCGAGCACTGATTTGCTCAAGAGCGGCAAGTTACCGGTGCCATTGGAGAGCGAGACTATACGGCGGACGCTG
GCAGGCCTCGCAGATCCGGACTCGCCCTATCACTCCAAGATGCTCAACACTTTGTTTGCTCGTCTACCTGCCGCG
ACAACGGACTATGTTTGGGATGCTGGGCCAGTTATGCCTAGTGTCGCAGAGCTGCTTCAGGAGAGCACTGTCAAG
GAAGTGCTTAGTTCGATATTCCGTCGCCACGGGGCCTTGGAGGCCTCTCGCAGCTTCATCTATCCCATCTCGGAT
ATGTACGGGCCCCAGGTCTTCAAGGTCCTTGATGCCAATGGCACAGTGCTTCAGCTACCCTTTGACCTCACGCTA
GGCAACGCGCGCATGCTGGCTAAGAAGAAGCCGTCAGTCTCACGCACATTTACCTTTGGCAGTGTCTTCAGAGAC
GGACCAGATGGTGGACAGCCCGACGTCATTAGTGAGGTCGACTTTGACATCATCTCTGATGACGCTCTGGACCTG
GCTCTTAGGGAAGCCGAAGTGCTCAAGGTGCTAGACGAGATTGTTGTCGCATTTCCCTCGCTACACGGCCAAATG
TGCTTTCAGATTGGTCATTCCGACTTGTTGCAGCTTATACTCGAGTATTGTGGGGTTCAACCAGAGAATCGCAGA
AGTGTCGCGAGTGCCTTGACGCACCTCAATGACCACAATCGGCCTTGGCAAAAGGTCAAGGCCGAGCTGCGGTCA
CCATCTACCGGCGTGTCCGCCACCAGCATCAACGAGCTGCAGCGCTTTGATTTTCGCGGTAAGGGAGTTGCCTGC
GTGCCATGGGCTGCATGCTGACGAGTTGATGTAGACGTGCCCAACAAAGCGTTTGCCAGACTCAAGACGCTATTT
GAGGGGAGCGATATGTATCAGAGAGCGTCGCCGGTTCTTGCCCATCTGAAAGAAGTCATGGAGTACCTGAAGCGC
TTCAAGCTGTCATCAAAGGTGTATATCAATCCGCTCAACAGTGTCAAGGAACATGTTTTTGTCGGAGGTATTCTA
TTTTGCTGTATGCACGACAAAAAGGCCATGGATGTGTTTGCCGCAGGGGGTCGATACGATCAGCTCATTAGAGAC
CAGCGGCCTAGAATCGCTGGGCTTCCCAAAGAGCAGCATGCCGTGGGCTTTCAGCTGGCCTGGGAACGACTGACC
AAGCAGCCAAAGCCGAGTGGTAAGCATGCAGCCAAAAAGGCTGACGAGGAAAAAGGAAGCATCTTTGCAGCTCGA
AGAGTAAGTTGCTATCCAGGGAGAAGTCGGGGGCTCAGGAGACGCAGTGCTGATGACGATTTTTTTTTTCCTTGT
TGTCTACATCAACAGTGCGATGCGCTTGTTGCTAGCTTTGATGCCAAACTTCTCAGATCTACCGGGGTTGAAATC
CTCGAGTTGCTGTGGACGCACGACATGAGTGCCGAGCTGGCCAAAGACGCCAAGTCGCCTGAAGAGTTGCTGGCC
CGCCATCGCAACGACACGTACTCGTGGATCATCATCATCAAGCAGGAGTCGATGCTCAAGATCAAGACGATGGGC
AGAAGCGACGTGACCGACGTGGATATCCCCACAGGACAGTTGCTGACATGGCTGAGGCCTCAGGTGCGCGAGCGC
GAGTCTCGCAGGACACGGGGCGGCTCGTCGCAGGCGGAGACGGCGAGCAGCGGCATGGGCGACAAGGACCACGAG
CAAGAGGTCAAGGTCTTGGTGGCGCAGACAAAGAGCAAAAAGTTCAACCGGCAGACGGTGGTGGAGCAGGCGCAG
ATGGCAGCCGCCAGCGTGGCGCGCACTTTCCTCGAGGGGCCGATTCTGGCGGTGGAAACGACGGACAATGTCATG
GAGCTGATGCGAGGCGCGCGCATCTCGGAGCCGGAGAGCTGGCGAAGGGTCGAGCACCAGGTGACGACGCTGGAG
CGCAACTATGTGCGCGACGTGCACCGCCAGCTGGAGCAATGGCGATGGGCACACGTCAAGGACGGCGGGCCTCGC
CACTCCTTCATCTACAACTTCCGCACGGGCATGTGCCTGTATTACGATGTAGGGCTGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail